HHsearch alignment for GI: 254780824 and conserved domain: cd02020

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.
Probab=94.92  E-value=0.025  Score=34.72  Aligned_cols=92  Identities=21%  Similarity=0.215  Sum_probs=54.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCCC--CCCCCCHHHHHHHCCCC-CCEEEEEEECCCCHHHHHCCCHHHHCCCCEEE
Q ss_conf             9999878786889999999976078885--30245202011003788-60899986517897775305836750897899
Q gi|254780824|r   35 CLTLSGDLGSGKSFLARSIIRFLMHDDA--LEVLSPTFTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICI  111 (162)
Q Consensus        35 ii~L~GdLGaGKTtfvr~i~~~lg~~~~--~~V~SPTF~l~~~Y~~~-~~i~H~DlYRL~~~~E~~~lg~~e~~~~~i~l  111 (162)
T Consensus         1 iIaIdGpagsGKsT~ak~lA~~l~~~~ldtG~ir~~ev~~~~s~ia~~~~V------R----~~l~~~-Qr~~~~~~~~V   69 (147)
T cd02020           1 IIAIDGPAGSGKSTVAKLLAKKLGLPYLDTGGIRTEEVGKLASEVAAIPEV------R----KALDER-QRELAKKPGIV   69 (147)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCEEECCCCCCCHHHHHHHHHHCCCHHH------H----HHHHHH-HHHHHHCCCEE
T ss_conf             988868997898999999999909907766542548998999998197889------9----999999-99997669968


Q ss_pred             EECHHHHHCCCCCCEEEEEEEECCCE
Q ss_conf             99855632049954099999873987
Q gi|254780824|r  112 IEWPEIGRSLLPKKYIDIHLSQGKTG  137 (162)
Q Consensus       112 IEWpe~~~~~lp~~~i~I~i~~~~~~  137 (162)
T Consensus        70 ~eGRDigtvV~P~A~lKifL~As~e~   95 (147)
T cd02020          70 LEGRDIGTVVFPDADLKIFLTASPEV   95 (147)
T ss_pred             EECCCCCCEECCCCCEEEEEECCHHH
T ss_conf             97131010244674767777589899