BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780824|ref|YP_003065237.1| hypothetical protein
CLIBASIA_03585 [Candidatus Liberibacter asiaticus str. psy62]
         (162 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780824|ref|YP_003065237.1| hypothetical protein CLIBASIA_03585 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040501|gb|ACT57297.1| hypothetical protein CLIBASIA_03585 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 162

 Score =  335 bits (858), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 162/162 (100%), Positives = 162/162 (100%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD
Sbjct: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60

Query: 61  DALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRS 120
           DALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRS
Sbjct: 61  DALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRS 120

Query: 121 LLPKKYIDIHLSQGKTGRKATISAERWIISHINQMNRSTSQQ 162
           LLPKKYIDIHLSQGKTGRKATISAERWIISHINQMNRSTSQQ
Sbjct: 121 LLPKKYIDIHLSQGKTGRKATISAERWIISHINQMNRSTSQQ 162


>gi|315122048|ref|YP_004062537.1| hypothetical protein CKC_01490 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495450|gb|ADR52049.1| hypothetical protein CKC_01490 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 170

 Score =  249 bits (635), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 118/162 (72%), Positives = 139/162 (85%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           MNFS+ H T+I +P+EK+TI LG  LA +L+LGDCLTLSGDLGSGKSFLARSIIRFL ++
Sbjct: 1   MNFSDTHSTIISLPHEKDTILLGHTLAYVLKLGDCLTLSGDLGSGKSFLARSIIRFLSNN 60

Query: 61  DALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRS 120
           + LEVLSPTFTLVQLY+ASIP+AHFDFYRLSSHQE+ ELGFDEILNER+CIIEWP+IG+ 
Sbjct: 61  NELEVLSPTFTLVQLYEASIPIAHFDFYRLSSHQELFELGFDEILNERLCIIEWPDIGKE 120

Query: 121 LLPKKYIDIHLSQGKTGRKATISAERWIISHINQMNRSTSQQ 162
           LLP + I IHL Q K GRKATI + +WIISH+NQM    SQ+
Sbjct: 121 LLPSQCICIHLEQEKNGRKATILSSKWIISHLNQMINQASQE 162


>gi|86355697|ref|YP_467589.1| hypothetical protein RHE_CH00029 [Rhizobium etli CFN 42]
 gi|86279799|gb|ABC88862.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 504

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 76/132 (57%), Positives = 92/132 (69%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  TI LG  LA  L+ GDCL LSGDLG+GKS LAR+I+R +  DD LEV SPTFTL
Sbjct: 11  LKDEAATIRLGEDLALALKAGDCLALSGDLGAGKSSLARAILRAIADDDGLEVPSPTFTL 70

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  IPV+HFD YRL    E+ ELGFDE L   IC++EWPE+  S LP + I + L+
Sbjct: 71  VQSYDLRIPVSHFDLYRLGDPDELTELGFDEALQNGICLVEWPEMAASELPTERITLTLA 130

Query: 133 QGKTGRKATISA 144
               GR+ATISA
Sbjct: 131 HEGNGRRATISA 142


>gi|190889669|ref|YP_001976211.1| hypothetical protein RHECIAT_CH0000030 [Rhizobium etli CIAT 652]
 gi|218517058|ref|ZP_03513898.1| hypothetical protein Retl8_27618 [Rhizobium etli 8C-3]
 gi|190694948|gb|ACE89033.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 503

 Score =  153 bits (387), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 74/132 (56%), Positives = 91/132 (68%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  TI LG  LA  L+ GDCL LSGDLG+GKS LAR+I+R +  DD LEV SPTFTL
Sbjct: 11  LKDEAATIRLGEDLALALKAGDCLALSGDLGAGKSSLARAILRAIADDDGLEVPSPTFTL 70

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  IPV+HFD YRL    E+ ELGFDE L   IC++EWPE+  S  P + I + L+
Sbjct: 71  VQSYDLRIPVSHFDLYRLGDASELTELGFDEALQNGICLVEWPEMAASEFPAERIALTLA 130

Query: 133 QGKTGRKATISA 144
              +GR+ATI A
Sbjct: 131 HEGSGRRATIEA 142


>gi|327192797|gb|EGE59725.1| hypothetical protein RHECNPAF_192005 [Rhizobium etli CNPAF512]
          Length = 503

 Score =  153 bits (387), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 75/132 (56%), Positives = 91/132 (68%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  TI LG  LA  L+ GDCL LSGDLG+GKS LAR+I+R +  DD LEV SPTFTL
Sbjct: 11  LKDEAATIRLGEDLALALKAGDCLALSGDLGAGKSSLARAILRAIADDDGLEVPSPTFTL 70

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  IPV+HFD YRL    E+ ELGFDE L   IC++EWPE+  S LP + I + L 
Sbjct: 71  VQSYDLRIPVSHFDLYRLGDASELTELGFDEALQNGICLVEWPEMAASELPAERIALMLV 130

Query: 133 QGKTGRKATISA 144
              +GR+ATI A
Sbjct: 131 HEGSGRRATIEA 142


>gi|241206972|ref|YP_002978068.1| hypothetical protein Rleg_4289 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860862|gb|ACS58529.1| protein of unknown function UPF0079 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 505

 Score =  150 bits (378), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 73/132 (55%), Positives = 91/132 (68%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  TI LG  LA  L+ GDCL LSGDLG+GKS LAR+I+R +  D+ LEV SPTFTL
Sbjct: 11  LKDEAATIRLGEDLALALKAGDCLALSGDLGAGKSSLARAILRAMADDEGLEVPSPTFTL 70

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  I V+HFD YRL    E+ ELGFDE L   IC++EWPE+  S LP + I + L+
Sbjct: 71  VQSYDLRIAVSHFDLYRLGDPAELTELGFDEALQNGICLVEWPEMAESELPAERITLTLA 130

Query: 133 QGKTGRKATISA 144
              +GR+ATI A
Sbjct: 131 HEGSGRRATIEA 142


>gi|116249795|ref|YP_765633.1| hypothetical protein RL0029 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115254443|emb|CAK05517.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 505

 Score =  149 bits (377), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 73/132 (55%), Positives = 92/132 (69%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  TI LG  LA  L+ GDCL LSGDLG+GKS LAR+I+R +  D+ LEV SPTFTL
Sbjct: 11  LKDEAATIRLGEDLALALKAGDCLALSGDLGAGKSSLARAILRAMADDEGLEVPSPTFTL 70

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  I V+HFD YRL    E+ ELGFDE L   IC++EWPE+ +S LP + I + L+
Sbjct: 71  VQSYDLRIAVSHFDLYRLGDPAELTELGFDEALQNGICLVEWPEMAQSELPAERIALTLA 130

Query: 133 QGKTGRKATISA 144
              +GR+ATI A
Sbjct: 131 HEGSGRRATIEA 142


>gi|209551533|ref|YP_002283450.1| hypothetical protein Rleg2_3962 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537289|gb|ACI57224.1| protein of unknown function UPF0079 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 503

 Score =  149 bits (376), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 74/143 (51%), Positives = 92/143 (64%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  TI  G  LA  L+ GDCL LSGDLG+GKS LAR+I+R +  D+ LEV SPTFTL
Sbjct: 11  LKDEAATIRFGEDLALALKAGDCLALSGDLGAGKSSLARAILRAMADDEGLEVPSPTFTL 70

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  IPV+HFD YRL    E+ ELGFDE L   IC++EWPE+    LP   I + L 
Sbjct: 71  VQSYDLRIPVSHFDLYRLGDPAELTELGFDEALENGICLVEWPEMAEGELPADRIALRLD 130

Query: 133 QGKTGRKATISAERWIISHINQM 155
              +GR+ATI A     S I ++
Sbjct: 131 HEDSGRRATIKAAEPQASRIRRV 153


>gi|218461896|ref|ZP_03501987.1| hypothetical protein RetlK5_21498 [Rhizobium etli Kim 5]
          Length = 493

 Score =  149 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 74/132 (56%), Positives = 90/132 (68%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  TI LG  LA  L+ GD L LSGDLG+GKS LAR+I+R +  DD LEV SPTFTL
Sbjct: 11  LKDEAATIRLGEDLALALKAGDYLALSGDLGAGKSSLARAILRAMADDDGLEVPSPTFTL 70

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  IPV+HFD YRL    E+ ELGFDE L   IC++EWPE+  S LP + I + L 
Sbjct: 71  VQSYDLRIPVSHFDLYRLGDASELTELGFDEALQNGICLVEWPEMADSELPAERIALTLV 130

Query: 133 QGKTGRKATISA 144
              +GR+ATI A
Sbjct: 131 HEGSGRRATIEA 142


>gi|150398437|ref|YP_001328904.1| hypothetical protein Smed_3245 [Sinorhizobium medicae WSM419]
 gi|150029952|gb|ABR62069.1| protein of unknown function UPF0079 [Sinorhizobium medicae WSM419]
          Length = 504

 Score =  140 bits (353), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 86/132 (65%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T   G  LA  L+ GDC+ LSGDLG+GKS  AR+ IR +  D+ALEV SPTFTL
Sbjct: 8   LTDEAATNEFGEDLALALKAGDCVALSGDLGAGKSTFARAFIRAMADDEALEVPSPTFTL 67

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  IPVAHFD YRL+   E+ ELGFDE L E IC++EWP+     LP   I + LS
Sbjct: 68  VQSYDLRIPVAHFDLYRLADASELDELGFDEALTEGICLVEWPDRAEEALPAVRITLTLS 127

Query: 133 QGKTGRKATISA 144
               GR+  ++A
Sbjct: 128 HEGDGRRVNVTA 139


>gi|15887385|ref|NP_353066.1| hypothetical protein Atu0026 [Agrobacterium tumefaciens str. C58]
 gi|15154888|gb|AAK85851.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 503

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 89/135 (65%), Gaps = 1/135 (0%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I +  EK+TI LG  LA  L+ GDCLTL GDLG+GKS LAR+ IR +  +  LEV SPTF
Sbjct: 10  ISLAGEKDTIRLGEDLALALKPGDCLTLIGDLGAGKSTLARAFIRAMADEPDLEVPSPTF 69

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLL-PKKYIDI 129
           T++Q Y   IPVAH D YRLS   E+ ELG DE+L + IC+IEWP+I   +L P + I +
Sbjct: 70  TIIQTYTTRIPVAHLDLYRLSDVSELDELGIDEMLEDGICLIEWPDIAAEVLPPAQTITL 129

Query: 130 HLSQGKTGRKATISA 144
            L+    GR A I A
Sbjct: 130 QLTHSGEGRVAVIEA 144


>gi|260463221|ref|ZP_05811423.1| protein of unknown function UPF0079 [Mesorhizobium opportunistum
           WSM2075]
 gi|259031071|gb|EEW32345.1| protein of unknown function UPF0079 [Mesorhizobium opportunistum
           WSM2075]
          Length = 503

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 71/133 (53%), Positives = 85/133 (63%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T  LG  LA  LR GD L L GDLG+GKS LAR++IR L  D  L+V SPTFTL
Sbjct: 10  LADETETARLGEDLALALRAGDVLALKGDLGAGKSTLARALIRTLADDAGLDVPSPTFTL 69

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  IPV HFD YRLSS  E+ ELGFDE L +   ++EWPE     LPK  + I L 
Sbjct: 70  VQSYDTRIPVHHFDLYRLSSAAELDELGFDEALTQGAALVEWPERAEGYLPKASLLIELV 129

Query: 133 QGKTGRKATISAE 145
           Q   GR+A +S +
Sbjct: 130 QHGEGRQARLSGQ 142


>gi|15963790|ref|NP_384143.1| hypothetical protein SMc02757 [Sinorhizobium meliloti 1021]
 gi|15072965|emb|CAC41424.1| Hypothetical protein SMc02757 [Sinorhizobium meliloti 1021]
          Length = 504

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 85/132 (64%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  TI  G  LA  L+ G+C+ LSGDLG+GKS  AR+ IR +  D+ LEV SPTFTL
Sbjct: 8   LKDEAATIEFGEDLALALKAGECVALSGDLGAGKSTFARAFIRAMADDETLEVPSPTFTL 67

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  IPVAHFD YRL+   E+ ELGFDE L + IC++EWPE     LP   I +  S
Sbjct: 68  VQSYDLRIPVAHFDLYRLADASELDELGFDEALADGICLVEWPEKAEEALPADRITLTFS 127

Query: 133 QGKTGRKATISA 144
               GR+  ++A
Sbjct: 128 HEDDGRRIHLTA 139


>gi|307322011|ref|ZP_07601390.1| protein of unknown function UPF0079 [Sinorhizobium meliloti AK83]
 gi|306892349|gb|EFN23156.1| protein of unknown function UPF0079 [Sinorhizobium meliloti AK83]
          Length = 504

 Score =  137 bits (344), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 85/132 (64%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  TI  G  LA  L+ G+C+ LSGDLG+GKS  AR+ IR +  D+ LEV SPTFTL
Sbjct: 8   LKDEAATIEFGEDLALALKAGECVALSGDLGAGKSTFARAFIRAMADDETLEVPSPTFTL 67

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  IPVAHFD YRL+   E+ ELGFDE L + IC++EWPE     LP   I +  S
Sbjct: 68  VQSYDLRIPVAHFDLYRLADASELDELGFDEALADGICLVEWPEKAEEALPADRITLTFS 127

Query: 133 QGKTGRKATISA 144
               GR+  ++A
Sbjct: 128 HEDDGRRIHLTA 139


>gi|13474242|ref|NP_105810.1| hypothetical protein mll5086 [Mesorhizobium loti MAFF303099]
 gi|14024994|dbj|BAB51596.1| mll5086 [Mesorhizobium loti MAFF303099]
          Length = 503

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 70/133 (52%), Positives = 84/133 (63%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T  LG  LA  LR GD L L GDLG+GKS LAR++IR L  D  L+V SPTFTL
Sbjct: 10  LADETQTARLGEDLALSLRAGDVLALKGDLGAGKSTLARALIRALADDAGLDVPSPTFTL 69

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  IPV HFD YRLSS  E+ ELGFDE L +   ++EWP+     LPK  + I L 
Sbjct: 70  VQSYDTRIPVHHFDLYRLSSASELDELGFDEALTQGAALVEWPDRAEGYLPKTTLSIELV 129

Query: 133 QGKTGRKATISAE 145
           Q   GR A +S +
Sbjct: 130 QHGEGRLARLSGQ 142


>gi|319780207|ref|YP_004139683.1| hypothetical protein Mesci_0461 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166095|gb|ADV09633.1| Uncharacterized protein family UPF0079, ATPase [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 503

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 71/133 (53%), Positives = 85/133 (63%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T  LG  LA  LR GD L L GDLG+GKS LAR++IR L  D  L+V SPTFTL
Sbjct: 10  LADETQTARLGEDLALSLRPGDVLALKGDLGAGKSTLARALIRTLADDAGLDVPSPTFTL 69

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  IPV HFD YRLSS  E+ ELGFDE L +   ++EWPE   + LPK  + I L 
Sbjct: 70  VQSYDTRIPVHHFDLYRLSSADEIDELGFDEALAQGAALVEWPERAEAHLPKTTVLIELV 129

Query: 133 QGKTGRKATISAE 145
           Q   GR A +S +
Sbjct: 130 QHGNGRLARLSGQ 142


>gi|227823896|ref|YP_002827869.1| putatuive aminoglycoside phosphotransferase [Sinorhizobium fredii
           NGR234]
 gi|227342898|gb|ACP27116.1| putatuive aminoglycoside phosphotransferase [Sinorhizobium fredii
           NGR234]
          Length = 501

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 86/132 (65%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  TI LG  LA  L+ GDC+ LSGDLG+GKS  AR+ +R +  D+ LEV SPTFT+
Sbjct: 8   LKDEAATIELGEDLALALKKGDCVGLSGDLGAGKSTFARAFLRAMADDEGLEVPSPTFTV 67

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ Y+  IPVAHFD YRL+   E+ ELGFDE L E IC++EWPE     LP + I +  +
Sbjct: 68  VQSYELRIPVAHFDLYRLADASELDELGFDEALAEGICLVEWPEKAAEALPAERIMLSFT 127

Query: 133 QGKTGRKATISA 144
               GR+  I+ 
Sbjct: 128 HEGEGRRVRITG 139


>gi|307310978|ref|ZP_07590623.1| protein of unknown function UPF0079 [Sinorhizobium meliloti BL225C]
 gi|306899658|gb|EFN30285.1| protein of unknown function UPF0079 [Sinorhizobium meliloti BL225C]
          Length = 504

 Score =  134 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 84/132 (63%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  TI  G  LA  L+ G+C+ LSGDLG+GKS  AR+ IR +  D+ LEV SPTFTL
Sbjct: 8   LKDEAATIEFGEDLALALKAGECVALSGDLGAGKSTFARAFIRAMADDETLEVPSPTFTL 67

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ YD  IPVAHFD YRL+   E+ ELGFDE L + IC++EW E     LP   I +  S
Sbjct: 68  VQSYDLRIPVAHFDLYRLADASELDELGFDEALADGICLVEWSEKAEEALPADRITLTFS 127

Query: 133 QGKTGRKATISA 144
               GR+  ++A
Sbjct: 128 HEDDGRRIHLTA 139


>gi|325291479|ref|YP_004277343.1| hypothetical protein AGROH133_02832 [Agrobacterium sp. H13-3]
 gi|325059332|gb|ADY63023.1| hypothetical protein AGROH133_02832 [Agrobacterium sp. H13-3]
          Length = 501

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 69/131 (52%), Positives = 84/131 (64%), Gaps = 1/131 (0%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            EK+TI LG  LA  L  GDCL L GDLG+GKS LAR+ IR +     LEV SPTFT++Q
Sbjct: 14  GEKDTIRLGEDLALALGAGDCLALIGDLGAGKSTLARAFIRAMADAPDLEVPSPTFTIIQ 73

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLL-PKKYIDIHLSQ 133
            Y   IPVAH D YRLS   E+ ELG DE+L + IC+IEWP+I  ++L P + I + L  
Sbjct: 74  TYPTRIPVAHLDLYRLSDVSELDELGIDEMLEDGICLIEWPDIAAAILPPNQTIRLRLEH 133

Query: 134 GKTGRKATISA 144
              GR A I A
Sbjct: 134 SGDGRLAVIDA 144


>gi|222084230|ref|YP_002542756.1| hypothetical protein Arad_0037 [Agrobacterium radiobacter K84]
 gi|221721678|gb|ACM24834.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 503

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 71/132 (53%), Positives = 91/132 (68%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + ++  T  LG  LA  L++GDC+ LSGDLG+GKS LAR+++R L  D  L+V SPTFTL
Sbjct: 12  LADDAATTRLGEDLALALKVGDCVALSGDLGAGKSSLARALLRALADDADLDVPSPTFTL 71

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ Y+  IPV+HFD YRL    E+ ELGFDE L   IC++EWPE+  S LPK+ ID+ L 
Sbjct: 72  VQSYELRIPVSHFDLYRLGDPSELAELGFDEALQTGICLVEWPEMAESELPKERIDLKLE 131

Query: 133 QGKTGRKATISA 144
               GR+ATI A
Sbjct: 132 HEAEGRRATIVA 143


>gi|265993861|ref|ZP_06106418.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262764842|gb|EEZ10763.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 511

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 68/147 (46%), Positives = 92/147 (62%), Gaps = 4/147 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 12  LPDEAATLRFGEDFALALQKGDFITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 71

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRLS+ +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 72  VQSYEALRLPVAHADLYRLSTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 131

Query: 132 SQGKTGRKATISAERWIISHINQMNRS 158
           S    GR   I+ ++     + Q+ RS
Sbjct: 132 SHEGAGRHILITGQQ---PAMEQLERS 155


>gi|256112423|ref|ZP_05453344.1| hypothetical protein Bmelb3E_07053 [Brucella melitensis bv. 3 str.
           Ether]
          Length = 513

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 68/147 (46%), Positives = 92/147 (62%), Gaps = 4/147 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 14  LPDEAATLRFGEDFALALQKGDFITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 73

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRLS+ +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 74  VQSYEALRLPVAHADLYRLSTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 133

Query: 132 SQGKTGRKATISAERWIISHINQMNRS 158
           S    GR   I+ ++     + Q+ RS
Sbjct: 134 SHEGAGRHILITGQQ---PAMEQLERS 157


>gi|260546205|ref|ZP_05821945.1| ATP/GTP-binding protein [Brucella abortus NCTC 8038]
 gi|260563005|ref|ZP_05833491.1| ATP/GTP-binding protein [Brucella melitensis bv. 1 str. 16M]
 gi|260755774|ref|ZP_05868122.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260758997|ref|ZP_05871345.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260760721|ref|ZP_05873064.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884798|ref|ZP_05896412.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261215050|ref|ZP_05929331.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|265992124|ref|ZP_06104681.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265999250|ref|ZP_05465520.2| ATP/GTP-binding protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260096312|gb|EEW80188.1| ATP/GTP-binding protein [Brucella abortus NCTC 8038]
 gi|260153021|gb|EEW88113.1| ATP/GTP-binding protein [Brucella melitensis bv. 1 str. 16M]
 gi|260669315|gb|EEX56255.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260671153|gb|EEX57974.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675882|gb|EEX62703.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260874326|gb|EEX81395.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260916657|gb|EEX83518.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|263003190|gb|EEZ15483.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263092861|gb|EEZ17036.1| ATP/GTP-binding protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326410097|gb|ADZ67162.1| ATP/GTP-binding protein [Brucella melitensis M28]
 gi|326539814|gb|ADZ88029.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 511

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 87/135 (64%), Gaps = 1/135 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 12  LPDEAATLRFGEDFALALQKGDFITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 71

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRLS+ +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 72  VQSYEALRLPVAHADLYRLSTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 131

