HHsearch alignment for GI: 254780824 and conserved domain: TIGR02640

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR013462 The GvpN protein is associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy , . It belongs to a larger family of ATPases .; GO: 0000166 nucleotide binding, 0005524 ATP binding, 0031412 gas vesicle organization and biogenesis, 0031411 gas vesicle.
Probab=96.57  E-value=0.0045  Score=39.27  Aligned_cols=97  Identities=22%  Similarity=0.229  Sum_probs=63.1

Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC-----CCCCCCCCHHHHHHHCCCCCCEEEEEEE---
Q ss_conf             99999999999845899699998787868899999999760788-----8530245202011003788608999865---
Q gi|254780824|r   17 KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD-----DALEVLSPTFTLVQLYDASIPVAHFDFY---   88 (162)
Q Consensus        17 ~~t~~la~~la~~l~~g~ii~L~GdLGaGKTtfvr~i~~~lg~~-----~~~~V~SPTF~l~~~Y~~~~~i~H~DlY---   88 (162)
T Consensus         5 ~~v~~v~~R~l~yL~~G~PvHl~GPaG~GKT~LA~hvA~~r~RPV~l~~Gd~e--L~~~DLvG~~~g~~~~kv~Dqfihn   82 (265)
T TIGR02640         5 DAVKRVTSRALRYLKSGYPVHLRGPAGTGKTTLAMHVARKRDRPVVLINGDAE--LTTSDLVGSYAGYTRKKVVDQFIHN   82 (265)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCEEEEECCCC--CCCCCCCCCCCCCEEEEEEECCEEE
T ss_conf             23799999876632278866744788855689999999736896899865823--2654423154675222232012111


Q ss_pred             --CCCCH--HHHHCCCHHHHCCCCEEEE--ECH
Q ss_conf             --17897--7753058367508978999--985
Q gi|254780824|r   89 --RLSSH--QEVVELGFDEILNERICII--EWP  115 (162)
Q Consensus        89 --RL~~~--~E~~~lg~~e~~~~~i~lI--EWp  115 (162)
T Consensus        83 V~K~~d~~~~~W~D~rLt~Av~eG~TLVYdEF~  115 (265)
T TIGR02640        83 VVKLEDIVRQNWVDNRLTLAVREGFTLVYDEFT  115 (265)
T ss_pred             EECCCCCCCCCCCCCHHHHHHHCCCEEEECCCC
T ss_conf             342512200266783578997569727664757