BLAST/PSIBLAST alignment of GI: 254780824 and GI: 150398437 at iteration 1
>gi|150398437|ref|YP_001328904.1| hypothetical protein Smed_3245 [Sinorhizobium medicae WSM419] Length = 504
>gi|150029952|gb|ABR62069.1| protein of unknown function UPF0079 [Sinorhizobium medicae WSM419] Length = 504
 Score =  140 bits (353), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 86/132 (65%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T   G  LA  L+ GDC+ LSGDLG+GKS  AR+ IR +  D+ALEV SPTFTL
Sbjct: 8   LTDEAATNEFGEDLALALKAGDCVALSGDLGAGKSTFARAFIRAMADDEALEVPSPTFTL 67

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  IPVAHFD YRL+   E+ ELGFDE L E IC++EWP+     LP   I + LS
Sbjct: 68  VQSYDLRIPVAHFDLYRLADASELDELGFDEALTEGICLVEWPDRAEEALPAVRITLTLS 127

Query: 133 QGKTGRKATISA 144
               GR+  ++A
Sbjct: 128 HEGDGRRVNVTA 139