Query: 132 SQGKTGRKATISAER 146
           S    GR   I+ ++
Sbjct: 132 SHEGAGRHILITGQQ 146


>gi|17988309|ref|NP_540943.1| 7.5 kDa chlorosome protein [Brucella melitensis bv. 1 str. 16M]
 gi|62290942|ref|YP_222735.1| hypothetical protein BruAb1_2075 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700853|ref|YP_415427.1| ATP/GTP-binding protein [Brucella melitensis biovar Abortus 2308]
 gi|189025154|ref|YP_001935922.1| ATP/GTP-binding protein [Brucella abortus S19]
 gi|225853528|ref|YP_002733761.1| hypothetical protein BMEA_A2161 [Brucella melitensis ATCC 23457]
 gi|237816447|ref|ZP_04595440.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|254690233|ref|ZP_05153487.1| hypothetical protein Babob68_08692 [Brucella abortus bv. 6 str.
           870]
 gi|254694721|ref|ZP_05156549.1| hypothetical protein Babob3T_08688 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696349|ref|ZP_05158177.1| hypothetical protein Babob28_01183 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731264|ref|ZP_05189842.1| hypothetical protein Babob42_08710 [Brucella abortus bv. 4 str.
           292]
 gi|256045703|ref|ZP_05448581.1| hypothetical protein Bmelb1R_14455 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256258486|ref|ZP_05464022.1| hypothetical protein Babob9C_14297 [Brucella abortus bv. 9 str.
           C68]
 gi|297247327|ref|ZP_06931045.1| hypothetical protein BAYG_00227 [Brucella abortus bv. 5 str. B3196]
 gi|17984082|gb|AAL53207.1| 7.5 kDa chlorosome protein [Brucella melitensis bv. 1 str. 16M]
 gi|62197074|gb|AAX75374.1| conserved hypothetical protein TIGR00150 [Brucella abortus bv. 1
           str. 9-941]
 gi|82616954|emb|CAJ12058.1| ATP/GTP-binding site motif A (P-loop):Protein of unknown function
           UPF0079 [Brucella melitensis biovar Abortus 2308]
 gi|189020726|gb|ACD73448.1| ATP/GTP-binding protein [Brucella abortus S19]
 gi|225641893|gb|ACO01807.1| conserved hypothetical protein [Brucella melitensis ATCC 23457]
 gi|237788514|gb|EEP62729.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|297174496|gb|EFH33843.1| hypothetical protein BAYG_00227 [Brucella abortus bv. 5 str. B3196]
          Length = 513

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 87/135 (64%), Gaps = 1/135 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 14  LPDEAATLRFGEDFALALQKGDFITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 73

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRLS+ +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 74  VQSYEALRLPVAHADLYRLSTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 133

Query: 132 SQGKTGRKATISAER 146
           S    GR   I+ ++
Sbjct: 134 SHEGAGRHILITGQQ 148


>gi|306842789|ref|ZP_07475430.1| conserved hypothetical protein [Brucella sp. BO2]
 gi|306287062|gb|EFM58570.1| conserved hypothetical protein [Brucella sp. BO2]
          Length = 511

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 65/133 (48%), Positives = 85/133 (63%), Gaps = 1/133 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 12  LPDEAATLRFGEDFALALQKGDLITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 71

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRLS+ +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 72  VQSYEALRLPVAHADLYRLSTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 131

Query: 132 SQGKTGRKATISA 144
           S    GR   I+ 
Sbjct: 132 SHEGAGRHILITG 144


>gi|306843517|ref|ZP_07476118.1| conserved hypothetical protein [Brucella sp. BO1]
 gi|306276208|gb|EFM57908.1| conserved hypothetical protein [Brucella sp. BO1]
          Length = 511

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 65/133 (48%), Positives = 85/133 (63%), Gaps = 1/133 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 12  LPDEAATLRFGEDFALALQKGDLITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 71

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRLS+ +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 72  VQSYEALRLPVAHADLYRLSTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 131

Query: 132 SQGKTGRKATISA 144
           S    GR   I+ 
Sbjct: 132 SHEGAGRHILITG 144


>gi|265983094|ref|ZP_06095829.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306837655|ref|ZP_07470524.1| conserved hypothetical protein [Brucella sp. NF 2653]
 gi|264661686|gb|EEZ31947.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306407213|gb|EFM63423.1| conserved hypothetical protein [Brucella sp. NF 2653]
          Length = 511

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 65/133 (48%), Positives = 85/133 (63%), Gaps = 1/133 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 12  LPDEAATLRFGEDFALALQKGDFITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 71

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRLS+ +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 72  VQSYEALRLPVAHADLYRLSTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 131

Query: 132 SQGKTGRKATISA 144
           S    GR   I+ 
Sbjct: 132 SHEGAGRHILITG 144


>gi|261324040|ref|ZP_05963237.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261300020|gb|EEY03517.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 511

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 65/133 (48%), Positives = 85/133 (63%), Gaps = 1/133 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 12  LPDEAATLRFGEDFALALQKGDFITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 71

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRLS+ +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 72  VQSYEALRLPVAHADLYRLSTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 131

Query: 132 SQGKTGRKATISA 144
           S    GR   I+ 
Sbjct: 132 SHEGAGRHILITG 144


>gi|261217920|ref|ZP_05932201.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261221149|ref|ZP_05935430.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261314865|ref|ZP_05954062.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316577|ref|ZP_05955774.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321230|ref|ZP_05960427.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261751242|ref|ZP_05994951.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261755807|ref|ZP_05999516.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261759035|ref|ZP_06002744.1| ATP/GTP-binding protein [Brucella sp. F5/99]
 gi|265987649|ref|ZP_06100206.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265997109|ref|ZP_06109666.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260919733|gb|EEX86386.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260923009|gb|EEX89577.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293920|gb|EEX97416.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261295800|gb|EEX99296.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261303891|gb|EEY07388.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261739019|gb|EEY27015.1| ATP/GTP-binding protein [Brucella sp. F5/99]
 gi|261740995|gb|EEY28921.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261745560|gb|EEY33486.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262551577|gb|EEZ07567.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|264659846|gb|EEZ30107.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 511

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 65/133 (48%), Positives = 85/133 (63%), Gaps = 1/133 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 12  LPDEAATLRFGEDFALALQKGDFITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 71

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRLS+ +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 72  VQSYEALRLPVAHADLYRLSTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 131

Query: 132 SQGKTGRKATISA 144
           S    GR   I+ 
Sbjct: 132 SHEGAGRHILITG 144


>gi|260567428|ref|ZP_05837898.1| ATP/GTP-binding protein [Brucella suis bv. 4 str. 40]
 gi|260156946|gb|EEW92026.1| ATP/GTP-binding protein [Brucella suis bv. 4 str. 40]
          Length = 511

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 65/133 (48%), Positives = 85/133 (63%), Gaps = 1/133 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 12  LPDEAATLRFGEDFALALQKGDFITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 71

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRLS+ +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 72  VQSYEALRLPVAHADLYRLSTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 131

Query: 132 SQGKTGRKATISA 144
           S    GR   I+ 
Sbjct: 132 SHEGAGRHILITG 144


>gi|256060063|ref|ZP_05450245.1| hypothetical protein Bneo5_06861 [Brucella neotomae 5K33]
          Length = 513

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 65/133 (48%), Positives = 85/133 (63%), Gaps = 1/133 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 14  LPDEAATLRFGEDFALALQKGDFITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 73

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRLS+ +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 74  VQSYEALRLPVAHADLYRLSTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 133

Query: 132 SQGKTGRKATISA 144
           S    GR   I+ 
Sbjct: 134 SHEGAGRHILITG 146


>gi|254718141|ref|ZP_05179952.1| hypothetical protein Bru83_01096 [Brucella sp. 83/13]
          Length = 513

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 65/133 (48%), Positives = 85/133 (63%), Gaps = 1/133 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 14  LPDEAATLRFGEDFALALQKGDFITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 73

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRLS+ +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 74  VQSYEALRLPVAHADLYRLSTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 133

Query: 132 SQGKTGRKATISA 144
           S    GR   I+ 
Sbjct: 134 SHEGAGRHILITG 146


>gi|161620012|ref|YP_001593899.1| hypothetical protein BCAN_A2145 [Brucella canis ATCC 23365]
 gi|161336823|gb|ABX63128.1| conserved hypothetical protein [Brucella canis ATCC 23365]
          Length = 513

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 65/133 (48%), Positives = 85/133 (63%), Gaps = 1/133 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 14  LPDEAATLRFGEDFALALQKGDFITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 73

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRLS+ +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 74  VQSYEALRLPVAHADLYRLSTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 133

Query: 132 SQGKTGRKATISA 144
           S    GR   I+ 
Sbjct: 134 SHEGAGRHILITG 146


>gi|148558909|ref|YP_001259901.1| hypothetical protein BOV_2017 [Brucella ovis ATCC 25840]
 gi|148370166|gb|ABQ60145.1| conserved hypothetical protein TIGR00150 [Brucella ovis ATCC 25840]
          Length = 513

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 65/133 (48%), Positives = 85/133 (63%), Gaps = 1/133 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 14  LPDEAATLRFGEDFALALQKGDFITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 73

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRLS+ +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 74  VQSYEALRLPVAHADLYRLSTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 133

Query: 132 SQGKTGRKATISA 144
           S    GR   I+ 
Sbjct: 134 SHEGAGRHILITG 146


>gi|23502948|ref|NP_699075.1| hypothetical protein BR2100 [Brucella suis 1330]
 gi|163844117|ref|YP_001628521.1| hypothetical protein BSUIS_A1941 [Brucella suis ATCC 23445]
 gi|225626476|ref|ZP_03784515.1| conserved hypothetical protein [Brucella ceti str. Cudo]
 gi|254700730|ref|ZP_05162558.1| hypothetical protein Bsuib55_07717 [Brucella suis bv. 5 str. 513]
 gi|254705102|ref|ZP_05166930.1| hypothetical protein Bsuib36_14501 [Brucella suis bv. 3 str. 686]
 gi|254707382|ref|ZP_05169210.1| hypothetical protein BpinM_10515 [Brucella pinnipedialis
           M163/99/10]
 gi|254709076|ref|ZP_05170887.1| hypothetical protein BpinB_02182 [Brucella pinnipedialis B2/94]
 gi|254713497|ref|ZP_05175308.1| hypothetical protein BcetM6_09114 [Brucella ceti M644/93/1]
 gi|254716147|ref|ZP_05177958.1| hypothetical protein BcetM_06886 [Brucella ceti M13/05/1]
 gi|256030601|ref|ZP_05444215.1| hypothetical protein BpinM2_08107 [Brucella pinnipedialis
           M292/94/1]
 gi|256158597|ref|ZP_05456487.1| hypothetical protein BcetM4_07026 [Brucella ceti M490/95/1]
 gi|256254008|ref|ZP_05459544.1| hypothetical protein BcetB_06868 [Brucella ceti B1/94]
 gi|256370498|ref|YP_003108009.1| phosphotransferase [Brucella microti CCM 4915]
 gi|260169507|ref|ZP_05756318.1| phosphotransferase [Brucella sp. F5/99]
 gi|23348983|gb|AAN30990.1| conserved hypothetical protein TIGR00150 [Brucella suis 1330]
 gi|163674840|gb|ABY38951.1| conserved hypothetical protein [Brucella suis ATCC 23445]
 gi|225618133|gb|EEH15176.1| conserved hypothetical protein [Brucella ceti str. Cudo]
 gi|256000661|gb|ACU49060.1| phosphotransferase [Brucella microti CCM 4915]
          Length = 513

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 65/133 (48%), Positives = 85/133 (63%), Gaps = 1/133 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 14  LPDEAATLRFGEDFALALQKGDFITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 73

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRLS+ +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 74  VQSYEALRLPVAHADLYRLSTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 133

Query: 132 SQGKTGRKATISA 144
           S    GR   I+ 
Sbjct: 134 SHEGAGRHILITG 146


>gi|295687602|ref|YP_003591295.1| hypothetical protein Cseg_0151 [Caulobacter segnis ATCC 21756]
 gi|295429505|gb|ADG08677.1| protein of unknown function UPF0079 [Caulobacter segnis ATCC 21756]
          Length = 148

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 87/138 (63%), Gaps = 2/138 (1%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +  +P+ +E  T  LGR LA+ LR GD L L+G LG+GKS LAR++IR L   D  EV S
Sbjct: 1   MNTLPLADEAATQALGRQLATALRPGDTLCLTGPLGAGKSTLARALIRALTTPDE-EVPS 59

Query: 68  PTFTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKY 126
           PTFTLVQ Y+  + P+AHFD YRL+   E  E+G DE L+  + +IEWP+     LP   
Sbjct: 60  PTFTLVQFYETPTFPLAHFDLYRLTDPDEAYEIGLDEALDGGVALIEWPQRLEGRLPPNR 119

Query: 127 IDIHLSQGKTGRKATISA 144
           +DI ++     R+A I+A
Sbjct: 120 LDIDIALDGDARRAAITA 137


>gi|239833143|ref|ZP_04681472.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
 gi|239825410|gb|EEQ96978.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
          Length = 754

 Score =  125 bits (313), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 65/143 (45%), Positives = 88/143 (61%), Gaps = 1/143 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T   G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D+ L+V SPTFTL
Sbjct: 14  LPDETATQRFGEDFALALQKGDLVTLSGDLGAGKSSLARAIIRAIADDEGLDVPSPTFTL 73

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  IPVAH D YR+S  +E+ ELG  E + + + + EWPE G   LP+    + L
Sbjct: 74  VQSYEALRIPVAHADLYRISHGEELDELGLPEFMEDGVVLAEWPEQGEGFLPEPSFAVTL 133

Query: 132 SQGKTGRKATISAERWIISHINQ 154
           S    GR+  +S     IS + +
Sbjct: 134 SHEGAGRRIAVSGPAAAISRLER 156


>gi|294851327|ref|ZP_06792000.1| hypothetical protein BAZG_00227 [Brucella sp. NVSL 07-0026]
 gi|294819916|gb|EFG36915.1| hypothetical protein BAZG_00227 [Brucella sp. NVSL 07-0026]
          Length = 511

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 64/133 (48%), Positives = 84/133 (63%), Gaps = 1/133 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D  L+V SPTFTL
Sbjct: 12  LPDEAATLRFGEDFALALQKGDFITLSGDLGAGKSSLARAIIRTIADDAGLDVPSPTFTL 71

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  +PVAH D YRL + +E+ ELG  E L+E + + EWPE G   LP+    + L
Sbjct: 72  VQSYEALRLPVAHADLYRLFTPEELDELGLVEFLDEGVALAEWPEQGEGFLPQATFAVML 131

Query: 132 SQGKTGRKATISA 144
           S    GR   I+ 
Sbjct: 132 SHEGAGRHILITG 144


>gi|163757505|ref|ZP_02164594.1| hypothetical protein HPDFL43_18882 [Hoeflea phototrophica DFL-43]
 gi|162285007|gb|EDQ35289.1| hypothetical protein HPDFL43_18882 [Hoeflea phototrophica DFL-43]
          Length = 497

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 58/119 (48%), Positives = 81/119 (68%)

Query: 26  LASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHF 85
           +A  L+ GDCL LSGDLG+GK+  AR++IR +  D  LEV SPTFTLVQ+Y+  +P+AHF
Sbjct: 18  MALSLKPGDCLCLSGDLGAGKTTFARALIRAVADDPDLEVPSPTFTLVQVYELRLPIAHF 77

Query: 86  DFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           D YRL S +E+ ELG ++ L++   +IEWPE     LP+  ++I  +     R AT+SA
Sbjct: 78  DLYRLGSAEELDELGLEDALSDGAALIEWPEQAAERLPQNLVEIRFAGLDATRTATVSA 136


>gi|288959558|ref|YP_003449899.1| hypothetical protein AZL_027170 [Azospirillum sp. B510]
 gi|288911866|dbj|BAI73355.1| hypothetical protein AZL_027170 [Azospirillum sp. B510]
          Length = 160

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/146 (46%), Positives = 93/146 (63%), Gaps = 3/146 (2%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           M+    H   IP+P+E  T  LG  L  +LR GD + L GDLG+GKS L+R++IR + HD
Sbjct: 1   MSDLSPHTVTIPLPDETATAALGCRLGLLLRPGDLVALRGDLGAGKSALSRALIRSVTHD 60

Query: 61  DALEVLSPTFTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGR 119
           +A EV SPTFTLVQ YD +I PV HFD YRLS   EV ELG+D+   E + ++EWP+   
Sbjct: 61  EA-EVPSPTFTLVQTYDTAIGPVWHFDLYRLSGADEVYELGWDDARAEAVALVEWPDRLG 119

Query: 120 SLLPKKYIDIHLS-QGKTGRKATISA 144
            LLP   +++ +   G   R+AT++ 
Sbjct: 120 PLLPPDRVEVTMEHDGPDARRATVTG 145


>gi|16127764|ref|NP_422328.1| hypothetical protein CC_3534 [Caulobacter crescentus CB15]
 gi|221236584|ref|YP_002519021.1| ATP/GTP hydrolase [Caulobacter crescentus NA1000]
 gi|13425268|gb|AAK25496.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220965757|gb|ACL97113.1| ATP/GTP hydrolase [Caulobacter crescentus NA1000]
          Length = 148

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 86/138 (62%), Gaps = 2/138 (1%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +  + + +E  T  LGR LA  LR GD L L+G LG+GKS LAR++IR L   D  EV S
Sbjct: 1   MKTLSLADEAATQALGRTLAGALRPGDALCLTGPLGAGKSTLARALIRALTTPDE-EVPS 59

Query: 68  PTFTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKY 126
           PTFTLVQ Y+  + P+AHFD YRLS   E  E+G DE L++ + +IEWP+     LP+  
Sbjct: 60  PTFTLVQFYETPAFPLAHFDLYRLSDPDEAYEIGLDEALDDGVALIEWPQRLEGRLPRTR 119

Query: 127 IDIHLSQGKTGRKATISA 144
           +DI ++     R+A I A
Sbjct: 120 LDIDIALDGDARRAVIVA 137


>gi|254417752|ref|ZP_05031476.1| uncharacterised P-loop hydrolase UPF0079 [Brevundimonas sp. BAL3]
 gi|196183929|gb|EDX78905.1| uncharacterised P-loop hydrolase UPF0079 [Brevundimonas sp. BAL3]
          Length = 152

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 92/151 (60%), Gaps = 10/151 (6%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I +P+ + T  LG  +A +L  GD L L G LG GKS LAR +IR L   D  +V SPTF
Sbjct: 3   IDLPDAEATTRLGHAIAPLLAPGDSLLLYGPLGMGKSTLARGLIRALTTPDE-DVPSPTF 61

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWP-----EIGRSLLPKK 125
           TLVQ Y++  PVAHFD YRL+  +E  E+G D+ L+E   IIEWP     E GR L P +
Sbjct: 62  TLVQFYESDPPVAHFDLYRLTRPEEAFEIGLDDALDEGCAIIEWPERLGEEPGRFLGPDR 121

Query: 126 YIDIHLSQGKTGRKATIS-AERW--IISHIN 153
            + I +S+   GR AT+S A RW  +I H+ 
Sbjct: 122 LV-IEISEHGDGRVATVSGAGRWEDLIDHVR 151


>gi|153008156|ref|YP_001369371.1| hypothetical protein Oant_0820 [Ochrobactrum anthropi ATCC 49188]
 gi|151560044|gb|ABS13542.1| protein of unknown function UPF0079 [Ochrobactrum anthropi ATCC
           49188]
          Length = 509

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 65/147 (44%), Positives = 89/147 (60%), Gaps = 4/147 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T   G   A  L+ GD +TLSGDLG+GKS LAR+IIR +  D+ L V SPTFTL
Sbjct: 12  LPDEAATQRFGEDFALALQKGDLVTLSGDLGAGKSSLARAIIRAIADDEGLNVPSPTFTL 71

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A  I VAH D YR+S  +E+ ELG  E L + + + EWPE G   L +    + L
Sbjct: 72  VQSYEALRIAVAHADLYRISHGEELDELGLPEFLEDGVVLAEWPEQGEGFLSEPSFAVTL 131

Query: 132 SQGKTGRKATISAERWIISHINQMNRS 158
           S    GR+ ++S     ++ I ++ RS
Sbjct: 132 SHEGAGRRISVSGP---VAAIQRLERS 155


>gi|323138126|ref|ZP_08073199.1| hypothetical protein family UPF0079, ATPase [Methylocystis sp. ATCC
           49242]
 gi|322396588|gb|EFX99116.1| hypothetical protein family UPF0079, ATPase [Methylocystis sp. ATCC
           49242]
          Length = 512

 Score =  117 bits (292), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 57/139 (41%), Positives = 91/139 (65%), Gaps = 5/139 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + I +E  TI L + +AS++++GD +TL+GDLG+GK+  AR+++R L+ D  LE  SPTF
Sbjct: 13  VDIADEAGTIALAQDIASLVKVGDTVTLAGDLGAGKTTFARALMRKLLGDPTLEAPSPTF 72

Query: 71  TLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
           TL+Q+Y++  + + H DFYR+SS  E+  LG++E  ++ I ++EW E     +P   +DI
Sbjct: 73  TLMQVYESGDVRIVHADFYRISSSSELAGLGWEEATDDSIVLVEWAERALDAMPPDRLDI 132

Query: 130 HLS----QGKTGRKATISA 144
            LS      +  R+ATIS 
Sbjct: 133 RLSFADADNRDARRATISG 151


>gi|167648804|ref|YP_001686467.1| hypothetical protein Caul_4849 [Caulobacter sp. K31]
 gi|167351234|gb|ABZ73969.1| protein of unknown function UPF0079 [Caulobacter sp. K31]
          Length = 150

