HHsearch alignment for GI: 254780824 and conserved domain: smart00175

>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=94.47  E-value=0.13  Score=30.41  Aligned_cols=60  Identities=15%  Similarity=0.219  Sum_probs=35.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHH---HHCCCCCCEEEEEEECCCCHHHHHCC
Q ss_conf             99987878688999999997607888530245202011---00378860899986517897775305
Q gi|254780824|r   36 LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV---QLYDASIPVAHFDFYRLSSHQEVVEL   99 (162)
Q Consensus        36 i~L~GdLGaGKTtfvr~i~~~lg~~~~~~V~SPTF~l~---~~Y~~~~~i~H~DlYRL~~~~E~~~l   99 (162)
T Consensus         3 i~vvG~~~vGKTsli~r~~~~~f~~~----~~~Ti~~~~~~~~i~~~~~~~~l~iwDt~G~e~~~~l   65 (164)
T smart00175        3 IILIGDSGVGKSSLLSRFTDGKFSEQ----YKSTIGVDFKTKTIEVDGKRVKLQIWDTAGQERFRSI   65 (164)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCCCC----CCCCCCEEEEEEEEEECCEEEEEEEEECCCCHHHHHH
T ss_conf             99999899779999999941999998----6884566667799999999999999967994466477