HHsearch alignment for GI: 254780824 and conserved domain: TIGR02639

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461 Proteins in this entry are related to ClpA () from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins..
Probab=96.89  E-value=0.002  Score=41.43  Aligned_cols=30  Identities=23%  Similarity=0.260  Sum_probs=27.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCC
Q ss_conf             899699998787868899999999760788
Q gi|254780824|r   31 RLGDCLTLSGDLGSGKSFLARSIIRFLMHD   60 (162)
Q Consensus        31 ~~g~ii~L~GdLGaGKTtfvr~i~~~lg~~   60 (162)
T Consensus       525 kP~GSFLF~GPTGVGKTElak~LA~~LGv~  554 (774)
T TIGR02639       525 KPVGSFLFVGPTGVGKTELAKQLAEELGVH  554 (774)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHHCCH
T ss_conf             816888864798962578899999970820