HHsearch alignment for GI: 254780824 and conserved domain: PRK13643

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=95.12  E-value=0.022  Score=35.10  Aligned_cols=34  Identities=29%  Similarity=0.388  Sum_probs=28.3

Q ss_pred             HHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCC
Q ss_conf             9984589969999878786889999999976078
Q gi|254780824|r   26 LASILRLGDCLTLSGDLGSGKSFLARSIIRFLMH   59 (162)
Q Consensus        26 la~~l~~g~ii~L~GdLGaGKTtfvr~i~~~lg~   59 (162)
T Consensus        25 Isl~I~~Ge~vaiiG~nGsGKSTLl~~l~Gll~p   58 (288)
T PRK13643         25 IDLEVKKGSYTALIGHTGSGKSTLLQHLNGLLQP   58 (288)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCC
T ss_conf             3679859989999999994799999999748888