BLAST/PSIBLAST alignment of GI: 254780824 and GI: 86355697 at iteration 1
>gi|86355697|ref|YP_467589.1| hypothetical protein RHE_CH00029 [Rhizobium etli CFN 42] Length = 504
>gi|86279799|gb|ABC88862.1| hypothetical conserved protein [Rhizobium etli CFN 42] Length = 504
 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 76/132 (57%), Positives = 92/132 (69%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  TI LG  LA  L+ GDCL LSGDLG+GKS LAR+I+R +  DD LEV SPTFTL
Sbjct: 11  LKDEAATIRLGEDLALALKAGDCLALSGDLGAGKSSLARAILRAIADDDGLEVPSPTFTL 70

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  IPV+HFD YRL    E+ ELGFDE L   IC++EWPE+  S LP + I + L+
Sbjct: 71  VQSYDLRIPVSHFDLYRLGDPDELTELGFDEALQNGICLVEWPEMAASELPTERITLTLA 130

Query: 133 QGKTGRKATISA 144
               GR+ATISA
Sbjct: 131 HEGNGRRATISA 142