HHsearch alignment for GI: 254780824 and conserved domain: pfam00437

>pfam00437 GSPII_E Type II/IV secretion system protein. This family contains both type II and type IV pathway secretion proteins from bacteria. VirB11 ATPase is a subunit of the Agrobacterium tumefaciens transfer DNA (T-DNA) transfer system, a type IV secretion pathway required for delivery of T-DNA and effector proteins to plant cells during infection.
Probab=96.72  E-value=0.0031  Score=40.26  Aligned_cols=42  Identities=19%  Similarity=0.255  Sum_probs=35.0

Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCC
Q ss_conf             999999999984589969999878786889999999976078
Q gi|254780824|r   18 NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMH   59 (162)
Q Consensus        18 ~t~~la~~la~~l~~g~ii~L~GdLGaGKTtfvr~i~~~lg~   59 (162)
T Consensus       124 ~~~~~~~~L~~~v~~~~~ilIsG~TGSGKTT~l~all~~i~~  165 (283)
T pfam00437       124 FDADIAEFLRQAVQARGNILVSGGTGSGKTTLLYALLNEINT  165 (283)
T ss_pred             CHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHCCC
T ss_conf             859999999999981975999889999889999999984087