HHsearch alignment for GI: 254780824 and conserved domain: cd04155

>cd04155 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension. In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form. The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector. Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2). It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery. In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=94.25  E-value=0.14  Score=30.30  Aligned_cols=70  Identities=7%  Similarity=0.174  Sum_probs=37.4

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHH--HHHHCCCCCCEEEEEEECCCCHHHHHCCCHHHHCC--CC
Q ss_conf             969999878786889999999976078885302452020--11003788608999865178977753058367508--97
Q gi|254780824|r   33 GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFT--LVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILN--ER  108 (162)
Q Consensus        33 g~ii~L~GdLGaGKTtfvr~i~~~lg~~~~~~V~SPTF~--l~~~Y~~~~~i~H~DlYRL~~~~E~~~lg~~e~~~--~~  108 (162)
T Consensus        14 ~~Ki~ilG~~~sGKTsll~~l~~~~-~~----~~~pT~g~~~~~v~~~~---~~~~lwD~~G~~~~~~~-~~~y~~~a~~   84 (173)
T cd04155          14 EPRILILGLDNAGKTTILKQLASED-IS----HITPTQGFNIKTVQSDG---FKLNVWDIGGQRAIRPY-WRNYFENTDC   84 (173)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCC-CC----CCCCCCCEEEEEEEECC---EEEEEEECCCCHHHHHH-HHHHCCCCCE
T ss_conf             7589999799998899999985699-86----60681132379999899---99999855875101268-9976555637


Q ss_pred             EEE
Q ss_conf             899
Q gi|254780824|r  109 ICI  111 (162)
Q Consensus       109 i~l  111 (162)
T Consensus        85 iI~   87 (173)
T cd04155          85 LIY   87 (173)
T ss_pred             EEE
T ss_conf             999