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 83/133 (62%), Gaps = 4/133 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T  LGR LA  LR GD + L+G LG+GKS LAR+++R L   D  EV SPTFTL
Sbjct: 6   LPDEAATQQLGRSLAKALRPGDAVCLTGPLGAGKSTLARALVRALTSPDE-EVPSPTFTL 64

Query: 73  VQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLP--KKYIDI 129
           VQ YD    PVAHFD YRL+   E  E+G +E L +   +IEWP+  +  LP  +  I+I
Sbjct: 65  VQFYDGPDFPVAHFDLYRLTDPDEAYEIGLEEALEDGAVLIEWPQRLQGRLPADRLAIEI 124

Query: 130 HLSQGKTGRKATI 142
             SQ    R+AT+
Sbjct: 125 TPSQDGEARRATL 137


>gi|328545813|ref|YP_004305922.1| Uncharacterized P-loop hydrolase UPF0079 [polymorphum gilvum
           SL003B-26A1]
 gi|326415553|gb|ADZ72616.1| Uncharacterized P-loop hydrolase UPF0079, putative [Polymorphum
           gilvum SL003B-26A1]
          Length = 504

 Score =  117 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 66/138 (47%), Positives = 84/138 (60%), Gaps = 6/138 (4%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ L   LA+IL  GD +TLSGDLG+GKS   R+++R L  D  LEV SPTFTL
Sbjct: 14  LADEAATVRLAEDLAAILAPGDVVTLSGDLGAGKSTFCRALLRALADDPDLEVPSPTFTL 73

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ YD   +PVAH D YR+   +E+ ELG DE L     +IEWPE  +  +P   + I L
Sbjct: 74  VQHYDLPRLPVAHVDLYRIEDPEELDELGLDEGLETGAALIEWPERAQGRIPAGALSITL 133

Query: 132 SQ--GKTGRKATISAERW 147
           +Q  G   R ATI   RW
Sbjct: 134 AQAGGPDQRTATI---RW 148


>gi|222147059|ref|YP_002548016.1| hypothetical protein Avi_0051 [Agrobacterium vitis S4]
 gi|221734049|gb|ACM35012.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 502

 Score =  116 bits (291), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 87/135 (64%), Gaps = 1/135 (0%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + + +E  TI LG  LA  L+ GDCL L GDLG+GKS LAR+++R L  DD LEV SPTF
Sbjct: 10  LSLADEAATIQLGEDLALALKPGDCLALHGDLGAGKSTLARALLRALADDDDLEVPSPTF 69

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIH 130
           TLVQ Y+  IP AHFD YRL    E+ ELGFDE L+  IC++EWPE     LPK  I +H
Sbjct: 70  TLVQSYELRIPAAHFDLYRLGDASELDELGFDEALDTGICLVEWPERAEDRLPKTTIGLH 129

Query: 131 LS-QGKTGRKATISA 144
                  GR+ TI+ 
Sbjct: 130 YGFPPDGGRELTITG 144


>gi|23014818|ref|ZP_00054616.1| COG0802: Predicted ATPase or kinase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 156

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 88/136 (64%), Gaps = 6/136 (4%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P E +TI LG  LA+++R GD + LSG LG+GKS LAR++IR L  D   EV SPTFTL
Sbjct: 9   LPVEADTIRLGHRLAALVRPGDVIALSGTLGTGKSTLARALIRALT-DPEEEVPSPTFTL 67

Query: 73  VQLY--DASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIH 130
           VQ Y  DA + + HFD YRL    + +EL  +E   E I +IEWPE     LP+K +D+ 
Sbjct: 68  VQQYESDAGL-IWHFDLYRLEKPDDALELDIEEAFAEGISLIEWPEQLGPHLPRKRLDVL 126

Query: 131 LSQGKT--GRKATISA 144
           L QG+   GR AT++A
Sbjct: 127 LQQGEAGLGRHATLTA 142


>gi|192288514|ref|YP_001989119.1| hypothetical protein Rpal_0081 [Rhodopseudomonas palustris TIE-1]
 gi|192282263|gb|ACE98643.1| protein of unknown function UPF0079 [Rhodopseudomonas palustris
           TIE-1]
          Length = 506

 Score =  114 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 61/150 (40%), Positives = 89/150 (59%), Gaps = 5/150 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + + NE  T+ L   +A ++  GD +TLSGDLG+GK+  AR++IR+L  DDALEV SPTF
Sbjct: 9   VALANEVATVRLMAEVALLIGPGDVVTLSGDLGAGKTAAARAMIRYLADDDALEVPSPTF 68

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
           TLVQ YD    P+ H D YR+    E+ E+G   + +  + +IEWPE   + LP+  IDI
Sbjct: 69  TLVQTYDLPPYPLLHADLYRVEDPSELEEIGLSPLPDGTVALIEWPERAGAALPEDRIDI 128

Query: 130 HLSQ----GKTGRKATISAERWIISHINQM 155
            LS     G + R A I+     +  + ++
Sbjct: 129 ALSHRPALGPSARAAEITGHGKAVKQVERL 158


>gi|39933158|ref|NP_945434.1| hypothetical protein RPA0078 [Rhodopseudomonas palustris CGA009]
 gi|39652783|emb|CAE25522.1| Protein of unknown function UPF0079 [Rhodopseudomonas palustris
           CGA009]
          Length = 506

 Score =  114 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 61/150 (40%), Positives = 89/150 (59%), Gaps = 5/150 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + + NE  T+ L   +A ++  GD +TLSGDLG+GK+  AR++IR+L  DDALEV SPTF
Sbjct: 9   VALANEVATVRLMAEVALLIGPGDVVTLSGDLGAGKTAAARAMIRYLADDDALEVPSPTF 68

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
           TLVQ YD    P+ H D YR+    E+ E+G   + +  + +IEWPE   + LP+  IDI
Sbjct: 69  TLVQTYDLPPYPLLHADLYRVEDPSELEEIGLSPLPDGTVALIEWPERAGAALPEDRIDI 128

Query: 130 HLSQ----GKTGRKATISAERWIISHINQM 155
            LS     G + R A I+     +  + ++
Sbjct: 129 ALSHRPALGPSARAAEITGHGKAVKQVERL 158


>gi|90420582|ref|ZP_01228489.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335310|gb|EAS49063.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 522

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 62/136 (45%), Positives = 81/136 (59%), Gaps = 1/136 (0%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           IP+ +E  T+ LG  LA  L  GD + L GDLG+GKS LAR+ IR L  +  LEV SPT+
Sbjct: 23  IPLADEAATLRLGGDLALALTAGDVVALIGDLGAGKSTLARAAIRTLADNPELEVPSPTY 82

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIH 130
           TLVQ Y+   P AH D YRLS   E+ ELGF+E+  + I  +EWP+   S L    + + 
Sbjct: 83  TLVQPYETVPPAAHLDLYRLSGDDELDELGFEEMARDGIVFVEWPQNAPSALAAATVTVT 142

Query: 131 LSQGK-TGRKATISAE 145
           L      GR A +SA+
Sbjct: 143 LDNTPGGGRTAHVSAD 158


>gi|83313348|ref|YP_423612.1| ATPase or kinase [Magnetospirillum magneticum AMB-1]
 gi|82948189|dbj|BAE53053.1| Predicted ATPase or kinase [Magnetospirillum magneticum AMB-1]
          Length = 156

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 87/135 (64%), Gaps = 4/135 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P E +TI LGR LA+++R GD + L G LG+GKS LAR++I+ L  DD  EV SPTFTL
Sbjct: 9   LPVEADTIRLGRKLAALVRPGDVIALEGTLGTGKSTLARALIQALT-DDEEEVPSPTFTL 67

Query: 73  VQLYDASIP-VAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+     V HFD YRL    + +EL  +E   E I +IEWP+     LP++ +++ L
Sbjct: 68  VQQYETPAGLVWHFDLYRLEKPDDALELDIEEAFAEGISLIEWPDKLGPHLPRRRLEVLL 127

Query: 132 SQGKT--GRKATISA 144
            QG+   GR AT++A
Sbjct: 128 QQGEAGLGRHATLTA 142


>gi|121602688|ref|YP_989602.1| P-loop hydrolase/phosphotransferase [Bartonella bacilliformis
           KC583]
 gi|120614865|gb|ABM45466.1| P-loop hydrolase/phosphotransferase [Bartonella bacilliformis
           KC583]
          Length = 497

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 84/155 (54%), Gaps = 7/155 (4%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           MNFS        + NE+ T    + LA  L+ GD +TL GDLG+GKS LAR+II  L +D
Sbjct: 1   MNFS------FFLANEEATKLFAQDLALALKPGDLVTLQGDLGAGKSTLARAIIHTLAND 54

Query: 61  DALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGR 119
           D LEV SPTFTLVQ Y      V H D YRLS  +E+ ELG  E   + I +IEWPE G 
Sbjct: 55  DNLEVPSPTFTLVQNYKLPQFEVIHADLYRLSMAEEIDELGLHEAREQSILLIEWPEKGA 114

Query: 120 SLLPKKYIDIHLSQGKTGRKATISAERWIISHINQ 154
             L      I L     GR  TI+A    I  + Q
Sbjct: 115 DSLGPTTFAISLQHQDCGRHITITAATHDIERLQQ 149


>gi|254437733|ref|ZP_05051227.1| uncharacterised P-loop hydrolase UPF0079 [Octadecabacter
           antarcticus 307]
 gi|198253179|gb|EDY77493.1| uncharacterised P-loop hydrolase UPF0079 [Octadecabacter
           antarcticus 307]
          Length = 156

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 79/134 (58%), Gaps = 3/134 (2%)

Query: 16  EKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQL 75
           + +T  LGR LA   R GDC  L G +GSGKS LAR+ IR L+  D  EV SPTFTLVQ 
Sbjct: 13  QDDTDHLGRILAKYARAGDCFLLRGQIGSGKSALARAFIRSLLGPDT-EVPSPTFTLVQT 71

Query: 76  YDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
           YD + + + H D YRL   QE VELG  +   + IC+IEWPE+   L P   +DI LS  
Sbjct: 72  YDYNDLEIWHADLYRLGDAQEAVELGLMDAFTDHICLIEWPELLGDLAPNTALDIELSVA 131

Query: 135 KTGRKATIS-AERW 147
                AT++  + W
Sbjct: 132 PDCHLATVTFGDNW 145


>gi|316931475|ref|YP_004106457.1| hypothetical protein Rpdx1_0080 [Rhodopseudomonas palustris DX-1]
 gi|315599189|gb|ADU41724.1| protein of unknown function UPF0079 [Rhodopseudomonas palustris
           DX-1]
          Length = 506

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 60/150 (40%), Positives = 87/150 (58%), Gaps = 5/150 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + + NE  T  L   +A ++  GD +TLSGDLG+GK+  AR++IR+L  DD LEV SPTF
Sbjct: 9   VALANEAATTRLMAEVALLIGPGDVVTLSGDLGAGKTAAARAMIRYLAADDTLEVPSPTF 68

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
           TLVQ YD    P+ H D YR+    E+ E+G   + +  + +IEWPE   + LP+  IDI
Sbjct: 69  TLVQTYDLPPYPLLHADLYRVEDPSELEEIGLSPLPDGTVALIEWPERAGAALPEDRIDI 128

Query: 130 HLSQ----GKTGRKATISAERWIISHINQM 155
            LS     G + R A I+     +  + ++
Sbjct: 129 ALSHRPALGPSARAAEITGHGKAVKQVERL 158


>gi|329891013|ref|ZP_08269356.1| conserved hypothetical P-loop hydrolase UPF0079 family protein
           [Brevundimonas diminuta ATCC 11568]
 gi|328846314|gb|EGF95878.1| conserved hypothetical P-loop hydrolase UPF0079 family protein
           [Brevundimonas diminuta ATCC 11568]
          Length = 167

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 87/156 (55%), Gaps = 21/156 (13%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +T   +P+   T  LG  +A +L  G+ + L G LG GKS LAR +IR L   D  +V S
Sbjct: 1   MTTFDLPDADATTRLGEAIAPLLEPGEAVLLYGPLGMGKSTLARGLIRALTRPDE-DVPS 59

Query: 68  PTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE-----IGRSLL 122
           PTFTLVQ Y++  P+AHFD YRL+  +E  E+G DE L+E   +IEWPE      GR L 
Sbjct: 60  PTFTLVQFYESDPPIAHFDLYRLTRPEEAFEVGLDEALDEGCALIEWPERLGDDPGRMLG 119

Query: 123 PKKYIDIHLSQ--------------GKTGRKATISA 144
           P + I I +S+              G +GR AT+S 
Sbjct: 120 PDRLI-IEISEPAPQAAALREGGDRGLSGRVATVSG 154


>gi|217976853|ref|YP_002361000.1| protein of unknown function UPF0079 [Methylocella silvestris BL2]
 gi|217502229|gb|ACK49638.1| protein of unknown function UPF0079 [Methylocella silvestris BL2]
          Length = 523

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 61/143 (42%), Positives = 89/143 (62%), Gaps = 7/143 (4%)

Query: 9   TVIP--IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
           TV P  + +E  T  L   +A ++R GD +TLSG+LG+GK+  AR++IR L  D  LEV 
Sbjct: 12  TVWPRRLADEDATSRLAAEIAELIRPGDLVTLSGELGAGKTTFARALIRLLTGDPDLEVP 71

Query: 67  SPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKK 125
           SPTF L+Q+Y+ AS P+ H DFYRL    +++ELG+DE  +    I+EWP+ G + L + 
Sbjct: 72  SPTFLLMQIYEGASAPIVHADFYRLEKPSDLIELGWDEAADGAFVIVEWPDRGGAYLGED 131

Query: 126 YIDIHL---SQGKTG-RKATISA 144
            +DI     +   TG R AT++ 
Sbjct: 132 RLDISFALDADSATGARDATVTG 154


>gi|27375867|ref|NP_767396.1| hypothetical protein bll0756 [Bradyrhizobium japonicum USDA 110]
 gi|27349005|dbj|BAC46021.1| bll0756 [Bradyrhizobium japonicum USDA 110]
          Length = 518

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 60/139 (43%), Positives = 83/139 (59%), Gaps = 5/139 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + + NE  T  L   LA ++  GD +TL+GDLG+GK+  AR++IR+L  D+ALEV SPTF
Sbjct: 9   VALHNETATAQLMADLALLVGPGDVITLTGDLGAGKTAAARAMIRYLADDEALEVPSPTF 68

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
           TLVQ Y+    PV H D YR+    E+ E+G   + +  + +IEWPE   S LP+  IDI
Sbjct: 69  TLVQGYELPPFPVMHADLYRVEDESELEEIGLSPLPDATLVLIEWPERAPSALPEDRIDI 128

Query: 130 HLSQ----GKTGRKATISA 144
            L+     G   R A I+ 
Sbjct: 129 ALTHRPALGSNARAADITG 147


>gi|89067397|ref|ZP_01154910.1| hypothetical protein OG2516_11171 [Oceanicola granulosus HTCC2516]
 gi|89046966|gb|EAR53020.1| hypothetical protein OG2516_11171 [Oceanicola granulosus HTCC2516]
          Length = 155

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/132 (43%), Positives = 75/132 (56%), Gaps = 2/132 (1%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
            T  L    AS L  GDCL LSG +G+GKS  AR++IR  + D A EV SPTFTLVQ+Y+
Sbjct: 15  ETEALAARFASRLGAGDCLLLSGPIGAGKSAFARALIRARLGDPAAEVPSPTFTLVQVYE 74

Query: 78  A-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKT 136
                + H D YRL+   E +ELG  E     IC++EWP+    L P+  + + L+    
Sbjct: 75  TDDTEIWHTDLYRLTGPSEALELGLAEAFETAICLVEWPDRLADLAPEGALTLALADAPP 134

Query: 137 GRKATISA-ERW 147
           GR  TIS  E W
Sbjct: 135 GRSLTISGPESW 146


>gi|209883639|ref|YP_002287496.1| 7.5 kda chlorosome protein [Oligotropha carboxidovorans OM5]
 gi|209871835|gb|ACI91631.1| 7.5 kda chlorosome protein [Oligotropha carboxidovorans OM5]
          Length = 509

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 80/139 (57%), Gaps = 5/139 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + +PNE  T  L   LA +   GD +TLSGDLG+GK+  AR++IR+L  DD  EV SPTF
Sbjct: 9   VALPNETATAELMADLALLAGPGDTITLSGDLGAGKTTAARAMIRYLAGDDDYEVPSPTF 68

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
           TL Q YD    PV H D YR++   E+ E+G   +    + +IEWPE     +P++ IDI
Sbjct: 69  TLTQTYDLPPFPVLHADLYRIADASELEEIGLSPLPEGTLSLIEWPERAPEAMPEERIDI 128

Query: 130 HLSQ----GKTGRKATISA 144
             S     G + R A I+ 
Sbjct: 129 AFSHRPSLGSSARAAEITG 147


>gi|85714153|ref|ZP_01045142.1| hypothetical protein NB311A_08353 [Nitrobacter sp. Nb-311A]
 gi|85699279|gb|EAQ37147.1| hypothetical protein NB311A_08353 [Nitrobacter sp. Nb-311A]
          Length = 507

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 63/146 (43%), Positives = 82/146 (56%), Gaps = 5/146 (3%)

Query: 4   SEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDAL 63
           SE       +PNE  T  L   LA ++  GD +TLSGDLG+GK+  AR++IR+L  DD +
Sbjct: 2   SEPSRFATALPNETATAHLMADLALLVGAGDVITLSGDLGAGKTSAARAMIRYLAGDDTI 61

Query: 64  EVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLL 122
           EV SPTFTL Q YD  S P+ H D YR+S   E+ E+G   +    + +IEWPE     L
Sbjct: 62  EVPSPTFTLAQHYDLPSYPLLHADLYRISGPGELEEIGLAPMPEGTVVLIEWPERAAGGL 121

Query: 123 PKKYIDIHLSQ----GKTGRKATISA 144
           P   IDI +S     G   R A I+ 
Sbjct: 122 PADRIDIAISHRPALGSGARAAEITG 147


>gi|299133351|ref|ZP_07026546.1| aminoglycoside phosphotransferase [Afipia sp. 1NLS2]
 gi|298593488|gb|EFI53688.1| aminoglycoside phosphotransferase [Afipia sp. 1NLS2]
          Length = 509

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 60/150 (40%), Positives = 85/150 (56%), Gaps = 5/150 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + +PNE  T  L   LA ++  GD +TLSGDLG+GK+  AR++IR+L  D+A EV SPTF
Sbjct: 9   VALPNEIATAHLMADLALLVGPGDTITLSGDLGAGKTTAARAMIRYLAGDEAYEVPSPTF 68

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
           TL Q YD    PV H D YR++   E+ E+G   +    + +IEWPE     +P   IDI
Sbjct: 69  TLTQTYDLPPYPVLHADLYRIADATELEEIGLSPLPEGTLALIEWPERAPEAMPDNRIDI 128

Query: 130 HLSQ----GKTGRKATISAERWIISHINQM 155
             S     G + R A I+     I+ + ++
Sbjct: 129 AFSHRPSLGSSARAAEITGHGEAIAKVARL 158


>gi|307942839|ref|ZP_07658184.1| 7.5 kda chlorosome protein [Roseibium sp. TrichSKD4]
 gi|307773635|gb|EFO32851.1| 7.5 kda chlorosome protein [Roseibium sp. TrichSKD4]
          Length = 521

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 63/132 (47%), Positives = 82/132 (62%), Gaps = 2/132 (1%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
            T + +  E  T  L   LA ILR GD + LSGDLG+GKS L+R+++R L  D  LEV S
Sbjct: 13  FTTLKLETEDATRQLAEDLAVILRPGDAILLSGDLGAGKSTLSRALLRSLASDPELEVPS 72

Query: 68  PTFTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKY 126
           PTFTLVQ Y    + VAHFD YRL   +EV ELG  E+L     +IEWPE+   LLP+  
Sbjct: 73  PTFTLVQTYRLDRLEVAHFDLYRLEEPEEVEELGLAEVLETGAALIEWPEMAADLLPENA 132

Query: 127 IDIHLSQ-GKTG 137
           + + L++ G+ G
Sbjct: 133 LWLQLTETGEVG 144


>gi|326403646|ref|YP_004283728.1| hypothetical protein ACMV_14990 [Acidiphilium multivorum AIU301]
 gi|325050508|dbj|BAJ80846.1| hypothetical protein ACMV_14990 [Acidiphilium multivorum AIU301]
          Length = 149

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/130 (44%), Positives = 78/130 (60%), Gaps = 2/130 (1%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  T+ L + +A   R GD L LSG+LG+GKS  AR+ IR    D +L+V SP+FTLVQ
Sbjct: 10  SEAETVALAQAMAVRARAGDALLLSGNLGAGKSTFARAFIRARAGDASLDVPSPSFTLVQ 69

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+   PV HFD +RL+   +V ELG D  L   I +IEWP+    L P++ I + L  G
Sbjct: 70  TYELDPPVTHFDLWRLTGPDDVAELGLDAALAG-IALIEWPDRLGPLAPREAITLALGWG 128

Query: 135 KTG-RKATIS 143
           +   R AT S
Sbjct: 129 EGNTRTATAS 138


>gi|300023814|ref|YP_003756425.1| hypothetical protein Hden_2307 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525635|gb|ADJ24104.1| protein of unknown function UPF0079 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 513

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 57/144 (39%), Positives = 87/144 (60%), Gaps = 3/144 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E + + L   +A  L+ GD L L GDLG+GKS  AR++IR L  D +L+V SPTFTL Q
Sbjct: 10  SENDVVRLADEIAFFLQPGDTLCLEGDLGAGKSTFARALIRALSGDPSLDVPSPTFTLTQ 69

Query: 75  LYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+     VAHFD YRL+  +E+ ELG +  L   + +IEWP  G   +P+ ++ + L +
Sbjct: 70  SYETPRFEVAHFDLYRLTDPEEIDELGLESALTRGVAVIEWPSRGGDRIPEDHVAMLLEE 129

