HHsearch alignment for GI: 254780824 and conserved domain: cd03232

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.77  E-value=0.0095  Score=37.30  Aligned_cols=30  Identities=23%  Similarity=0.438  Sum_probs=25.7

Q ss_pred             HHHHCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             998458996999987878688999999997
Q gi|254780824|r   26 LASILRLGDCLTLSGDLGSGKSFLARSIIR   55 (162)
Q Consensus        26 la~~l~~g~ii~L~GdLGaGKTtfvr~i~~   55 (162)
T Consensus        26 is~~i~~Ge~~~llGpnGaGKSTLl~~l~g   55 (192)
T cd03232          26 ISGYVKPGTLTALMGESGAGKTTLLDVLAG   55 (192)
T ss_pred             CEEEEECCEEEEEECCCCCCHHHHHHHHHC
T ss_conf             388992883999999999988999999837