HHsearch alignment for GI: 254780824 and conserved domain: PRK13634

>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=94.98  E-value=0.023  Score=34.92  Aligned_cols=30  Identities=30%  Similarity=0.445  Sum_probs=26.1

Q ss_pred             HCCCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             458996999987878688999999997607
Q gi|254780824|r   29 ILRLGDCLTLSGDLGSGKSFLARSIIRFLM   58 (162)
Q Consensus        29 ~l~~g~ii~L~GdLGaGKTtfvr~i~~~lg   58 (162)
T Consensus        16 ~i~~Ge~vaiiG~sGsGKSTLl~~l~GLl~   45 (276)
T PRK13634         16 SIPSGSYVAIIGHTGSGKSTLLQHLNGLLK   45 (276)
T ss_pred             EECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             998998999999999699999999974999