Query: 134 G--KTGRKATISAERWIISHINQM 155
           G  +T R  TI++   +I  + ++
Sbjct: 130 GDSETLRTITITSAASLIERLQRL 153


>gi|83594767|ref|YP_428519.1| hypothetical protein Rru_A3438 [Rhodospirillum rubrum ATCC 11170]
 gi|83577681|gb|ABC24232.1| Protein of unknown function UPF0079 [Rhodospirillum rubrum ATCC
           11170]
          Length = 165

 Score =  107 bits (266), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 65/142 (45%), Positives = 83/142 (58%), Gaps = 8/142 (5%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+   T  LG  LA ++R GD L L GDLG+GKS LAR++IR L   D  EV SPTFTL
Sbjct: 8   LPDPSATDRLGAALARLVRGGDVLALIGDLGAGKSALARALIRALTTPDE-EVPSPTFTL 66

Query: 73  VQLYD----ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYID 128
           VQ YD    A   + HFD YRL   +E + L  ++   E I +IEWP+   +LLP   +D
Sbjct: 67  VQTYDPADGAKPMIWHFDLYRLDDPEEALALAIEDAFAEGISLIEWPDRLGALLPADRLD 126

Query: 129 IHLSQGKT--GRKATISAE-RW 147
           I L    +  GR AT+S   RW
Sbjct: 127 IRLGPDASGAGRIATLSERGRW 148


>gi|86747751|ref|YP_484247.1| hypothetical protein RPB_0625 [Rhodopseudomonas palustris HaA2]
 gi|86570779|gb|ABD05336.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 505

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 80/139 (57%), Gaps = 5/139 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + + NE  T  L   +A ++  GD +TLSGDLG+GK+  AR++IR+L  DD LEV SPTF
Sbjct: 9   VALANEAATARLMADIALLIGPGDVVTLSGDLGAGKTAAARAMIRYLAGDDELEVPSPTF 68

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
           TLVQ YD    P+ H D YR+    E+ E+G   + +  + +IEWPE     +P   IDI
Sbjct: 69  TLVQSYDLPPFPLLHADLYRVEDPSELEEIGLSPLPDGTVALIEWPERAPGAMPPDRIDI 128

Query: 130 HLSQ----GKTGRKATISA 144
            LS     G   R A I+ 
Sbjct: 129 ALSHRPALGSMARAAEITG 147


>gi|90421907|ref|YP_530277.1| hypothetical protein RPC_0383 [Rhodopseudomonas palustris BisB18]
 gi|90103921|gb|ABD85958.1| protein of unknown function UPF0079 [Rhodopseudomonas palustris
           BisB18]
          Length = 506

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 60/146 (41%), Positives = 84/146 (57%), Gaps = 5/146 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE  T  L   LA ++  GD +TLSGDLG+GK+  AR++IR+L  D  LEV SPTFTLVQ
Sbjct: 13  NESATANLMADLALLIAPGDVITLSGDLGAGKTAAARAMIRYLAGDPELEVPSPTFTLVQ 72

Query: 75  LYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+ S  P+ H D YR+    E+ E+G   +    + +IEWPE    LLP+  IDI L+ 
Sbjct: 73  SYELSPFPLLHADLYRIEDPSELEEIGLSPLPEGSVVLIEWPERAPDLLPEDRIDIALTH 132

Query: 134 ----GKTGRKATISAERWIISHINQM 155
               G   R A I+      + ++++
Sbjct: 133 RPALGTAARAAEITGHGRAAAQVDRL 158


>gi|240849709|ref|YP_002971097.1| hypothetical protein Bgr_00280 [Bartonella grahamii as4aup]
 gi|240266832|gb|ACS50420.1| hypothetical protein Bgr_00280 [Bartonella grahamii as4aup]
          Length = 156

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 87/155 (56%), Gaps = 7/155 (4%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           MNFS        + NE+ T    +HL   L+ GD +TL GDLG+GKS +AR+II+ L +D
Sbjct: 1   MNFS------FFLENEEATKLFAQHLTLSLKPGDLVTLQGDLGTGKSTIARTIIQTLTND 54

Query: 61  DALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGR 119
           + ++V SPTFTLVQ Y      + H D YRLS  +E+ ELG  E   + I ++EWPE   
Sbjct: 55  NTMDVPSPTFTLVQSYQLPQFEIIHADLYRLSMAEEIDELGLHEAREKNILLVEWPERNT 114

Query: 120 SLLPKKYIDIHLSQGKTGRKATISAERWIISHINQ 154
           +LL      + L   + GR  T+ + +  I  + Q
Sbjct: 115 ALLELATFALTLHYKEHGRHVTLRSAQHAIERLQQ 149


>gi|330991803|ref|ZP_08315752.1| UPF0079 ATP-binding protein [Gluconacetobacter sp. SXCC-1]
 gi|329760824|gb|EGG77319.1| UPF0079 ATP-binding protein [Gluconacetobacter sp. SXCC-1]
          Length = 168

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 79/122 (64%), Gaps = 2/122 (1%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           IP+P+ + T  LG  LA +LR GD + L GDLG+GK+ LAR+++R L     +EV SP++
Sbjct: 17  IPLPDTQATQALGHALAPLLRAGDAVLLEGDLGAGKTTLARALLRALCGSPDMEVPSPSY 76

Query: 71  TLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
           TLVQ+YDA +  VAHFD +RL     + ELG+D+   E I ++EWP+   +L P   + +
Sbjct: 77  TLVQVYDAPLAAVAHFDLWRLDGPDALHELGWDDAC-EGIVLVEWPDRLGTLAPPDALHV 135

Query: 130 HL 131
            L
Sbjct: 136 RL 137


>gi|91974688|ref|YP_567347.1| hypothetical protein RPD_0206 [Rhodopseudomonas palustris BisB5]
 gi|91681144|gb|ABE37446.1| protein of unknown function UPF0079 [Rhodopseudomonas palustris
           BisB5]
          Length = 505

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 58/139 (41%), Positives = 81/139 (58%), Gaps = 5/139 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + + NE  T  L   +A ++  GD +TLSGDLG+GK+  AR++IR+L  DD LEV SPTF
Sbjct: 9   VALANETATARLMAEIALLIGPGDVVTLSGDLGAGKTSAARAMIRYLAGDDDLEVPSPTF 68

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
           TLVQ Y+    P+ H D YR++   E+ E+G   + +  + +IEWPE     +P   IDI
Sbjct: 69  TLVQSYELPPFPLLHADLYRVNDPSELEEIGLSPLPDGAVALIEWPERAPGAMPSDRIDI 128

Query: 130 HLSQ----GKTGRKATISA 144
            LS     G   R A I+ 
Sbjct: 129 ALSHRPALGSMARAAEITG 147


>gi|114331870|ref|YP_748092.1| hypothetical protein Neut_1895 [Nitrosomonas eutropha C91]
 gi|114308884|gb|ABI60127.1| protein of unknown function UPF0079 [Nitrosomonas eutropha C91]
          Length = 158

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 84/138 (60%), Gaps = 4/138 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ + +E  T+ LG  LA+ILR G  + L GDLG+GK+ LAR I++ L H D  +V SPT
Sbjct: 6   VVQLDDEAATLFLGEQLAAILRPGLTVFLYGDLGAGKTTLARGILKGLGHYD--KVRSPT 63

Query: 70  FTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           + LV++Y  S + + HFDFYRL+   E  E GF E  N+  IC++EWPE     L    +
Sbjct: 64  YNLVEIYKLSELYLYHFDFYRLNDPLEWEEAGFREYFNQNSICLVEWPEKAGEFLHAADL 123

Query: 128 DIHLSQGKTGRKATISAE 145
            I +S   TGR A + AE
Sbjct: 124 KIWISYSGTGRIAELKAE 141


>gi|254294690|ref|YP_003060713.1| hypothetical protein Hbal_2336 [Hirschia baltica ATCC 49814]
 gi|254043221|gb|ACT60016.1| protein of unknown function UPF0079 [Hirschia baltica ATCC 49814]
          Length = 156

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 86/141 (60%), Gaps = 4/141 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V  I +E  T  L + +A +L+ GD + L+GDLG+GK+  +R++I+ L+ +  ++V SPT
Sbjct: 9   VFSIADEAETFALAKRIAPLLKAGDVIALNGDLGAGKTTFSRALIQTLLDNPNVDVTSPT 68

Query: 70  FTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYID 128
           FTLVQ Y++ + P+ H+D YR+    E+ ELGF++ + + + IIEWP      LP   +D
Sbjct: 69  FTLVQTYESPNFPIWHYDMYRIEDESELDELGFEDTI-DGLAIIEWPIRMGDQLPSYRLD 127

Query: 129 IHLSQGKTGRKATI--SAERW 147
           I +    TGR  ++    E W
Sbjct: 128 IQIDFTNTGRSISLIGHGEEW 148


>gi|164687092|ref|ZP_02211120.1| hypothetical protein CLOBAR_00718 [Clostridium bartlettii DSM
           16795]
 gi|164603977|gb|EDQ97442.1| hypothetical protein CLOBAR_00718 [Clostridium bartlettii DSM
           16795]
          Length = 156

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/133 (39%), Positives = 80/133 (60%), Gaps = 3/133 (2%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I + N+K T  +G  L  +L+ G  + L GDLG+GK+ + +S+   L  DD   + SPTF
Sbjct: 10  IYLDNDKETREIGFKLGKLLKPGSIVCLIGDLGAGKTTMTQSLAEALEVDDY--ITSPTF 67

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDI 129
           T+V  Y+  +P+ HFD YR+   +E+ ++GFDE +N E +CIIEW  I   +LP  Y+ I
Sbjct: 68  TIVNEYEGKMPLYHFDVYRIGCSEEMYDIGFDEYINGEGVCIIEWANIIEDILPDDYLKI 127

Query: 130 HLSQGKTGRKATI 142
            L     GR+ T+
Sbjct: 128 ELKYKDMGREMTL 140


>gi|319404941|emb|CBI78543.1| P-loop hydrolase/phosphotransferase [Bartonella sp. AR 15-3]
          Length = 506

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 83/145 (57%), Gaps = 7/145 (4%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           MNFS        + NE+ TI   + LA  L+ GD +T  GDLG+GKS L R++IR L ++
Sbjct: 1   MNFS------FFLENEEATILFAQDLALALKSGDLVTFQGDLGAGKSTLIRALIRALANN 54

Query: 61  DALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGR 119
             +++ SPTFTLVQ Y      V H DFYR+SS +E+ ELG  E   E + +IEWPE G 
Sbjct: 55  CTMDIPSPTFTLVQSYQLPQFEVLHVDFYRISSIEEIYELGLHESRKENVLLIEWPEKGV 114

Query: 120 SLLPKKYIDIHLSQGKTGRKATISA 144
            +L      I L     GR  T+++
Sbjct: 115 EVLGPVTFAITLQHKGCGRHITLAS 139


>gi|319407901|emb|CBI81555.1| P-loop hydrolase/phosphotransferase [Bartonella schoenbuchensis R1]
          Length = 497

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 62/145 (42%), Positives = 83/145 (57%), Gaps = 7/145 (4%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           MNFS        + NE+ T    + LA  L+ GD +TL G+LG+GKS LAR++I  L +D
Sbjct: 1   MNFS------FFLENEEATKLFAQDLALALKPGDLITLQGNLGAGKSTLARALIHALAND 54

Query: 61  DALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGR 119
           + L+V SPTFTLVQ Y      V H DFYRLS  +E+ ELG  E   + + +IEWPE G 
Sbjct: 55  NTLDVPSPTFTLVQNYQLPQFEVIHADFYRLSMVEEIDELGLHEAREQSVLLIEWPEKGA 114

Query: 120 SLLPKKYIDIHLSQGKTGRKATISA 144
            LL      I L     GR  ++++
Sbjct: 115 DLLGPTTFAITLQHENCGRYISVTS 139


>gi|260575778|ref|ZP_05843774.1| protein of unknown function UPF0079 [Rhodobacter sp. SW2]
 gi|259021931|gb|EEW25231.1| protein of unknown function UPF0079 [Rhodobacter sp. SW2]
          Length = 159

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 79/135 (58%), Gaps = 2/135 (1%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ T   G  LA+ LR GD L L G +G+GK+ LARS+IR  +     +V SPTFTL
Sbjct: 11  LASEQETARFGEWLAARLRPGDTLLLEGQIGAGKTHLARSLIRARLGR-MEDVPSPTFTL 69

Query: 73  VQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ YDA    + H D YRLS   EV ELG +   +  IC+IEWP+   SL P   + + L
Sbjct: 70  VQTYDAGDTEIWHADLYRLSHPDEVTELGLEAAFDTAICLIEWPDRLGSLAPPGAMRLQL 129

Query: 132 SQGKTGRKATISAER 146
           SQ   GR+  +S  R
Sbjct: 130 SQEGEGRRLLVSGGR 144


>gi|182677582|ref|YP_001831728.1| hypothetical protein Bind_0587 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633465|gb|ACB94239.1| protein of unknown function UPF0079 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 562

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 61/137 (44%), Positives = 84/137 (61%), Gaps = 5/137 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P E  T  L   +A +L  GD LTLSGDLG+GK+  AR++IR L+ D  LEV SPTFTL
Sbjct: 22  LPGEAATAALAADIAPLLGPGDLLTLSGDLGTGKTSFARALIRVLVGDPTLEVPSPTFTL 81

Query: 73  VQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           +QLY+    P+ H D YR+S  +++ ELG++E     I I+EWPE  R +L    +DI  
Sbjct: 82  MQLYEGERCPIVHADLYRISRPEDLAELGWEEAGEGAIVIVEWPEHAREVLNSDRLDIAF 141

Query: 132 ----SQGKTGRKATISA 144
               +Q  T R AT++ 
Sbjct: 142 FLDPAQPPTFRSATLTG 158


>gi|119897535|ref|YP_932748.1| hypothetical protein azo1244 [Azoarcus sp. BH72]
 gi|119669948|emb|CAL93861.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 173

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 85/134 (63%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P E +T+ LG  LA ++R G  + L GDLGSGK+ L R ++R L H+   +V SPT+TL
Sbjct: 17  LPAEADTLALGAALAGVVRAGLHVWLQGDLGSGKTTLTRGLLRALGHEG--KVKSPTYTL 74

Query: 73  VQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIH 130
           ++ Y  S + + HFDFYR ++ +E ++ G DE    + +CI+EWP+     LP   +++ 
Sbjct: 75  IEPYALSRLDLYHFDFYRFNAPEEYLDAGLDEYFAGDGVCIVEWPDKALPYLPAPDLELR 134

Query: 131 LSQGKTGRKATISA 144
           L +   GR+A+I+A
Sbjct: 135 LDRAGEGRRASITA 148


>gi|46204039|ref|ZP_00050587.2| COG3178: Predicted phosphotransferase related to Ser/Thr protein
           kinases [Magnetospirillum magnetotacticum MS-1]
          Length = 332

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 76/122 (62%), Gaps = 3/122 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P E  T  +   LAS LR GD + L G LG+GK+ LAR++IR L  D ALEV SPTFTL
Sbjct: 3   LPEEGATEDMAAFLASFLRPGDLVALFGGLGAGKTTLARAMIRELARDPALEVPSPTFTL 62

Query: 73  VQLYD--ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE-IGRSLLPKKYIDI 129
           +Q Y+  +   V H D YRL    E+VELGFDE+    I ++EWPE +GR   P   +++
Sbjct: 63  MQPYETGSGRTVIHADLYRLRGPDELVELGFDELSETAITLVEWPERLGRRDNPTLTVEL 122

Query: 130 HL 131
            L
Sbjct: 123 SL 124


>gi|197103670|ref|YP_002129047.1| hypothetical protein PHZ_c0204 [Phenylobacterium zucineum HLK1]
 gi|196477090|gb|ACG76618.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 158

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 76/119 (63%), Gaps = 2/119 (1%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  T  LG  +A+ L+ G+ + LSG LG+GKS LAR+++R L    A +V SPTFTLVQ
Sbjct: 13  DEAATARLGAAIAAGLKPGEAVCLSGPLGAGKSTLARALVRALTTP-AEDVPSPTFTLVQ 71

Query: 75  LYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+   + VAHFD YRLS+  E  E+G DE L+E   ++EWPE     LP   +D+ ++
Sbjct: 72  FYEGPRLKVAHFDLYRLSNPDEAYEIGLDEALDEGAAVVEWPERLEGRLPPDRLDVEIA 130


>gi|238795249|ref|ZP_04638832.1| hypothetical protein yinte0001_20880 [Yersinia intermedia ATCC
           29909]
 gi|238725417|gb|EEQ16988.1| hypothetical protein yinte0001_20880 [Yersinia intermedia ATCC
           29909]
          Length = 156

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+P+P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VLPLPDEAATVALGATLAHAFNGASVIYLFGDLGAGKTTFSRGFLQALGH--VGHVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  A  PV HFD YRL+  +E+  +G  +  +ER IC++EWP+ G   LP+  I
Sbjct: 63  YTLVEPYALAPRPVYHFDLYRLADPEELEFMGIRDYFDERAICLVEWPQQGEGFLPRADI 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL+    GR+A + A
Sbjct: 123 ELHLAYQAEGREARLVA 139


>gi|217970198|ref|YP_002355432.1| hypothetical protein Tmz1t_1784 [Thauera sp. MZ1T]
 gi|217507525|gb|ACK54536.1| protein of unknown function UPF0079 [Thauera sp. MZ1T]
          Length = 176

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 83/134 (61%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+ LG  LA +L  G  + L G+LG+GK+ L R ++R L H+   +V SPT+TL
Sbjct: 19  LPDEAATVALGGALAGVLAPGLQIWLQGNLGTGKTTLTRGLLRALGHEG--KVKSPTYTL 76

Query: 73  VQLY-DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIH 130
           ++ Y  +S+ + HFDFYR +S  E ++ G DE    E +CI+EWP+     LP   ++I 
Sbjct: 77  IEPYVVSSLNLYHFDFYRFTSPDEYLDAGLDEYFAGEGVCIVEWPDKASPHLPSPDVEIV 136

Query: 131 LSQGKTGRKATISA 144
           L  G++GR   ISA
Sbjct: 137 LQAGESGRDVAISA 150


>gi|92115686|ref|YP_575415.1| hypothetical protein Nham_0054 [Nitrobacter hamburgensis X14]
 gi|91798580|gb|ABE60955.1| protein of unknown function UPF0079 [Nitrobacter hamburgensis X14]
          Length = 507

 Score =  104 bits (259), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 58/137 (42%), Positives = 79/137 (57%), Gaps = 5/137 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + NE  T  L   LA ++  GD +TLSGDLG+GK+  AR++IR+L  DD +EV SPTFTL
Sbjct: 11  LANETATAHLMADLALLIGPGDVITLSGDLGAGKTAAARAMIRYLAGDDTVEVPSPTFTL 70

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
            Q YD    P+ H D YR++   E+ E+G   + +  + +IEWPE     LP   IDI +
Sbjct: 71  AQHYDLPCYPLLHADLYRINGPGELEEIGLAPLPDATVVLIEWPERAAGALPTDRIDIAI 130

Query: 132 SQ----GKTGRKATISA 144
           S     G   R A I+ 
Sbjct: 131 SHRPALGSAARAAEITG 147


>gi|295098324|emb|CBK87414.1| conserved hypothetical nucleotide-binding protein [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 153

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 84/137 (61%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
            IP+P+E+ T+ LG+ +A   +    + L GDLG+GK+  +R  ++ L H+    V SPT
Sbjct: 5   AIPLPDEQATLDLGKRVAQACQGATVIYLYGDLGAGKTTFSRGFLQALGHNG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   +I V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYTLENIMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGAGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IHL     GR+A ISA
Sbjct: 123 EIHLDYQAQGREARISA 139


>gi|332559989|ref|ZP_08414311.1| hypothetical protein RSWS8N_13050 [Rhodobacter sphaeroides WS8N]
 gi|332277701|gb|EGJ23016.1| hypothetical protein RSWS8N_13050 [Rhodobacter sphaeroides WS8N]
          Length = 161

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 85/139 (61%), Gaps = 4/139 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRF-LMHDDALEVLSP 68
           ++ + +E++T  LG  LA +LR GD L L G +G+GK+ LAR++IR  L H++  EV SP
Sbjct: 12  LLALASEEDTARLGAALACLLRPGDVLLLEGPIGAGKTHLARALIRAALGHEE--EVPSP 69

Query: 69  TFTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYI 127
           TFTLVQ Y+A    V H D YRL+   EV+ELG +      +C++EWP+    L P   +
Sbjct: 70  TFTLVQTYEAPGHEVWHADLYRLTHPDEVLELGLEAAFATAVCLVEWPDRLGDLAPPGAL 129

Query: 128 DIHLSQGKTGRKATISAER 146
            + L     GR+AT+S  R
Sbjct: 130 RLRLEAEGEGRRATLSGGR 148


>gi|75674245|ref|YP_316666.1| hypothetical protein Nwi_0046 [Nitrobacter winogradskyi Nb-255]
 gi|74419115|gb|ABA03314.1| Protein of unknown function UPF0079 [Nitrobacter winogradskyi
           Nb-255]
          Length = 507

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 61/146 (41%), Positives = 81/146 (55%), Gaps = 5/146 (3%)

Query: 4   SEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDAL 63
           SE       + NE  T  L   LA ++  GD +TLSGDLG+GK+  AR++IR+L  DD +
Sbjct: 2   SEPSRFATALVNETATAHLMADLALLIGPGDVITLSGDLGAGKTAAARALIRYLAGDDTI 61

