HHsearch alignment for GI: 254780824 and conserved domain: cd04159

>cd04159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identified from a human cancer-derived EST dataset. No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=93.62  E-value=0.26  Score=28.60  Aligned_cols=68  Identities=19%  Similarity=0.299  Sum_probs=40.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHH--HHHHCCCCCCEEEEEEECCCCHHHHHCCCHHHHCC--CCEEE
Q ss_conf             999878786889999999976078885302452020--11003788608999865178977753058367508--97899
Q gi|254780824|r   36 LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFT--LVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILN--ERICI  111 (162)
Q Consensus        36 i~L~GdLGaGKTtfvr~i~~~lg~~~~~~V~SPTF~--l~~~Y~~~~~i~H~DlYRL~~~~E~~~lg~~e~~~--~~i~l  111 (162)
T Consensus         2 I~llG~~~~GKTsll~~~~~~~f~~~----~~pTig~~~~~i~~~~---~~l~iwDt~G~e~~~~l-~~~y~~~~~~ii~   73 (159)
T cd04159           2 ITLVGLQNSGKTTLVNVIAGGQFSED----TIPTVGFNMRKVTKGN---VTLKVWDLGGQPRFRSM-WERYCRGVNAIVY   73 (159)
T ss_pred             EEEECCCCCCHHHHHHHHHCCCCCCC----CCCCCCEEEEEEEECC---EEEEEEECCCHHHHHHH-HHHHHCCCCEEEE
T ss_conf             89999999869999999975999886----1673250589999899---99999979835877999-9987468636875