HHsearch alignment for GI: 254780824 and conserved domain: pfam00004

>pfam00004 AAA ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.
Probab=96.00  E-value=0.0068  Score=38.17  Aligned_cols=34  Identities=29%  Similarity=0.408  Sum_probs=27.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCHH
Q ss_conf             99987878688999999997607888530245202
Q gi|254780824|r   36 LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF   70 (162)
Q Consensus        36 i~L~GdLGaGKTtfvr~i~~~lg~~~~~~V~SPTF   70 (162)
T Consensus         1 iLl~GppGtGKT~~a~~la~~~~~~~-~~v~~~~~   34 (131)
T pfam00004         1 LLLYGPPGTGKTTLAKAVAKELGAPF-IEISGSEL   34 (131)
T ss_pred             CEEECCCCCCHHHHHHHHHHHHCCCC-EECCCCCC
T ss_conf             98789999999999999999978985-33242012