Query: 64  EVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLL 122
           EV SPTFTL Q YD    P+ H D YR+S   E+ E+G   +  + + +IEWPE     L
Sbjct: 62  EVPSPTFTLAQHYDLPPHPLLHADLYRISGPGELDEIGLAPLPEDAVVLIEWPERAAGGL 121

Query: 123 PKKYIDIHLSQ----GKTGRKATISA 144
           P   IDI +S     G   R A I+ 
Sbjct: 122 PADRIDIAISHRPALGSAARSAEITG 147


>gi|296117282|ref|ZP_06835873.1| putative hydrolase protein [Gluconacetobacter hansenii ATCC 23769]
 gi|295976175|gb|EFG82962.1| putative hydrolase protein [Gluconacetobacter hansenii ATCC 23769]
          Length = 206

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 90/155 (58%), Gaps = 25/155 (16%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I +P++  T+ LGR LA ++R+GD + L GDLG+GK+ LAR+++R +  D A+EV SP++
Sbjct: 29  ICLPDDAATMALGRALAPVVRVGDAVLLRGDLGAGKTTLARALLRAMCDDPAMEVPSPSY 88

Query: 71  TLVQLYDA---------------------SIPVAHFDFYRLSSHQEVVELGFDEILNERI 109
           TLVQ YD                       + V+HFD +RL     +VELG+D+   E I
Sbjct: 89  TLVQTYDVPGKDVPGEGGQVAGGQAERGQGVEVSHFDLWRLDGPGALVELGWDDAC-EGI 147

Query: 110 CIIEWPEIGRSLLP--KKYIDIHLSQGKTGRKATI 142
            ++EWPE   +L P   ++ID+ + +   GR A +
Sbjct: 148 VLVEWPERLGALTPPHARHIDL-VVRADGGRDAIL 181


>gi|200388244|ref|ZP_03214856.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199605342|gb|EDZ03887.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 153

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 86/137 (62%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG+ +A+       + L GDLG+GK+  +R  ++ L H+    V SPT
Sbjct: 5   VIPLPDEQATLGLGQRVANACDGATVIYLYGDLGAGKTTFSRGFLQALGHNG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G+ +LP   +
Sbjct: 63  YTLVEPYALDNMMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGKGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIDYQAQGREARVSA 139


>gi|77462062|ref|YP_351566.1| hypothetical protein RSP_1522 [Rhodobacter sphaeroides 2.4.1]
 gi|77386480|gb|ABA77665.1| Conserved hypothetical [Rhodobacter sphaeroides 2.4.1]
          Length = 161

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 60/143 (41%), Positives = 85/143 (59%), Gaps = 10/143 (6%)

Query: 12  PIP------NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRF-LMHDDALE 64
           P+P      +E++T  LG  LA +LR GD L L G +G+GK+ LAR++IR  L H++  E
Sbjct: 8   PVPLLLALASEEDTARLGAALARLLRPGDVLLLEGPIGAGKTHLARALIRAALGHEE--E 65

Query: 65  VLSPTFTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLP 123
           V SPTFTLVQ Y+A    + H D YRL+   EV+ELG +      +C++EWP+    L P
Sbjct: 66  VPSPTFTLVQTYEAPGHEIWHADLYRLTHPDEVLELGLEAAFATAVCLVEWPDRLGDLAP 125

Query: 124 KKYIDIHLSQGKTGRKATISAER 146
              + + L     GR+AT+S  R
Sbjct: 126 PGALRLRLEAEGEGRRATLSGGR 148


>gi|49473712|ref|YP_031754.1| chlorosome protein [Bartonella quintana str. Toulouse]
 gi|49239215|emb|CAF25534.1| Chlorosome protein [Bartonella quintana str. Toulouse]
          Length = 500

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 79/145 (54%), Gaps = 7/145 (4%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           MNFS        + NEK T    + LA  L+ GD +TL GDLG+GKS LAR+IIR L +D
Sbjct: 1   MNFS------FSLENEKATKLFAQDLALALKPGDLVTLQGDLGTGKSTLARTIIRTLAND 54

Query: 61  DALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGR 119
             L+V SPTFTL Q Y      + H D YRLS  +E+ ELG  E   + I ++EWPE   
Sbjct: 55  TTLDVPSPTFTLAQSYQLPQFEIIHVDLYRLSIAEEIDELGLHEAREQSILLVEWPEKSA 114

Query: 120 SLLPKKYIDIHLSQGKTGRKATISA 144
            LL      +       GR  T+++
Sbjct: 115 ELLGPVTFALTFQYEDYGRHVTLTS 139


>gi|126460951|ref|YP_001042065.1| hypothetical protein Rsph17029_0174 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221641015|ref|YP_002527277.1| hypothetical protein RSKD131_2916 [Rhodobacter sphaeroides KD131]
 gi|126102615|gb|ABN75293.1| protein of unknown function UPF0079 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221161796|gb|ACM02776.1| Hypothetical Protein RSKD131_2916 [Rhodobacter sphaeroides KD131]
          Length = 169

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 58/139 (41%), Positives = 85/139 (61%), Gaps = 4/139 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRF-LMHDDALEVLSP 68
           ++ + +E++T  LG  LA +LR GD L L G +G+GK+ LAR++IR  L H++  EV SP
Sbjct: 20  LLALASEEDTARLGAALACLLRPGDVLLLEGPIGAGKTHLARALIRAALGHEE--EVPSP 77

Query: 69  TFTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYI 127
           TFTLVQ Y+A    + H D YRL+   EV+ELG +      +C++EWP+    L P   +
Sbjct: 78  TFTLVQTYEAPGHEIWHADLYRLTHPDEVLELGLEAAFATAVCLVEWPDRLGDLAPPGAL 137

Query: 128 DIHLSQGKTGRKATISAER 146
            + L     GR+AT+S  R
Sbjct: 138 RLRLEAEGEGRRATLSGGR 156


>gi|144898914|emb|CAM75778.1| ATPase or kinase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 154

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 88/142 (61%), Gaps = 5/142 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +  + +E  T  LG+ LA++ R GD + L G LG GKS LARS I+ L   D  EV SPT
Sbjct: 5   IFELADEAATRRLGQMLAALARPGDVIMLHGTLGMGKSTLARSFIQALTSADE-EVPSPT 63

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYID 128
           FTLVQ+Y+ A+  + HFD YRL   ++  ELG ++   + I +IEWP+    L P++ ++
Sbjct: 64  FTLVQMYEGANGDIWHFDLYRLDKPEDAFELGIEDAFADGISLIEWPDRLGRLAPRRRLE 123

Query: 129 IHLSQGK--TGRKAT-ISAERW 147
           IHL  G+  T R+A  IS ++W
Sbjct: 124 IHLHLGQHDTARRAELISHDQW 145


>gi|148264365|ref|YP_001231071.1| hypothetical protein Gura_2319 [Geobacter uraniireducens Rf4]
 gi|146397865|gb|ABQ26498.1| protein of unknown function UPF0079 [Geobacter uraniireducens Rf4]
          Length = 162

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 80/136 (58%), Gaps = 4/136 (2%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           K TI +G  L S L  GD + L GDLGSGK+  A+ +   L  D  + + SPT+TLV +Y
Sbjct: 12  KETIAVGERLGSFLSAGDFIALVGDLGSGKTQFAKGVAAGLAIDPTIPITSPTYTLVNIY 71

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQGK 135
              +P+ HFD YRL   Q++++LGF+E      +C++EW E  +  LP++++++ L+   
Sbjct: 72  KGRLPLYHFDLYRLHGDQDIIDLGFEEYFYGNGVCLVEWAERLKDALPEEHLEVVLTHAG 131

Query: 136 TGRKA---TISAERWI 148
             ++    T S ER +
Sbjct: 132 NEQRCLTFTPSGERAV 147


>gi|167554137|ref|ZP_02347878.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205321596|gb|EDZ09435.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 153

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 86/137 (62%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG+ +A+       + L GDLG+GK+  +R  ++ L H+    V SPT
Sbjct: 5   VIPLPDEQATLDLGQRVANACDGATVIYLYGDLGAGKTTFSRGFLQALGHNG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G+ +LP   +
Sbjct: 63  YTLVEPYTLDNMMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGKGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIGYQAQGREARVSA 139


>gi|304320186|ref|YP_003853829.1| hypothetical protein PB2503_03057 [Parvularcula bermudensis
           HTCC2503]
 gi|303299089|gb|ADM08688.1| hypothetical protein PB2503_03057 [Parvularcula bermudensis
           HTCC2503]
          Length = 155

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 52/131 (39%), Positives = 81/131 (61%), Gaps = 4/131 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           K T   GR L  +LR GD ++L+ ++G+GK+ LA  ++R LM +D ++V SPTFT++  Y
Sbjct: 12  KATETFGRRLGQVLRPGDVVSLAAEMGAGKTVLAAGVVRSLMGED-IDVSSPTFTIIHDY 70

Query: 77  DASIPVAHFDFYRLSSHQEVVELG-FDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGK 135
             S PV H D YRL+   E++ELG FD+  +  I ++EW E G + LP  Y+++ +    
Sbjct: 71  PGSPPVKHADLYRLAEPDEILELGLFDD--DAAIVLVEWAEKGAAFLPPGYLEVGIHLVP 128

Query: 136 TGRKATISAER 146
            GR   +S +R
Sbjct: 129 EGRMIALSGDR 139


>gi|188584127|ref|YP_001927572.1| hypothetical protein Mpop_4941 [Methylobacterium populi BJ001]
 gi|179347625|gb|ACB83037.1| protein of unknown function UPF0079 [Methylobacterium populi BJ001]
          Length = 540

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 55/106 (51%), Positives = 69/106 (65%), Gaps = 2/106 (1%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P E  T  +   LA ILR GD + LSG LG+GK+ LAR++IR L  D ALEV SPTFTL
Sbjct: 35  LPEESATEDMAAFLAGILRPGDLVALSGGLGAGKTTLARALIRELAGDPALEVPSPTFTL 94

Query: 73  VQLYD--ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           +Q Y+  +   V H D YRL    E+VELGFDE+    I ++EWPE
Sbjct: 95  MQPYETRSGRSVIHADLYRLRGPDELVELGFDELSETAITLVEWPE 140


>gi|168822516|ref|ZP_02834516.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|197249307|ref|YP_002149271.1| putative ATPase [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197213010|gb|ACH50407.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|205341070|gb|EDZ27834.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320088784|emb|CBY98542.1| UPF0079 ATP-binding protein HI0065 [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 153

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 86/137 (62%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG+ +A+       + L GDLG+GK+  +R  ++ L H+    V SPT
Sbjct: 5   VIPLPDEQATLDLGQRVANACDGATVIYLYGDLGAGKTTFSRGFLQALGHNG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G+ +LP   +
Sbjct: 63  YTLVEPYTLDNMMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGKGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIDYQAQGREARVSA 139


>gi|16767603|ref|NP_463218.1| ATPase [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|167995171|ref|ZP_02576261.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|16422917|gb|AAL23177.1| putative nucleotide-binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|205327105|gb|EDZ13869.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|267996688|gb|ACY91573.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301160846|emb|CBW20377.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|321222677|gb|EFX47749.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|323132695|gb|ADX20125.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|332991168|gb|AEF10151.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 153

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 86/137 (62%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG+ +A+       + L GDLG+GK+  +R  ++ L H+    V SPT
Sbjct: 5   VIPLPDEQATLDLGQRVANACDGATVIYLYGDLGAGKTTFSRGFLQALGHNG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G+ +LP   +
Sbjct: 63  YTLVEPYAIDNMMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGKGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIDYQAQGREARVSA 139


>gi|16763176|ref|NP_458793.1| ATPase [Salmonella enterica subsp. enterica serovar Typhi str.
           CT18]
 gi|29144655|ref|NP_807997.1| ATPase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
 gi|62182803|ref|YP_219220.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|168244865|ref|ZP_02669797.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168464759|ref|ZP_02698662.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194443602|ref|YP_002043612.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|205355115|ref|YP_002228916.1| ATPase [Salmonella enterica subsp. enterica serovar Gallinarum str.
           287/91]
 gi|213052284|ref|ZP_03345162.1| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. E00-7866]
 gi|213420175|ref|ZP_03353241.1| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. E01-6750]
 gi|213586192|ref|ZP_03368018.1| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-0664]
 gi|213621069|ref|ZP_03373852.1| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-2068]
 gi|238910515|ref|ZP_04654352.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|291080848|ref|ZP_06536576.2| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. AG3]
 gi|25326454|pir||AE1048 conserved hypothetical protein yjeE [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16505484|emb|CAD06834.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29140294|gb|AAO71857.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|62130436|gb|AAX68139.1| putative nucleotide-binding protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|194402265|gb|ACF62487.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|195632792|gb|EDX51246.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|205274896|emb|CAR39963.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205336307|gb|EDZ23071.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|322615519|gb|EFY12439.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322618579|gb|EFY15468.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322622008|gb|EFY18858.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322627732|gb|EFY24523.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322637742|gb|EFY34443.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322642406|gb|EFY39010.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322659728|gb|EFY55971.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322662061|gb|EFY58277.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322676040|gb|EFY72111.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322717305|gb|EFZ08876.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323192897|gb|EFZ78123.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323197227|gb|EFZ82367.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323206170|gb|EFZ91132.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323213179|gb|EFZ97981.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323215552|gb|EGA00296.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323219537|gb|EGA04022.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323227840|gb|EGA11994.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323229010|gb|EGA13139.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323248019|gb|EGA31956.1| ADP-binding protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323254650|gb|EGA38461.1| ADP-binding protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323258291|gb|EGA41968.1| ADP-binding protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323263563|gb|EGA47084.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323270285|gb|EGA53733.1| ADP-binding protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
 gi|326626046|gb|EGE32391.1| putative ATPase [Salmonella enterica subsp. enterica serovar Dublin
           str. 3246]
 gi|326630272|gb|EGE36615.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 153

 Score =  103 bits (257), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 86/137 (62%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG+ +A+       + L GDLG+GK+  +R  ++ L H+    V SPT
Sbjct: 5   VIPLPDEQATLDLGQRVANACDGATVIYLYGDLGAGKTTFSRGFLQALGHNG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G+ +LP   +
Sbjct: 63  YTLVEPYALDNMMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGKGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIDYQAQGREARVSA 139


>gi|261249448|emb|CBG27313.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|312915455|dbj|BAJ39429.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
          Length = 152

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 86/137 (62%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG+ +A+       + L GDLG+GK+  +R  ++ L H+    V SPT
Sbjct: 4   VIPLPDEQATLDLGQRVANACDGATVIYLYGDLGAGKTTFSRGFLQALGHNG--NVKSPT 61

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G+ +LP   +
Sbjct: 62  YTLVEPYAIDNMMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGKGVLPDPDV 121

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 122 EIHIDYQAQGREARVSA 138


>gi|161617627|ref|YP_001591592.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|194451640|ref|YP_002048400.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194470221|ref|ZP_03076205.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194734142|ref|YP_002117298.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197264440|ref|ZP_03164514.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197301254|ref|ZP_03166351.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|198243704|ref|YP_002218241.1| putative ATPase [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|204926856|ref|ZP_03218058.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205358442|ref|ZP_03224034.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205360657|ref|ZP_03224684.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|207859503|ref|YP_002246154.1| ATPase [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|213428676|ref|ZP_03361426.1| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|213647297|ref|ZP_03377350.1| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
 gi|224586198|ref|YP_002639997.1| ATPase [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|289829985|ref|ZP_06547436.1| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-3139]
 gi|161366991|gb|ABX70759.1| hypothetical protein SPAB_05490 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194409944|gb|ACF70163.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194456585|gb|EDX45424.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194709644|gb|ACF88865.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197242695|gb|EDY25315.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197287605|gb|EDY26997.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197938220|gb|ACH75553.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|204323521|gb|EDZ08716.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205334255|gb|EDZ21019.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205347962|gb|EDZ34593.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206711306|emb|CAR35684.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224470726|gb|ACN48556.1| hypothetical protein SPC_4504 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322631039|gb|EFY27803.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322644025|gb|EFY40573.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322650493|gb|EFY46901.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322653542|gb|EFY49870.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322666190|gb|EFY62368.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322672610|gb|EFY68721.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322680524|gb|EFY76562.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322684582|gb|EFY80586.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323201656|gb|EFZ86720.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323236378|gb|EGA20454.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323238717|gb|EGA22769.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323241832|gb|EGA25861.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323265841|gb|EGA49337.1| ADP-binding protein [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
          Length = 152

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 86/137 (62%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG+ +A+       + L GDLG+GK+  +R  ++ L H+    V SPT
Sbjct: 4   VIPLPDEQATLDLGQRVANACDGATVIYLYGDLGAGKTTFSRGFLQALGHNG--NVKSPT 61

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G+ +LP   +
Sbjct: 62  YTLVEPYALDNMMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGKGVLPDPDV 121

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 122 EIHIDYQAQGREARVSA 138


>gi|126697721|ref|YP_001086618.1| putative ATP/GTP hydrolase [Clostridium difficile 630]
 gi|254973808|ref|ZP_05270280.1| putative ATP/GTP hydrolase [Clostridium difficile QCD-66c26]
 gi|255091195|ref|ZP_05320673.1| putative ATP/GTP hydrolase [Clostridium difficile CIP 107932]
 gi|255099309|ref|ZP_05328286.1| putative ATP/GTP hydrolase [Clostridium difficile QCD-63q42]
 gi|255305094|ref|ZP_05349266.1| putative ATP/GTP hydrolase [Clostridium difficile ATCC 43255]
 gi|255312852|ref|ZP_05354435.1| putative ATP/GTP hydrolase [Clostridium difficile QCD-76w55]
 gi|255515611|ref|ZP_05383287.1| putative ATP/GTP hydrolase [Clostridium difficile QCD-97b34]
 gi|255648705|ref|ZP_05395607.1| putative ATP/GTP hydrolase [Clostridium difficile QCD-37x79]
 gi|260681927|ref|YP_003213212.1| putative ATP/GTP hydrolase [Clostridium difficile CD196]
 gi|260685525|ref|YP_003216658.1| putative ATP/GTP hydrolase [Clostridium difficile R20291]
 gi|306518824|ref|ZP_07405171.1| putative ATP/GTP hydrolase [Clostridium difficile QCD-32g58]
 gi|115249158|emb|CAJ66969.1| putative P-loop ATPases [Clostridium difficile]
 gi|260208090|emb|CBA60336.1| putative ATP/GTP hydrolase [Clostridium difficile CD196]
 gi|260211541|emb|CBE01720.1| putative ATP/GTP hydrolase [Clostridium difficile R20291]
          Length = 150

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 82/137 (59%), Gaps = 3/137 (2%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +  I + NE  T  +G  L  +L+ G  + L GDLG+GK+ + +S+   L  +D   + S
Sbjct: 1   MAKIYLENENKTREIGYKLGKLLKEGSVICLVGDLGAGKTTMTQSLADSLGIEDY--ITS 58

Query: 68  PTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKY 126
           PTFT++  Y+  IP+ HFD YR+ S  E+ ++G+DE +N   ICIIEW  +   +LPK+Y
Sbjct: 59  PTFTIINEYEGKIPLYHFDVYRIGSSDEMYDIGYDEYVNSNGICIIEWANLIEDILPKEY 118

Query: 127 IDIHLSQGKTGRKATIS 143
           ++I L     GR+  ++
Sbjct: 119 LNIELRYKDEGREMILT 135


>gi|161505140|ref|YP_001572252.1| putative ATPase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160866487|gb|ABX23110.1| hypothetical protein SARI_03274 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 153

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 86/137 (62%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG+ +A+       + L GDLG+GK+  +R  ++ L H+    V SPT
Sbjct: 5   VIPLPDEQATLDLGQRVANACDGATVIYLYGDLGAGKTTFSRGFLQALGHNG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G+ +LP   +
Sbjct: 63  YTLVEPYALDNMMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGKGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIDYQAQGREARVSA 139


>gi|56416148|ref|YP_153223.1| ATPase [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|56130405|gb|AAV79911.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
          Length = 153

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 86/137 (62%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG+ +A+       + L GDLG+GK+  +R  ++ L H+    V SPT
Sbjct: 5   VIPLPDEQATLDLGQRVANACDGATVIYLYGDLGAGKTTFSRGFLQALGHNG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G+ +LP   +
Sbjct: 63  YTLVEPYALDNMMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGKGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIDYQTQGREARVSA 139


>gi|197365074|ref|YP_002144711.1| ATPase [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|197096551|emb|CAR62161.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 152

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 86/137 (62%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG+ +A+       + L GDLG+GK+  +R  ++ L H+    V SPT
Sbjct: 4   VIPLPDEQATLDLGQRVANACDGATVIYLYGDLGAGKTTFSRGFLQALGHNG--NVKSPT 61

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G+ +LP   +
Sbjct: 62  YTLVEPYALDNMMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGKGVLPDPDV 121

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 122 EIHIDYQTQGREARVSA 138


>gi|114798401|ref|YP_760588.1| hypothetical protein HNE_1887 [Hyphomonas neptunium ATCC 15444]
 gi|114738575|gb|ABI76700.1| conserved hypothetical protein TIGR00150 [Hyphomonas neptunium ATCC
           15444]
          Length = 151

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 78/121 (64%), Gaps = 3/121 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG+ +A ILR+GD + L GDLG+GK+ L R II+ L+     EV SPT+TL
Sbjct: 7   LEDEDATLSLGKSIAGILRVGDFVALHGDLGAGKTTLTRGIIQALLGGQE-EVPSPTYTL 65

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ+YD    P+ HFD YRL   + V ELG+DE + E + ++EWPE     LP+  +D+ L
Sbjct: 66  VQVYDGPDFPLWHFDLYRLEDPEGVEELGWDETV-EGVALVEWPEHAGRHLPQVRLDVLL 124

