HHsearch alignment for GI: 254780824 and conserved domain: pfam03969

>pfam03969 AFG1_ATPase AFG1-like ATPase. This family of proteins contains a P-loop motif and are predicted to be ATPases.
Probab=95.19  E-value=0.11  Score=30.78  Aligned_cols=113  Identities=17%  Similarity=0.252  Sum_probs=74.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCC-------------------CCCCHHHHHHHCCCCCCEEEEEEECCCC
Q ss_conf             996999987878688999999997607888530-------------------2452020110037886089998651789
Q gi|254780824|r   32 LGDCLTLSGDLGSGKSFLARSIIRFLMHDDALE-------------------VLSPTFTLVQLYDASIPVAHFDFYRLSS   92 (162)
Q Consensus        32 ~g~ii~L~GdLGaGKTtfvr~i~~~lg~~~~~~-------------------V~SPTF~l~~~Y~~~~~i~H~DlYRL~~   92 (162)
T Consensus        60 ~~kGlYl~G~VGrGKTmLMDlFy~~lp~~~K~R~HFh~FM~~vH~~l~~~~~~~dpl~~va~~l~~~~~lLCfDEFqV~D  139 (361)
T pfam03969        60 PVRGLYLWGGVGRGKTHLMDSFFESLPGERKRRTHFHRFMFRVHDELTTLQGGDDPLPIAADRFANEARLLCFDEFEVDD  139 (361)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCEEEEEEEEECC
T ss_conf             99868988998886999999999867753444566789999999999997667763899999997258779976356167


Q ss_pred             HHHHHCCC--HHHHCCCCEEEEECHHHHHC-----------CCC------CCEEEEEEEECCCEEEEEEEE
Q ss_conf             77753058--36750897899998556320-----------499------540999998739876999995
Q gi|254780824|r   93 HQEVVELG--FDEILNERICIIEWPEIGRS-----------LLP------KKYIDIHLSQGKTGRKATISA  144 (162)
Q Consensus        93 ~~E~~~lg--~~e~~~~~i~lIEWpe~~~~-----------~lp------~~~i~I~i~~~~~~R~i~i~~  144 (162)
T Consensus       140 IaDAMIL~rLf~~Lf~~gvvlV~TSN~~P~~LY~~GLqR~~FlPfI~ll~~~~~v~~l~~~~DYR~~~~~~  210 (361)
T pfam03969       140 IGDAMILGRLFEALFARGVSLVATSNTAPEQLYRNGLNRQRFLPAIDLLESHFEVVRVDGPVDYRLRTLEQ  210 (361)
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHCCCCCHHHHHHHHHHHHHHCEEEEECCCCCCCCCCCCC
T ss_conf             88899999999999977978998089998998368741778899999999867899815987805465655