HHsearch alignment for GI: 254780824 and conserved domain: cd04153

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus. Arl5 is developmentally regulated during embryogenesis in mice. Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion. Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library. It is found in brain, heart, lung, cartilage, and kidney. No function has been assigned for Arl8 to date.
Probab=94.33  E-value=0.094  Score=31.27  Aligned_cols=72  Identities=10%  Similarity=0.151  Sum_probs=40.7

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHCCCCCCEEEEEEECCCCHHHHHCCCHHHHCC--CCEEE
Q ss_conf             6999987878688999999997607888530245202011003788608999865178977753058367508--97899
Q gi|254780824|r   34 DCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILN--ERICI  111 (162)
Q Consensus        34 ~ii~L~GdLGaGKTtfvr~i~~~lg~~~~~~V~SPTF~l~~~Y~~~~~i~H~DlYRL~~~~E~~~lg~~e~~~--~~i~l  111 (162)
T Consensus        16 ~KililG~~~sGKTsil~~l~~~~~~-----~~~pT~G~-~~~~i~~~~~~~~iwD~~G~e~~~~~-~~~y~~~a~~ii~   88 (174)
T cd04153          16 YKVIIVGLDNAGKTTILYQFLLGEVV-----HTSPTIGS-NVEEIVYKNIRFLMWDIGGQESLRSS-WNTYYTNTDAVIL   88 (174)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCC-----CCCCCCCC-CEEEEEECCEEEEEEECCCCCCCCCH-HHHHHCCCCEEEE
T ss_conf             99999989999889999999739927-----71672360-46999978889999989998656622-6777057753799


Q ss_pred             E
Q ss_conf             9
Q gi|254780824|r  112 I  112 (162)
Q Consensus       112 I  112 (162)
T Consensus        89 V   89 (174)
T cd04153          89 V   89 (174)
T ss_pred             E
T ss_conf             9