Query: 132 S 132
            
Sbjct: 125 E 125


>gi|311281280|ref|YP_003943511.1| hypothetical protein Entcl_3990 [Enterobacter cloacae SCF1]
 gi|308750475|gb|ADO50227.1| Uncharacterized protein family UPF0079, ATPase [Enterobacter
           cloacae SCF1]
          Length = 153

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 84/137 (61%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEQATLDLGNRLAKACDGATVIYLYGDLGAGKTTFSRGFLQALGHKG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G  +LP+  +
Sbjct: 63  YTLVEPYTLENLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGAGVLPEPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IHL+    GR+A ++A
Sbjct: 123 EIHLAYQAQGREARVTA 139


>gi|189184488|ref|YP_001938273.1| hypothetical protein OTT_1581 [Orientia tsutsugamushi str. Ikeda]
 gi|189181259|dbj|BAG41039.1| hypothetical protein OTT_1581 [Orientia tsutsugamushi str. Ikeda]
          Length = 140

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 76/123 (61%), Gaps = 2/123 (1%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I + N   T    +HLA  L+ G  +T SGDLG+GK+F+ R IIR +   + + V SPTF
Sbjct: 4   IKLGNRSATKAFAQHLAVNLKPGSIVTFSGDLGAGKTFICREIIRTICGMNTI-VSSPTF 62

Query: 71  TLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
            ++Q Y A +  + HFD YRL    E+ ELG ++   + IC+IEWPE+  +++P+ YI I
Sbjct: 63  NVLQRYQADTFAIYHFDLYRLRDSSEIYELGIEDAWQQNICLIEWPELIEAIIPRPYISI 122

Query: 130 HLS 132
            ++
Sbjct: 123 RIT 125


>gi|310659603|ref|YP_003937324.1| hypothetical protein CLOST_2302 [Clostridium sticklandii DSM 519]
 gi|308826381|emb|CBH22419.1| conserved protein of unknown function [Clostridium sticklandii]
          Length = 150

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 85/136 (62%), Gaps = 4/136 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I + +E+ T  +G  +  +L+  D L L+GDLG+GK+ + +SI R +  +D   + SPT
Sbjct: 1   MIYLIDEQMTKYIGEKIGKLLKPNDVLALTGDLGAGKTMMTQSIARGMGIEDY--ITSPT 58

Query: 70  FTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYID 128
           FT+VQ Y+  +P+ HFD YR++  +E+  +GFDE L    +CIIEW  +  S+LPK+ +D
Sbjct: 59  FTIVQEYEGKLPLFHFDVYRIADEEEMYYIGFDEYLARGGVCIIEWANLIESILPKERLD 118

Query: 129 IH-LSQGKTGRKATIS 143
           I  L   K GR   ++
Sbjct: 119 IELLYTEKEGRNMRLT 134


>gi|157803199|ref|YP_001491748.1| hypothetical protein A1E_00050 [Rickettsia canadensis str. McKiel]
 gi|157784462|gb|ABV72963.1| hypothetical protein A1E_00050 [Rickettsia canadensis str. McKiel]
          Length = 143

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/122 (41%), Positives = 77/122 (63%), Gaps = 2/122 (1%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I + NE+ T  L +  A  L+  D + L+ DLGSGK+F  R II++   ++   ++SPTF
Sbjct: 3   INLNNEEETKNLAKRFAQNLKPNDIVLLNSDLGSGKTFFCREIIKYFCGENT-SIISPTF 61

Query: 71  TLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
            L+Q Y AS   + H+D YRL S +E+ ELGF+E LN  + +IEW +I + LLP   I++
Sbjct: 62  NLLQTYKASNFTIYHYDLYRLKSPEEIYELGFEEALNGNLILIEWSQIIKHLLPTTLIEV 121

Query: 130 HL 131
           +L
Sbjct: 122 NL 123


>gi|283834786|ref|ZP_06354527.1| ATPase with strong ADP affinity [Citrobacter youngae ATCC 29220]
 gi|291069032|gb|EFE07141.1| ATPase with strong ADP affinity [Citrobacter youngae ATCC 29220]
          Length = 153

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 84/137 (61%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG+ +A        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEQATLDLGQRVAKACDGATVIYLYGDLGAGKTTFSRGFLQALGHKG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G+ +LP   +
Sbjct: 63  YTLVEPYSLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGKGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIEYQAQGREARVSA 139


>gi|255654240|ref|ZP_05399649.1| putative ATP/GTP hydrolase [Clostridium difficile QCD-23m63]
 gi|296452525|ref|ZP_06894222.1| ATP/GTP hydrolase [Clostridium difficile NAP08]
 gi|296881063|ref|ZP_06905006.1| ATP/GTP hydrolase [Clostridium difficile NAP07]
 gi|296258630|gb|EFH05528.1| ATP/GTP hydrolase [Clostridium difficile NAP08]
 gi|296427929|gb|EFH13833.1| ATP/GTP hydrolase [Clostridium difficile NAP07]
          Length = 150

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 81/137 (59%), Gaps = 3/137 (2%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +  I + NE  T  +G  L  +L+ G  + L GDLG+GK+ + +S+   L   D   + S
Sbjct: 1   MAKIYLENENKTREIGYKLGKLLKEGSVICLVGDLGAGKTTMTQSLADSLGIKDY--ITS 58

Query: 68  PTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKY 126
           PTFT++  Y+  IP+ HFD YR+ S  E+ ++G+DE +N   ICIIEW  +   +LPK+Y
Sbjct: 59  PTFTIINEYEGKIPLYHFDVYRIGSSDEMYDIGYDEYVNSNGICIIEWANLIEDILPKEY 118

Query: 127 IDIHLSQGKTGRKATIS 143
           ++I L     GR+  ++
Sbjct: 119 LNIELRYKDEGREMILT 135


>gi|163867335|ref|YP_001608529.1| hypothetical protein Btr_0030 [Bartonella tribocorum CIP 105476]
 gi|161016976|emb|CAK00534.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 155

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 82/143 (57%), Gaps = 1/143 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + NE+ T    ++LA  L+ GD +TL GDLG+GKS +AR+II+ L++DD ++V SPTFTL
Sbjct: 7   LENEEATKLFAKNLALSLKPGDLVTLQGDLGTGKSTIARTIIQTLVNDDTMDVPSPTFTL 66

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y      + H D YRLS  +E+ ELG  E   + I ++EWPE    LL      + L
Sbjct: 67  VQNYQLPQFEIIHADLYRLSMAEEIDELGLHEAREKNILLVEWPERSADLLEIATFALTL 126

Query: 132 SQGKTGRKATISAERWIISHINQ 154
                GR   + + +  I  + Q
Sbjct: 127 QYKAHGRHVILRSAQHSIECLQQ 149


>gi|302384285|ref|YP_003820108.1| hypothetical protein Bresu_3179 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194913|gb|ADL02485.1| protein of unknown function UPF0079 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 160

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 91/155 (58%), Gaps = 11/155 (7%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + +P+E  T  LG  LA  L +G+ + L G LG GKS LAR +IR L   D  +V SPTF
Sbjct: 7   VALPDEAATTALGAALAGSLGIGEAILLQGPLGMGKSTLARGLIRALTGPDE-DVPSPTF 65

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE-----IGRSLLPKK 125
           TLVQ+Y+   PVAHFD YRL+  +E  E+G DE L+    +IEWPE     + R+L P +
Sbjct: 66  TLVQVYETDPPVAHFDLYRLTRPEEAFEIGLDEALDLGCALIEWPERLGDDLDRALGPDR 125

Query: 126 YIDIHLSQGKTGRKATISA----ERWIISHINQMN 156
            + I +S+   GR AT+S      R I + I  +N
Sbjct: 126 -LSIVVSEDGDGRVATVSGVGAWARKIDAGIEGLN 159


>gi|123440756|ref|YP_001004748.1| putative ATPase [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|122087717|emb|CAL10502.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 156

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 83/137 (60%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+P+P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VLPLPDEAATVALGGALAHAFEGASVIYLFGDLGAGKTTFSRGFLQALGHSG--HVKSPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  +  PV HFD YRL+  +E+  +G  +  +++ IC++EWP++G   LP+  +
Sbjct: 63  YTLVEPYALTPRPVYHFDLYRLADPEELEFMGIRDYFDKQAICLVEWPQLGAGFLPQADV 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL+    GR+A + A
Sbjct: 123 ELHLAYQAAGREARLVA 139


>gi|296283895|ref|ZP_06861893.1| ATPase [Citromicrobium bathyomarinum JL354]
          Length = 152

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 80/140 (57%), Gaps = 8/140 (5%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           T I +P+      LG  +A+ +R GD + LSG LG+GK+ LAR+I+R   H  A EV SP
Sbjct: 4   TAIDLPDLAAMEALGARIAADMRPGDVIALSGPLGAGKTTLARAILRAAGH--AGEVPSP 61

Query: 69  TFTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKY- 126
           TFTL+++Y+A   PVAH DFYRL    EV ELG D+     + I EWPE       +   
Sbjct: 62  TFTLIEMYEALQPPVAHADFYRLEDPAEVEELGLDDYREGAVLIAEWPERAGGFAHEPAC 121

Query: 127 --IDIHL--SQGKTGRKATI 142
             ID+    +  + GRKA +
Sbjct: 122 LSIDVSFAGANAQAGRKAIV 141


>gi|212633659|ref|YP_002310184.1| hypothetical protein swp_0784 [Shewanella piezotolerans WP3]
 gi|212555143|gb|ACJ27597.1| Conserved hypothetical protein [Shewanella piezotolerans WP3]
          Length = 160

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 85/137 (62%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
            + + +E+ T+ LG  L++++     L LSGDLG+GK+  +R +I+ L HD A  V SPT
Sbjct: 7   TLDLKDEQATVSLGNKLSTLITPPLTLYLSGDLGAGKTTFSRGLIQSLGHDGA--VKSPT 64

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y+ A I V HFD YRL   +E+  +G  +   ER +CI+EWP+ G  LLP+  I
Sbjct: 65  YTLVEPYEIAGIDVFHFDLYRLYDPEELEFMGIRDYFTERSLCIVEWPDRGHGLLPQADI 124

Query: 128 DIHLSQGKTGRKATISA 144
            I++    TGR+  + A
Sbjct: 125 HIYIKYVNTGRQIELQA 141


>gi|238787535|ref|ZP_04631333.1| hypothetical protein yfred0001_20540 [Yersinia frederiksenii ATCC
           33641]
 gi|238724322|gb|EEQ15964.1| hypothetical protein yfred0001_20540 [Yersinia frederiksenii ATCC
           33641]
          Length = 156

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 83/137 (60%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+P+P+E  T+ LG  LA +      + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VLPLPDEAATVALGASLAHVFNGASVIYLFGDLGAGKTTFSRGFLQALGHSG--HVKSPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  +  PV HFD YRL+  +E+  +G  +  +++ IC++EWP+ G   LP+  +
Sbjct: 63  YTLVEPYALTPRPVYHFDLYRLADPEELEFMGIRDYFDKQAICLVEWPQQGAGFLPQADV 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL+    GR+A + A
Sbjct: 123 ELHLAYQDEGREARLMA 139


>gi|148285172|ref|YP_001249262.1| hypothetical protein OTBS_2170 [Orientia tsutsugamushi str.
           Boryong]
 gi|146740611|emb|CAM81265.1| conserved hypothetical protein [Orientia tsutsugamushi str.
           Boryong]
          Length = 140

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 76/123 (61%), Gaps = 2/123 (1%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I + N   T    +HLA  L+ G  +T SGDLG+GK+F+ R IIR +   + + V SPTF
Sbjct: 4   IKLGNRSATKAFAQHLAVNLKPGSIVTFSGDLGAGKTFICREIIRTICGMNTI-VSSPTF 62

Query: 71  TLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
            ++Q Y A +  + HFD YRL    E+ ELG ++   + +C+IEWPE+  +++P+ Y+ I
Sbjct: 63  NVLQRYQADNFAIYHFDLYRLRDSSEIYELGIEDAWQQNVCLIEWPELIEAIIPRPYVSI 122

Query: 130 HLS 132
            ++
Sbjct: 123 RIT 125


>gi|251788128|ref|YP_003002849.1| hypothetical protein Dd1591_0488 [Dickeya zeae Ech1591]
 gi|247536749|gb|ACT05370.1| protein of unknown function UPF0079 [Dickeya zeae Ech1591]
          Length = 160

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 90/158 (56%), Gaps = 9/158 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++P+P+E  TI LG  LA        + L GDLG+GK+ L+R  ++ L H     V SPT
Sbjct: 5   LLPLPDEAATIALGAALAKACERATIIYLLGDLGAGKTTLSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y     PV HFD YRL+  +E+  +G  + L++  +C+IEWP+ G  +LP   +
Sbjct: 63  YTLVEPYALLPRPVYHFDLYRLADPEELEFMGIRDYLSQDALCLIEWPQQGAGILPDADV 122

Query: 128 DIHLSQGKTGRKATISA-----ERWIISHINQMNRSTS 160
           ++ LS    GR+A I+A     ER + + I Q  +  S
Sbjct: 123 ELLLSYQGAGRQAEITARTPQGERMMATLIAQSEQDAS 160


>gi|270264994|ref|ZP_06193257.1| putative ATPase [Serratia odorifera 4Rx13]
 gi|270040928|gb|EFA14029.1| putative ATPase [Serratia odorifera 4Rx13]
          Length = 156

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 55/138 (39%), Positives = 82/138 (59%), Gaps = 6/138 (4%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+P+P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VLPLPDEAATVALGAALAKACDRASVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYDASIPVA--HFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKY 126
           +TLV+ Y A +P+A  HFD YRL+  +E+  +G  D    + IC++EWP+ G  +LP   
Sbjct: 63  YTLVEPY-ALLPLAVYHFDLYRLADPEELEFMGIRDYFAQDAICLVEWPQQGTGVLPDPD 121

Query: 127 IDIHLSQGKTGRKATISA 144
           +++HLS    GR+A I A
Sbjct: 122 LELHLSYQDQGREAKIQA 139


>gi|307132708|ref|YP_003884724.1| ATPase with strong ADP affinity [Dickeya dadantii 3937]
 gi|306530237|gb|ADN00168.1| ATPase with strong ADP affinity [Dickeya dadantii 3937]
          Length = 160

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++P+P+E  TI LG  LA        + L GDLG+GK+ L+R  ++ L H     V SPT
Sbjct: 5   LLPLPDEAATIALGAALARACERATIIYLLGDLGAGKTTLSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y     PV HFD YRL+  +E+  +G  + L++  +C+IEWP+ G   LP+  +
Sbjct: 63  YTLVEPYALLPRPVYHFDLYRLADPEELEFMGIRDYLSQDALCLIEWPQQGTGFLPQADV 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL     GR+A I+A
Sbjct: 123 ELHLGYQGAGRQAEINA 139


>gi|290512272|ref|ZP_06551639.1| conserved hypothetical protein [Klebsiella sp. 1_1_55]
 gi|289775267|gb|EFD83268.1| conserved hypothetical protein [Klebsiella sp. 1_1_55]
          Length = 153

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 83/137 (60%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A +      + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEQATLALGDRIAQVCTGATVIYLYGDLGAGKTTFSRGFLQALGHRG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   ++ IC++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYTLENLMVYHFDLYRLADPEELEFMGIRDYFADDAICLVEWPQQGAGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IHL     GR+A I+A
Sbjct: 123 EIHLDYQAQGREARITA 139


>gi|254563789|ref|YP_003070884.1| hypothetical protein METDI5466 [Methylobacterium extorquens DM4]
 gi|254271067|emb|CAX27074.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 542

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 54/106 (50%), Positives = 68/106 (64%), Gaps = 2/106 (1%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P E  T  +   LA ILR GD + LSG LG+GK+ LAR++IR L  D  LEV SPTFTL
Sbjct: 36  LPEEGATEDMAAFLAGILRPGDLVALSGGLGAGKTTLARAMIRELAGDPRLEVPSPTFTL 95

Query: 73  VQLYD--ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           +Q Y+  +   V H D YRL    E+VELGFDE+    I ++EWPE
Sbjct: 96  IQPYETRSGGAVIHADLYRLRGPDELVELGFDELSETAITLVEWPE 141


>gi|240141280|ref|YP_002965760.1| hypothetical protein MexAM1_META1p4874 [Methylobacterium extorquens
           AM1]
 gi|240011257|gb|ACS42483.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 542

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 54/106 (50%), Positives = 68/106 (64%), Gaps = 2/106 (1%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P E  T  +   LA ILR GD + LSG LG+GK+ LAR++IR L  D  LEV SPTFTL
Sbjct: 36  LPEEGATEDMAAFLAGILRPGDLVALSGGLGAGKTTLARAMIRELAGDPRLEVPSPTFTL 95

Query: 73  VQLYD--ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           +Q Y+  +   V H D YRL    E+VELGFDE+    I ++EWPE
Sbjct: 96  IQPYETRSGGAVIHADLYRLRGPDELVELGFDELSETAITLVEWPE 141


>gi|218532772|ref|YP_002423588.1| hypothetical protein Mchl_4895 [Methylobacterium chloromethanicum
           CM4]
 gi|218525075|gb|ACK85660.1| protein of unknown function UPF0079 [Methylobacterium
           chloromethanicum CM4]
          Length = 542

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 54/106 (50%), Positives = 68/106 (64%), Gaps = 2/106 (1%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P E  T  +   LA ILR GD + LSG LG+GK+ LAR++IR L  D  LEV SPTFTL
Sbjct: 36  LPEEGATEDMAAFLAGILRPGDLVALSGGLGAGKTTLARAMIRELAGDPRLEVPSPTFTL 95

Query: 73  VQLYD--ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           +Q Y+  +   V H D YRL    E+VELGFDE+    I ++EWPE
Sbjct: 96  IQPYETRSGGAVIHADLYRLRGPDELVELGFDELSETAITLVEWPE 141


>gi|163853827|ref|YP_001641870.1| hypothetical protein Mext_4431 [Methylobacterium extorquens PA1]
 gi|163665432|gb|ABY32799.1| protein of unknown function UPF0079 [Methylobacterium extorquens
           PA1]
          Length = 549

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 54/106 (50%), Positives = 68/106 (64%), Gaps = 2/106 (1%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P E  T  +   LA ILR GD + LSG LG+GK+ LAR++IR L  D  LEV SPTFTL
Sbjct: 43  LPEEGATEDMAAFLAGILRPGDLVALSGGLGAGKTTLARAMIRELAGDPRLEVPSPTFTL 102

Query: 73  VQLYD--ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           +Q Y+  +   V H D YRL    E+VELGFDE+    I ++EWPE
Sbjct: 103 IQPYETRSGGAVIHADLYRLRGPDELVELGFDELSETAITLVEWPE 148


>gi|120597488|ref|YP_962062.1| hypothetical protein Sputw3181_0657 [Shewanella sp. W3-18-1]
 gi|120557581|gb|ABM23508.1| protein of unknown function UPF0079 [Shewanella sp. W3-18-1]
 gi|319427726|gb|ADV55800.1| peptidoglycan biosynthesis related ATPase, YjeE [Shewanella
           putrefaciens 200]
          Length = 152

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 54/132 (40%), Positives = 85/132 (64%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE +TI +G+ LA  ++    L L+GDLG+GK+ L+R +I+ L H  A  V SPT+TLV+
Sbjct: 10  NEDDTIAVGQQLARYIKAPLTLYLTGDLGAGKTTLSRGLIQGLGHQGA--VKSPTYTLVE 67

Query: 75  LYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+ + + + HFD YRL+  +E+  +G  +  +++ +CI+EWP+ G  LLP   I +HLS
Sbjct: 68  PYELNGVEIYHFDLYRLNDPEELEFMGIRDYFSDKSLCIVEWPDKGEGLLPDADIHLHLS 127

Query: 133 QGKTGRKATISA 144
              +GR+  I A
Sbjct: 128 YVNSGREIHIQA 139


>gi|222056022|ref|YP_002538384.1| protein of unknown function UPF0079 [Geobacter sp. FRC-32]
 gi|221565311|gb|ACM21283.1| protein of unknown function UPF0079 [Geobacter sp. FRC-32]
          Length = 161

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 76/117 (64%), Gaps = 1/117 (0%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T+ +G+ L ++L+ GD + L G+LG+GK+ LA+ I   L  D ++ V SPT+TL+ +Y
Sbjct: 11  EETVSVGKKLGTLLQGGDFVALQGELGAGKTQLAKGIAEGLGVDPSIPVTSPTYTLLNVY 70

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
              +P  HFD YRL   Q++++LGFDE    + IC++EW E  + +LP  Y+ I +S
Sbjct: 71  SGRLPFYHFDLYRLHGGQDLLDLGFDEYFHGDGICLVEWAERLQEMLPDDYLLITMS 127


>gi|319898222|ref|YP_004158315.1| ATPase/phosphotransferase [Bartonella clarridgeiae 73]
 gi|319402186|emb|CBI75717.1| putative ATPase/Phosphotransferase [Bartonella clarridgeiae 73]
          Length = 506

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 59/145 (40%), Positives = 82/145 (56%), Gaps = 7/145 (4%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           MNFS        + +E+ TI   + LA  L+ GD +T  GDLG+GK+ L R++IR L ++
Sbjct: 1   MNFS------FFLESEEATILFAQDLALALKPGDLVTFQGDLGAGKTTLIRALIRTLANN 54

Query: 61  DALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGR 119
             +++ SPTF LVQ Y      V H DFYRLSS +E+ ELG  E   E + +IEWPE G 
Sbjct: 55  FTMDIPSPTFNLVQSYQLPQFEVLHADFYRLSSIEEIDELGLHESRKENVLLIEWPEKGA 114

Query: 120 SLLPKKYIDIHLSQGKTGRKATISA 144
            +L      I L     GR  T+++
Sbjct: 115 EILGPVTFAITLKHKDCGRYITLTS 139


>gi|157147863|ref|YP_001455182.1| putative ATPase [Citrobacter koseri ATCC BAA-895]
 gi|157085068|gb|ABV14746.1| hypothetical protein CKO_03667 [Citrobacter koseri ATCC BAA-895]
          Length = 153

