HHsearch alignment for GI: 254780824 and conserved domain: cd03266

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=95.55  E-value=0.014  Score=36.19  Aligned_cols=33  Identities=27%  Similarity=0.372  Sum_probs=28.3

Q ss_pred             HHCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC
Q ss_conf             845899699998787868899999999760788
Q gi|254780824|r   28 SILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD   60 (162)
Q Consensus        28 ~~l~~g~ii~L~GdLGaGKTtfvr~i~~~lg~~   60 (162)
T Consensus        26 ~~i~~Gei~gllG~NGaGKSTllk~i~Gl~~p~   58 (218)
T cd03266          26 FTVKPGEVTGLLGPNGAGKTTTLRMLAGLLEPD   58 (218)
T ss_pred             EEECCCCEEEEECCCCCCHHHHHHHHHCCCCCC
T ss_conf             898598299999999984999999997797789