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 83/137 (60%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEQATLDLGLRVAKACDGATVIYLYGDLGAGKTTFSRGFLQALGHKG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G+ +LP   +
Sbjct: 63  YTLVEPYTLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGKGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A ISA
Sbjct: 123 EIHIDYQAQGREARISA 139


>gi|298290315|ref|YP_003692254.1| hypothetical protein Snov_0301 [Starkeya novella DSM 506]
 gi|296926826|gb|ADH87635.1| protein of unknown function UPF0079 [Starkeya novella DSM 506]
          Length = 609

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 56/126 (44%), Positives = 80/126 (63%), Gaps = 6/126 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + +P+E  T  L   LA++LR GD + L GDLG+GK+ LAR++IR L  D  LEV SPTF
Sbjct: 20  VVLPDEVATGRLAMDLAAMLRPGDLVALDGDLGAGKTTLARALIRELAGDPELEVPSPTF 79

Query: 71  TLVQLYDASIP---VAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGR-SLLPKKY 126
           TL+Q YD  +P   V H D YRLS   E+ ELG+ E  +  + ++EWPE    ++L    
Sbjct: 80  TLMQTYD--LPRHRVVHADLYRLSDASELDELGWQEQTDGAVTLVEWPERAEGAVLKTDR 137

Query: 127 IDIHLS 132
           +++H+S
Sbjct: 138 LEVHIS 143


>gi|215489512|ref|YP_002331943.1| putative ATPase [Escherichia coli O127:H6 str. E2348/69]
 gi|215267584|emb|CAS12039.1| ATPase with strong ADP affinity [Escherichia coli O127:H6 str.
           E2348/69]
          Length = 153

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEQATLDLGERVAKACDGATVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYSLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGTGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIDYQAQGREARVSA 139


>gi|237729101|ref|ZP_04559582.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908830|gb|EEH94748.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 153

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 83/137 (60%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEQATLDLGLRVAKACDGATVIYLYGDLGAGKTTFSRGFLQALGHKG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G+ +LP   +
Sbjct: 63  YTLVEPYSLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGKGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIEYQAQGREARVSA 139


>gi|115522492|ref|YP_779403.1| hypothetical protein RPE_0464 [Rhodopseudomonas palustris BisA53]
 gi|115516439|gb|ABJ04423.1| protein of unknown function UPF0079 [Rhodopseudomonas palustris
           BisA53]
          Length = 507

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 56/139 (40%), Positives = 79/139 (56%), Gaps = 5/139 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + + NE  T  L   LA ++  GD + LSGDLG+GK+  AR++IR+L  D  L+V SPTF
Sbjct: 9   VALANETATAQLMADLALLIGPGDVIALSGDLGAGKTAAARAMIRYLSDDPELDVPSPTF 68

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
           TLVQ Y+  S P+ H D YR+    E+ E+G   +    + +IEWPE    LLP   I +
Sbjct: 69  TLVQSYELPSFPLLHADLYRIDDPSELEEIGLSPLPEGVVALIEWPERAPDLLPADRITL 128

Query: 130 HLSQ----GKTGRKATISA 144
            L+     G + R A I+ 
Sbjct: 129 ALTHRPALGSSARAAEITG 147


>gi|315617581|gb|EFU98187.1| conserved hypothetical protein [Escherichia coli 3431]
          Length = 152

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 4   VIPLPDEQATLDLGERIAKACDGATVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPT 61

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G  +LP   +
Sbjct: 62  YTLVEPYTLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGTGVLPDPDV 121

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 122 EIHIDYQAQGREARVSA 138


>gi|127511496|ref|YP_001092693.1| hypothetical protein Shew_0562 [Shewanella loihica PV-4]
 gi|126636791|gb|ABO22434.1| protein of unknown function UPF0079 [Shewanella loihica PV-4]
          Length = 157

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 55/132 (41%), Positives = 82/132 (62%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE  T+ LG+ LAS ++    L LSG+LG+GK+  +R +I+ L H  A  V SPT+TLV+
Sbjct: 10  NEAETVSLGQRLASAIKPPLTLYLSGELGAGKTTFSRGLIQSLGHKGA--VKSPTYTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+   I V HFD YRLS  +E+  +G  +   E  +CI+EWP+ G  LLP+  + IH+ 
Sbjct: 68  PYELGDIDVYHFDLYRLSDPEELEFMGIRDYFTESSLCIVEWPDKGVGLLPEADLAIHIQ 127

Query: 133 QGKTGRKATISA 144
             + GR+  ++A
Sbjct: 128 YHQQGREVMLTA 139


>gi|304410911|ref|ZP_07392528.1| Uncharacterized protein family UPF0079, ATPase [Shewanella baltica
           OS183]
 gi|307304918|ref|ZP_07584668.1| protein of unknown function UPF0079 [Shewanella baltica BA175]
 gi|304350808|gb|EFM15209.1| Uncharacterized protein family UPF0079, ATPase [Shewanella baltica
           OS183]
 gi|306912320|gb|EFN42744.1| protein of unknown function UPF0079 [Shewanella baltica BA175]
          Length = 152

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 84/134 (62%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + NE +TI +G+ LA  ++    L L+GDLG+GK+ L+R +I+ L H  A  V SPT+TL
Sbjct: 8   LDNEDDTIAVGQKLARHVQAPLTLYLTGDLGAGKTTLSRGLIQGLGHKGA--VKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+   + V HFD YRL+  +E+  +G  D   ++ +CI+EWP+ G  LLP   + +H
Sbjct: 66  VEPYELEGVEVYHFDLYRLNDPEELEFMGIRDYFTDKSLCIVEWPDKGEGLLPDADVHMH 125

Query: 131 LSQGKTGRKATISA 144
           LS   +GR+  I A
Sbjct: 126 LSYQNSGREIRIEA 139


>gi|15804757|ref|NP_290798.1| putative ATPase [Escherichia coli O157:H7 EDL933]
 gi|15834398|ref|NP_313171.1| ATPase [Escherichia coli O157:H7 str. Sakai]
 gi|16131990|ref|NP_418589.1| ADP-binding protein needed for nucleoid integrity [Escherichia coli
           str. K-12 substr. MG1655]
 gi|24115523|ref|NP_710033.1| putative ATPase [Shigella flexneri 2a str. 301]
 gi|30065540|ref|NP_839711.1| putative ATPase [Shigella flexneri 2a str. 2457T]
 gi|74314653|ref|YP_313072.1| putative ATPase [Shigella sonnei Ss046]
 gi|82546591|ref|YP_410538.1| ATPase [Shigella boydii Sb227]
 gi|82779450|ref|YP_405799.1| putative ATPase [Shigella dysenteriae Sd197]
 gi|89110888|ref|AP_004668.1| ATPase with strong ADP affinity [Escherichia coli str. K-12 substr.
           W3110]
 gi|110808086|ref|YP_691606.1| putative ATPase [Shigella flexneri 5 str. 8401]
 gi|157158929|ref|YP_001465665.1| putative ATPase [Escherichia coli E24377A]
 gi|157163631|ref|YP_001460949.1| putative ATPase [Escherichia coli HS]
 gi|168751482|ref|ZP_02776504.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4113]
 gi|168774121|ref|ZP_02799128.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4196]
 gi|170021822|ref|YP_001726776.1| putative ATPase [Escherichia coli ATCC 8739]
 gi|170083614|ref|YP_001732934.1| ATPase with strong ADP affinity [Escherichia coli str. K-12 substr.
           DH10B]
 gi|187732615|ref|YP_001882859.1| putative ATPase [Shigella boydii CDC 3083-94]
 gi|191165634|ref|ZP_03027474.1| putative P-loop hydrolase [Escherichia coli B7A]
 gi|193070851|ref|ZP_03051783.1| putative P-loop hydrolase [Escherichia coli E110019]
 gi|194426519|ref|ZP_03059073.1| putative P-loop hydrolase [Escherichia coli B171]
 gi|194439538|ref|ZP_03071612.1| putative P-loop hydrolase [Escherichia coli 101-1]
 gi|208813384|ref|ZP_03254713.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4045]
 gi|208820533|ref|ZP_03260853.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4042]
 gi|209921656|ref|YP_002295740.1| putative ATPase [Escherichia coli SE11]
 gi|218551438|ref|YP_002385230.1| ATPase [Escherichia fergusonii ATCC 35469]
 gi|218556720|ref|YP_002389634.1| putative ATPase [Escherichia coli IAI1]
 gi|218697917|ref|YP_002405584.1| putative ATPase [Escherichia coli 55989]
 gi|218702865|ref|YP_002410494.1| putative ATPase [Escherichia coli IAI39]
 gi|218707779|ref|YP_002415298.1| putative ATPase [Escherichia coli UMN026]
 gi|238903275|ref|YP_002929071.1| ATPase with strong ADP affinity [Escherichia coli BW2952]
 gi|253775207|ref|YP_003038038.1| ATPase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254037182|ref|ZP_04871259.1| ATPase with strong ADP affinity [Escherichia sp. 1_1_43]
 gi|254164097|ref|YP_003047205.1| putative ATPase [Escherichia coli B str. REL606]
 gi|254796187|ref|YP_003081024.1| putative ATPase [Escherichia coli O157:H7 str. TW14359]
 gi|256019813|ref|ZP_05433678.1| putative ATPase [Shigella sp. D9]
 gi|256025103|ref|ZP_05438968.1| putative ATPase [Escherichia sp. 4_1_40B]
 gi|260846998|ref|YP_003224776.1| ATPase with strong ADP affinity [Escherichia coli O103:H2 str.
           12009]
 gi|260858321|ref|YP_003232212.1| ATPase with strong ADP affinity [Escherichia coli O26:H11 str.
           11368]
 gi|260870924|ref|YP_003237326.1| ATPase with strong ADP affinity [Escherichia coli O111:H- str.
           11128]
 gi|291285580|ref|YP_003502398.1| hypothetical protein G2583_4995 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293402795|ref|ZP_06646892.1| UPF0079 ATP-binding protein yjeE [Escherichia coli FVEC1412]
 gi|293407895|ref|ZP_06651735.1| hypothetical protein ECEG_02819 [Escherichia coli B354]
 gi|293417671|ref|ZP_06660293.1| hypothetical protein ECDG_02587 [Escherichia coli B185]
 gi|293476478|ref|ZP_06664886.1| hypothetical protein ECCG_02798 [Escherichia coli B088]
 gi|298378325|ref|ZP_06988209.1| yjeE [Escherichia coli FVEC1302]
 gi|300816532|ref|ZP_07096753.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           107-1]
 gi|300821259|ref|ZP_07101407.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           119-7]
 gi|300899706|ref|ZP_07117932.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           198-1]
 gi|300905997|ref|ZP_07123721.1| hypothetical protein HMPREF9536_03983 [Escherichia coli MS 84-1]
 gi|300920808|ref|ZP_07137209.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           115-1]
 gi|300922426|ref|ZP_07138546.1| hypothetical protein HMPREF9548_00687 [Escherichia coli MS 182-1]
 gi|300929275|ref|ZP_07144751.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           187-1]
 gi|300940655|ref|ZP_07155216.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS 21-1]
 gi|300949127|ref|ZP_07163169.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           116-1]
 gi|300957827|ref|ZP_07170005.1| hypothetical protein HMPREF9547_03561 [Escherichia coli MS 175-1]
 gi|301023434|ref|ZP_07187217.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS 69-1]
 gi|301302584|ref|ZP_07208714.1| hypothetical protein HMPREF9347_01163 [Escherichia coli MS 124-1]
 gi|301325931|ref|ZP_07219352.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS 78-1]
 gi|301646613|ref|ZP_07246479.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           146-1]
 gi|307140862|ref|ZP_07500218.1| putative ATPase [Escherichia coli H736]
 gi|307314884|ref|ZP_07594476.1| protein of unknown function UPF0079 [Escherichia coli W]
 gi|309796979|ref|ZP_07691379.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           145-7]
 gi|312974025|ref|ZP_07788196.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|331644915|ref|ZP_08346032.1| putative nucleotide-binding protein [Escherichia coli H736]
 gi|331650293|ref|ZP_08351365.1| putative nucleotide-binding protein [Escherichia coli M605]
 gi|331655996|ref|ZP_08356984.1| putative nucleotide-binding protein [Escherichia coli M718]
 gi|331665832|ref|ZP_08366726.1| putative nucleotide-binding protein [Escherichia coli TA143]
 gi|331671073|ref|ZP_08371906.1| putative nucleotide-binding protein [Escherichia coli TA271]
 gi|331671319|ref|ZP_08372117.1| putative nucleotide-binding protein [Escherichia coli TA280]
 gi|331680298|ref|ZP_08380957.1| putative nucleotide-binding protein [Escherichia coli H591]
 gi|331681187|ref|ZP_08381824.1| putative nucleotide-binding protein [Escherichia coli H299]
 gi|332280952|ref|ZP_08393365.1| ATPase with strong ADP affinity [Shigella sp. D9]
 gi|84028057|sp|P0AF68|YJEE_ECO57 RecName: Full=UPF0079 ATP-binding protein yjeE
 gi|84028058|sp|P0AF67|YJEE_ECOLI RecName: Full=UPF0079 ATP-binding protein yjeE
 gi|84028059|sp|P0AF69|YJEE_SHIFL RecName: Full=UPF0079 ATP-binding protein yjeE
 gi|12519153|gb|AAG59364.1|AE005650_3 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|304913|gb|AAA20096.1| urf2 [Escherichia coli]
 gi|537009|gb|AAA97064.1| urf2 of GenBank Accession Number L19346 [Escherichia coli str. K-12
           substr. MG1655]
 gi|1790610|gb|AAC77125.1| ADP-binding protein needed for nucleoid integrity [Escherichia coli
           str. K-12 substr. MG1655]
 gi|13364621|dbj|BAB38567.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|24054850|gb|AAN45740.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30043804|gb|AAP19523.1| hypothetical protein S4591 [Shigella flexneri 2a str. 2457T]
 gi|73858130|gb|AAZ90837.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81243598|gb|ABB64308.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81248002|gb|ABB68710.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|85676919|dbj|BAE78169.1| ATPase with strong ADP affinity [Escherichia coli str. K12 substr.
           W3110]
 gi|110617634|gb|ABF06301.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|157069311|gb|ABV08566.1| conserved hypothetical protein TIGR00150 [Escherichia coli HS]
 gi|157080959|gb|ABV20667.1| conserved hypothetical protein TIGR00150 [Escherichia coli E24377A]
 gi|169756750|gb|ACA79449.1| protein of unknown function UPF0079 [Escherichia coli ATCC 8739]
 gi|169891449|gb|ACB05156.1| ATPase with strong ADP affinity [Escherichia coli str. K-12 substr.
           DH10B]
 gi|187429607|gb|ACD08881.1| putative P-loop hydrolase [Shigella boydii CDC 3083-94]
 gi|187770290|gb|EDU34134.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4196]
 gi|188014487|gb|EDU52609.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4113]
 gi|190904329|gb|EDV64038.1| putative P-loop hydrolase [Escherichia coli B7A]
 gi|192955797|gb|EDV86268.1| putative P-loop hydrolase [Escherichia coli E110019]
 gi|194415258|gb|EDX31526.1| putative P-loop hydrolase [Escherichia coli B171]
 gi|194421537|gb|EDX37550.1| putative P-loop hydrolase [Escherichia coli 101-1]
 gi|208734661|gb|EDZ83348.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4045]
 gi|208740656|gb|EDZ88338.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4042]
 gi|209750318|gb|ACI73466.1| hypothetical protein ECs5144 [Escherichia coli]
 gi|209750320|gb|ACI73467.1| hypothetical protein ECs5144 [Escherichia coli]
 gi|209750322|gb|ACI73468.1| hypothetical protein ECs5144 [Escherichia coli]
 gi|209750324|gb|ACI73469.1| hypothetical protein ECs5144 [Escherichia coli]
 gi|209750326|gb|ACI73470.1| hypothetical protein ECs5144 [Escherichia coli]
 gi|209914915|dbj|BAG79989.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218354649|emb|CAV01637.1| ATPase with strong ADP affinity [Escherichia coli 55989]
 gi|218358980|emb|CAQ91640.1| ATPase with strong ADP affinity [Escherichia fergusonii ATCC 35469]
 gi|218363489|emb|CAR01143.1| ATPase with strong ADP affinity [Escherichia coli IAI1]
 gi|218372851|emb|CAR20730.1| ATPase with strong ADP affinity [Escherichia coli IAI39]
 gi|218434876|emb|CAR15814.1| ATPase with strong ADP affinity [Escherichia coli UMN026]
 gi|222035938|emb|CAP78683.1| UPF0079 ATP-binding protein yjeE [Escherichia coli LF82]
 gi|226840288|gb|EEH72290.1| ATPase with strong ADP affinity [Escherichia sp. 1_1_43]
 gi|238860038|gb|ACR62036.1| ATPase with strong ADP affinity [Escherichia coli BW2952]
 gi|242379691|emb|CAQ34514.1| essential protein with weak ATPase activity [Escherichia coli
           BL21(DE3)]
 gi|253326251|gb|ACT30853.1| protein of unknown function UPF0079 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975998|gb|ACT41669.1| ATPase with strong ADP affinity [Escherichia coli B str. REL606]
 gi|253980154|gb|ACT45824.1| ATPase with strong ADP affinity [Escherichia coli BL21(DE3)]
 gi|254595587|gb|ACT74948.1| ATPase with strong ADP affinity [Escherichia coli O157:H7 str.
           TW14359]
 gi|257756970|dbj|BAI28472.1| ATPase with strong ADP affinity [Escherichia coli O26:H11 str.
           11368]
 gi|257762145|dbj|BAI33642.1| ATPase with strong ADP affinity [Escherichia coli O103:H2 str.
           12009]
 gi|257767280|dbj|BAI38775.1| ATPase with strong ADP affinity [Escherichia coli O111:H- str.
           11128]
 gi|260451005|gb|ACX41427.1| protein of unknown function UPF0079 [Escherichia coli DH1]
 gi|281181264|dbj|BAI57594.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|281603630|gb|ADA76614.1| ATP-binding protein yjeE [Shigella flexneri 2002017]
 gi|284924350|emb|CBG37466.1| putative hydrolase [Escherichia coli 042]
 gi|290765453|gb|ADD59414.1| UPF0079 ATP-binding protein yjeE [Escherichia coli O55:H7 str.
           CB9615]
 gi|291320931|gb|EFE60373.1| hypothetical protein ECCG_02798 [Escherichia coli B088]
 gi|291429710|gb|EFF02724.1| UPF0079 ATP-binding protein yjeE [Escherichia coli FVEC1412]
 gi|291430389|gb|EFF03387.1| hypothetical protein ECDG_02587 [Escherichia coli B185]
 gi|291472146|gb|EFF14628.1| hypothetical protein ECEG_02819 [Escherichia coli B354]
 gi|298280659|gb|EFI22160.1| yjeE [Escherichia coli FVEC1302]
 gi|300315458|gb|EFJ65242.1| hypothetical protein HMPREF9547_03561 [Escherichia coli MS 175-1]
 gi|300356717|gb|EFJ72587.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           198-1]
 gi|300397021|gb|EFJ80559.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS 69-1]
 gi|300402164|gb|EFJ85702.1| hypothetical protein HMPREF9536_03983 [Escherichia coli MS 84-1]
 gi|300412231|gb|EFJ95541.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           115-1]
 gi|300421245|gb|EFK04556.1| hypothetical protein HMPREF9548_00687 [Escherichia coli MS 182-1]
 gi|300451375|gb|EFK14995.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           116-1]
 gi|300454543|gb|EFK18036.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS 21-1]
 gi|300462768|gb|EFK26261.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           187-1]
 gi|300526148|gb|EFK47217.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           119-7]
 gi|300530762|gb|EFK51824.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           107-1]
 gi|300842109|gb|EFK69869.1| hypothetical protein HMPREF9347_01163 [Escherichia coli MS 124-1]
 gi|300847284|gb|EFK75044.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS 78-1]
 gi|301075160|gb|EFK89966.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           146-1]
 gi|306905687|gb|EFN36216.1| protein of unknown function UPF0079 [Escherichia coli W]
 gi|308119392|gb|EFO56654.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           145-7]
 gi|309704673|emb|CBJ04023.1| putative hydrolase [Escherichia coli ETEC H10407]
 gi|310331559|gb|EFP98815.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|313646357|gb|EFS10819.1| hypothetical protein SF2457T_5267 [Shigella flexneri 2a str. 2457T]
 gi|315063482|gb|ADT77809.1| ATPase with strong ADP affinity [Escherichia coli W]
 gi|315138722|dbj|BAJ45881.1| hypothetical protein ECDH1ME8569_4025 [Escherichia coli DH1]
 gi|315255512|gb|EFU35480.1| ATPase with strong ADP affinity [Escherichia coli MS 85-1]
 gi|320173678|gb|EFW48868.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Shigella dysenteriae CDC 74-1112]
 gi|320190700|gb|EFW65350.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Escherichia coli O157:H7 str. EC1212]
 gi|320200702|gb|EFW75288.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Escherichia coli EC4100B]
 gi|320655009|gb|EFX22970.1| ADP-binding protein [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320660516|gb|EFX27977.1| ADP-binding protein [Escherichia coli O55:H7 str. USDA 5905]
 gi|320665785|gb|EFX32822.1| ADP-binding protein [Escherichia coli O157:H7 str. LSU-61]
 gi|323156015|gb|EFZ42177.1| hypothetical protein ECEPECA14_2117 [Escherichia coli EPECa14]
 gi|323160284|gb|EFZ46239.1| hypothetical protein ECE128010_3202 [Escherichia coli E128010]
 gi|323166650|gb|EFZ52408.1| hypothetical protein SS53G_2987 [Shigella sonnei 53G]
 gi|323176074|gb|EFZ61666.1| hypothetical protein ECOK1180_4760 [Escherichia coli 1180]
 gi|323182274|gb|EFZ67684.1| hypothetical protein ECOK1357_4575 [Escherichia coli 1357]
 gi|323189953|gb|EFZ75231.1| hypothetical protein ECRN5871_1740 [Escherichia coli RN587/1]
 gi|323380439|gb|ADX52707.1| Uncharacterized protein family UPF0079, ATPase [Escherichia coli
           KO11]
 gi|323935398|gb|EGB31742.1| ATP-binding protein yjeE [Escherichia coli E1520]
 gi|323940087|gb|EGB36281.1| hypothetical protein ERDG_03284 [Escherichia coli E482]
 gi|323946016|gb|EGB42053.1| ATP-binding protein yjeE [Escherichia coli H120]
 gi|323960316|gb|EGB55956.1| hypothetical protein ERGG_03173 [Escherichia coli H489]
 gi|323965554|gb|EGB61008.1| hypothetical protein ERJG_03048 [Escherichia coli M863]
 gi|323970577|gb|EGB65836.1| hypothetical protein ERHG_03446 [Escherichia coli TA007]
 gi|323975491|gb|EGB70592.1| hypothetical protein ERFG_03716 [Escherichia coli TW10509]
 gi|324019346|gb|EGB88565.1| hypothetical protein HMPREF9542_01950 [Escherichia coli MS 117-3]
 gi|324112235|gb|EGC06213.1| hypothetical protein ERIG_03203 [Escherichia fergusonii B253]
 gi|324118733|gb|EGC12625.1| hypothetical protein ERBG_01401 [Escherichia coli E1167]
 gi|325499704|gb|EGC97563.1| putative ATPase [Escherichia fergusonii ECD227]
 gi|326345500|gb|EGD69243.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Escherichia coli O157:H7 str. 1125]
 gi|331035890|gb|EGI08128.1| putative nucleotide-binding protein [Escherichia coli H736]
 gi|331040687|gb|EGI12845.1| putative nucleotide-binding protein [Escherichia coli M605]
 gi|331046350|gb|EGI18440.1| putative nucleotide-binding protein [Escherichia coli M718]
 gi|331056883|gb|EGI28877.1| putative nucleotide-binding protein [Escherichia coli TA143]
 gi|331061662|gb|EGI33588.1| putative nucleotide-binding protein [Escherichia coli TA271]
 gi|331071164|gb|EGI42521.1| putative nucleotide-binding protein [Escherichia coli TA280]
 gi|331071761|gb|EGI43097.1| putative nucleotide-binding protein [Escherichia coli H591]
 gi|331081408|gb|EGI52569.1| putative nucleotide-binding protein [Escherichia coli H299]
 gi|332087014|gb|EGI92148.1| hypothetical protein SB359474_4938 [Shigella boydii 3594-74]
 gi|332103304|gb|EGJ06650.1| ATPase with strong ADP affinity [Shigella sp. D9]
 gi|332749044|gb|EGJ79467.1| hypothetical protein SFK671_5088 [Shigella flexneri K-671]
 gi|332749312|gb|EGJ79733.1| hypothetical protein SF434370_4679 [Shigella flexneri 4343-70]
 gi|332761887|gb|EGJ92161.1| hypothetical protein SF274771_0240 [Shigella flexneri 2747-71]
 gi|333009442|gb|EGK28898.1| hypothetical protein SFK218_0114 [Shigella flexneri K-218]
 gi|333010315|gb|EGK29748.1| hypothetical protein SFVA6_0108 [Shigella flexneri VA-6]
 gi|333011150|gb|EGK30564.1| hypothetical protein SFK272_0103 [Shigella flexneri K-272]
 gi|333012031|gb|EGK31416.1| hypothetical protein SFK304_5383 [Shigella flexneri K-304]
 gi|333012656|gb|EGK32036.1| hypothetical protein SFK227_5091 [Shigella flexneri K-227]
          Length = 153

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEQATLDLGERVAKACDGATVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYTLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGTGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIDYQAQGREARVSA 139


>gi|170766694|ref|ZP_02901147.1| putative P-loop hydrolase [Escherichia albertii TW07627]
 gi|170124132|gb|EDS93063.1| putative P-loop hydrolase [Escherichia albertii TW07627]
          Length = 153

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEQATLDLGERIAKACDGATVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYTLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGTGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIDYQAQGREARVSA 139


>gi|300721484|ref|YP_003710759.1| hypothetical protein XNC1_0451 [Xenorhabdus nematophila ATCC 19061]
 gi|297627976|emb|CBJ88525.1| putative enzyme with nucleoside triP hydrolase domain [Xenorhabdus
           nematophila ATCC 19061]
          Length = 153

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 80/137 (58%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ +PNE  T+ LG  +A+I   G  + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VLSLPNENATVALGNAVAAISDRGYVIYLYGDLGAGKTTFSRGFLQALGHQG--HVKSPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y     PV HFD YRL+  +E+  +G  D    + IC++EWP+ G  +LP   I
Sbjct: 63  YTLVEPYALQPRPVYHFDLYRLADPEELEFMGIRDYFHQDSICLVEWPQQGTGVLPDADI 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HLS    GR+A   A
Sbjct: 123 ELHLSYDSEGRQARFIA 139


>gi|238757515|ref|ZP_04618700.1| hypothetical protein yaldo0001_30090 [Yersinia aldovae ATCC 35236]
 gi|238704277|gb|EEP96809.1| hypothetical protein yaldo0001_30090 [Yersinia aldovae ATCC 35236]
          Length = 156

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 83/137 (60%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+P+P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H+    V SPT
Sbjct: 5   VLPLPDEAATVALGAALAHAFNGASVIYLFGDLGAGKTTFSRGFLQSLGHNG--HVKSPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  +  PV HFD YRL+  +E+  +G  +  +++ IC++EWP+ G   LP+  +
Sbjct: 63  YTLVEPYALNPRPVYHFDLYRLADPEELEFMGIRDYFDKQAICLVEWPQQGAGFLPQADV 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL+    GR+A + A
Sbjct: 123 ELHLAYQDEGREARLVA 139


>gi|126172803|ref|YP_001048952.1| hypothetical protein Sbal_0554 [Shewanella baltica OS155]
 gi|153002277|ref|YP_001367958.1| hypothetical protein Shew185_3771 [Shewanella baltica OS185]
 gi|160877001|ref|YP_001556317.1| hypothetical protein Sbal195_3897 [Shewanella baltica OS195]
 gi|217974864|ref|YP_002359615.1| hypothetical protein Sbal223_3714 [Shewanella baltica OS223]
 gi|125996008|gb|ABN60083.1| protein of unknown function UPF0079 [Shewanella baltica OS155]
 gi|151366895|gb|ABS09895.1| protein of unknown function UPF0079 [Shewanella baltica OS185]
 gi|160862523|gb|ABX51057.1| protein of unknown function UPF0079 [Shewanella baltica OS195]
 gi|217499999|gb|ACK48192.1| protein of unknown function UPF0079 [Shewanella baltica OS223]
 gi|315269204|gb|ADT96057.1| Uncharacterised protein family UPF0079, ATPase [Shewanella baltica
           OS678]
          Length = 152

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 84/134 (62%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + NE +TI +G+ LA  ++    L L+GDLG+GK+ L+R +I+ L H  A  V SPT+TL
Sbjct: 8   LDNEDDTIAVGQKLARHVQAPLTLYLTGDLGAGKTTLSRGLIQGLGHKGA--VKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+   + V HFD YRL+  +E+  +G  D   ++ +CI+EWP+ G  LLP   + +H
Sbjct: 66  VEPYELEGVEVYHFDLYRLNDPEELEFMGIRDYFTDKSLCIVEWPDKGEGLLPDADVHMH 125

Query: 131 LSQGKTGRKATISA 144
           LS   +GR+  I A
Sbjct: 126 LSYQNSGREIRIEA 139


>gi|210620545|ref|ZP_03292093.1| hypothetical protein CLOHIR_00036 [Clostridium hiranonis DSM 13275]
 gi|210155259|gb|EEA86265.1| hypothetical protein CLOHIR_00036 [Clostridium hiranonis DSM 13275]
          Length = 174

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 88/156 (56%), Gaps = 6/156 (3%)

Query: 4   SEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDAL 63
           +E ++  I + +E  T  LG  L  ++  G  + L GDLG+GK+   +S  + L  DD  
Sbjct: 21  TEINMKRIFLEDENKTKELGEKLGKLVDAGSIICLVGDLGAGKTTFTQSFAKSLGVDDY- 79

Query: 64  EVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLL 122
            + SPTFT+V  Y   +P+ HFD YR+   +E+ ++G+DE +N + +CIIEW  +   +L
Sbjct: 80  -ITSPTFTIVNEYQGRLPLYHFDVYRIGCSEEMYDIGYDEYINSDGVCIIEWANLIEDIL 138

Query: 123 PKKYIDIHLSQGKTGRKATIS--AERWIISHINQMN 156
           P +Y+ I +   + GR+ T     E++    I +MN
Sbjct: 139 PDEYLKIDMKYKEMGREVTFEPVGEKY-EKMIEEMN 173


>gi|296100935|ref|YP_003611081.1| hypothetical protein ECL_00566 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295055394|gb|ADF60132.1| conserved hypothetical protein [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 153

 Score =  100 bits (249), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 82/135 (60%), Gaps = 4/135 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
            IP+P+E+ T+ LG+ +A   +    + L GDLG+GK+  +R  ++ L H+    V SPT
Sbjct: 5   AIPLPDEQATLELGKRVAQACQGATVIYLYGDLGAGKTTFSRGFLQALGHNG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYTLENLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGAGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATI 142
           +IHL     GR+A I
Sbjct: 123 EIHLDYQAQGREARI 137


>gi|170684296|ref|YP_001746563.1| putative ATPase [Escherichia coli SMS-3-5]
 gi|189010212|ref|ZP_03006242.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4076]
 gi|189402048|ref|ZP_03006565.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4401]
 gi|189402786|ref|ZP_03006842.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4486]
 gi|189403842|ref|ZP_03007239.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4501]
 gi|189404597|ref|ZP_03007518.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC869]
 gi|189406185|ref|ZP_03008099.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC508]
 gi|193065997|ref|ZP_03047055.1| putative P-loop hydrolase [Escherichia coli E22]
 gi|195935958|ref|ZP_03081340.1| putative ATPase [Escherichia coli O157:H7 str. EC4024]
 gi|208807656|ref|ZP_03249993.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4206]
 gi|209400173|ref|YP_002273710.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4115]
 gi|217326587|ref|ZP_03442671.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. TW14588]
 gi|261225288|ref|ZP_05939569.1| ATPase with strong ADP affinity [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255460|ref|ZP_05947993.1| ATPase with strong ADP affinity [Escherichia coli O157:H7 str.
           FRIK966]
 gi|297520820|ref|ZP_06939206.1| putative ATPase [Escherichia coli OP50]
 gi|301027990|ref|ZP_07191274.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           196-1]
 gi|309787672|ref|ZP_07682283.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|170522014|gb|ACB20192.1| putative P-loop hydrolase [Escherichia coli SMS-3-5]
 gi|189001828|gb|EDU70814.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4076]
 gi|189357785|gb|EDU76204.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4401]
 gi|189363919|gb|EDU82338.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4486]
 gi|189368936|gb|EDU87352.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4501]
 gi|189374763|gb|EDU93179.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC869]
 gi|189376080|gb|EDU94496.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC508]
 gi|192926320|gb|EDV80956.1| putative P-loop hydrolase [Escherichia coli E22]
 gi|208727457|gb|EDZ77058.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4206]
 gi|209161573|gb|ACI39006.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. EC4115]
 gi|217322808|gb|EEC31232.1| putative P-loop hydrolase [Escherichia coli O157:H7 str. TW14588]
 gi|299878900|gb|EFI87111.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           196-1]
 gi|308924422|gb|EFP69918.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|312948817|gb|ADR29644.1| putative ATPase [Escherichia coli O83:H1 str. NRG 857C]
 gi|320180681|gb|EFW55608.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Shigella boydii ATCC 9905]
 gi|320187046|gb|EFW61757.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Shigella flexneri CDC 796-83]
 gi|320193548|gb|EFW68185.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Escherichia coli WV_060327]
 gi|320638926|gb|EFX08572.1| ADP-binding protein [Escherichia coli O157:H7 str. G5101]
 gi|320644295|gb|EFX13360.1| ADP-binding protein [Escherichia coli O157:H- str. 493-89]
 gi|320649613|gb|EFX18137.1| ADP-binding protein [Escherichia coli O157:H- str. H 2687]
 gi|323171599|gb|EFZ57245.1| hypothetical protein ECLT68_3808 [Escherichia coli LT-68]
 gi|326346643|gb|EGD70377.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Escherichia coli O157:H7 str. 1044]
 gi|327250108|gb|EGE61827.1| hypothetical protein ECSTEC7V_4912 [Escherichia coli STEC_7v]
 gi|330908510|gb|EGH37029.1| ATPase YjeE [Escherichia coli AA86]
 gi|332083814|gb|EGI89032.1| hypothetical protein SD15574_5220 [Shigella dysenteriae 155-74]
 gi|332346244|gb|AEE59578.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|332763215|gb|EGJ93458.1| essential protein with weak ATPase activity [Shigella flexneri
           2930-71]
          Length = 152

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 4   VIPLPDEQATLDLGERVAKACDGATVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPT 61

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G  +LP   +
Sbjct: 62  YTLVEPYTLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGTGVLPDPDV 121

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 122 EIHIDYQAQGREARVSA 138


>gi|332160018|ref|YP_004296595.1| putative ATPase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318607425|emb|CBY28923.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Yersinia enterocolitica subsp. palearctica
           Y11]
 gi|325664248|gb|ADZ40892.1| putative ATPase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 156

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+P+P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VLPLPDEAATVALGGALAHAFEGASVIYLFGDLGAGKTTFSRGFLQALGHSG--HVKSPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  +  PV HFD YRL+  +E+  +G  +  +++ IC++EWP+ G   LP+  +
Sbjct: 63  YTLVEPYALTPRPVYHFDLYRLADPEELEFMGIRDYFDKQAICLVEWPQQGAGFLPQADV 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL+    GR+A + A
Sbjct: 123 ELHLAYQAEGREARLVA 139


>gi|238755897|ref|ZP_04617225.1| hypothetical protein yruck0001_26140 [Yersinia ruckeri ATCC 29473]
 gi|238705856|gb|EEP98245.1| hypothetical protein yruck0001_26140 [Yersinia ruckeri ATCC 29473]
          Length = 156

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 81/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+P+P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VLPLPDEAATVALGARLAQAFDGASVIYLFGDLGAGKTTFSRGFLQALGHQG--HVKSPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  +  PV HFD YRL+  +E+  +G  +  +++ IC++EWP+ G   LP   I
Sbjct: 63  YTLVEPYTLTPRPVYHFDLYRLADPEELEFMGIRDYFDQQAICLVEWPQQGVGFLPDPDI 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL+    GR+A + A
Sbjct: 123 ELHLAYQPQGREARLVA 139


>gi|294675598|ref|YP_003576213.1| hypothetical protein RCAP_rcc00041 [Rhodobacter capsulatus SB 1003]
 gi|294474418|gb|ADE83806.1| protein of unknown function UPF0079, ATPase [Rhodobacter capsulatus
           SB 1003]
          Length = 158

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 72/120 (60%), Gaps = 1/120 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+   T   G  +A +LR GD L L G +G+GK+  AR++IR  +     +V SPTFTL
Sbjct: 12  LPDADATDRFGIAMARLLRAGDVLLLEGPIGAGKTHFARALIRARLGGPE-DVPSPTFTL 70

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ+Y A   + H D YRL+   E VELG +E  +  IC+IEWPE    LLP+K + +  S
Sbjct: 71  VQVYGADPEIWHADLYRLTHPDEAVELGLEEAFDTAICLIEWPERLGDLLPEKALSLQFS 130


>gi|2801652|gb|AAB97417.1| unknown [Bradyrhizobium japonicum]
          Length = 157

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 51/111 (45%), Positives = 69/111 (62%), Gaps = 1/111 (0%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE  T  L   LA ++  GD +TL+GDLG+GK+  AR++IR+L  D+ALEV SPTFTLVQ
Sbjct: 13  NETATAQLMADLALLVGPGDVITLTGDLGAGKTAAARAMIRYLADDEALEVPSPTFTLVQ 72

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPK 124
            Y+    PV H D YR+    E+ E+G     +  + +IEWPE  R   P+
Sbjct: 73  GYELPPFPVMHADLYRVEDESELEEIGCRRCSDATLVLIEWPERARRRCPR 123


>gi|26251060|ref|NP_757100.1| putative ATPase [Escherichia coli CFT073]
 gi|218692502|ref|YP_002400714.1| putative ATPase [Escherichia coli ED1a]
 gi|227886789|ref|ZP_04004594.1| ATPase [Escherichia coli 83972]
 gi|300987267|ref|ZP_07178096.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS 45-1]
 gi|301045960|ref|ZP_07193144.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           185-1]
 gi|306815617|ref|ZP_07449766.1| putative ATPase [Escherichia coli NC101]
 gi|331660743|ref|ZP_08361675.1| putative nucleotide-binding protein [Escherichia coli TA206]
 gi|26111492|gb|AAN83674.1|AE016771_185 Hypothetical protein yjeE [Escherichia coli CFT073]
 gi|218430066|emb|CAR10911.1| ATPase with strong ADP affinity [Escherichia coli ED1a]
 gi|227836362|gb|EEJ46828.1| ATPase [Escherichia coli 83972]
 gi|300302043|gb|EFJ58428.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           185-1]
 gi|300407744|gb|EFJ91282.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS 45-1]
 gi|305851279|gb|EFM51734.1| putative ATPase [Escherichia coli NC101]
 gi|315293550|gb|EFU52902.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           153-1]
 gi|315299049|gb|EFU58303.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS 16-3]
 gi|324005231|gb|EGB74450.1| hypothetical protein HMPREF9532_05103 [Escherichia coli MS 57-2]
 gi|331051785|gb|EGI23824.1| putative nucleotide-binding protein [Escherichia coli TA206]
          Length = 153

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEQATLDLGERVAKACDGATVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYTLDNLLVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGTGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIDYQAQGREARVSA 139


>gi|254504520|ref|ZP_05116671.1| uncharacterized P-loop hydrolase UPF0079, putative [Labrenzia
           alexandrii DFL-11]
 gi|222440591|gb|EEE47270.1| uncharacterized P-loop hydrolase UPF0079, putative [Labrenzia
           alexandrii DFL-11]
          Length = 510

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 60/126 (47%), Positives = 84/126 (66%), Gaps = 1/126 (0%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + + +E +T  L   LA+IL+ GD L LSGDLG+GKS  +R++IR +  D  LEV SPTF
Sbjct: 16  LSLKDESDTRQLAEDLAAILKPGDLLCLSGDLGAGKSTFSRALIRNMAGDPDLEVPSPTF 75

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
           TLVQ YD   +P+AHFD YRL   +E+ ELG +EIL +   +IEWPE+ + LLP+  + +
Sbjct: 76  TLVQPYDLPRLPLAHFDLYRLEEPEEIEELGLEEILEDSAALIEWPEMAKDLLPESALWL 135

Query: 130 HLSQGK 135
               G+
Sbjct: 136 QFRHGR 141


>gi|212709949|ref|ZP_03318077.1| hypothetical protein PROVALCAL_01000 [Providencia alcalifaciens DSM
           30120]
 gi|212687358|gb|EEB46886.1| hypothetical protein PROVALCAL_01000 [Providencia alcalifaciens DSM
           30120]
          Length = 154

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
            I + NE+ T+ LGR +A   + G  + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   TIQLANEEQTVALGRTIAMACKQGAIINLYGDLGAGKTTFSRGFLQALGHKG--HVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y+ A   V HFD YRL+  +E+  +G  D   +  +C++EWP+ G+  LP+  +
Sbjct: 63  YTLVEPYELADRHVFHFDLYRLADPEELEFMGIRDYFSDTSVCLVEWPQQGKGFLPEADL 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IHL+    GR+A + A
Sbjct: 123 EIHLTYQNEGRQARVVA 139


>gi|163797149|ref|ZP_02191104.1| hypothetical protein BAL199_11586 [alpha proteobacterium BAL199]
 gi|159177665|gb|EDP62218.1| hypothetical protein BAL199_11586 [alpha proteobacterium BAL199]
          Length = 161

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 83/143 (58%), Gaps = 4/143 (2%)

Query: 6   KHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEV 65
           + +T++ +P+   T  L   +A++ R G+ + LSG LG+GKS  AR+ +R  + D A EV
Sbjct: 5   RTVTIVDLPDLAATERLAGRIAALARPGEAVLLSGPLGAGKSAFARAFVRAWVDDPAAEV 64

Query: 66  LSPTFTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPK 124
            SPTFTLVQ YD     V H D YRL   +E+ ELG D+   E + ++EWP+     LP 
Sbjct: 65  PSPTFTLVQPYDGPRGAVWHCDLYRLGDPEELQELGIDQGFAEAVMLVEWPDRLGPWLPP 124

Query: 125 KYIDIHL---SQGKTGRKATISA 144
             +++ +    Q +  R+A ++A
Sbjct: 125 DRLELAIEICEQAEDARRAMLAA 147


>gi|332083165|gb|EGI88396.1| hypothetical protein SB521682_5044 [Shigella boydii 5216-82]
          Length = 153

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEQATLDLGERVAKACDGATVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYTLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGTGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIDYQAQGREAHVSA 139


>gi|238764688|ref|ZP_04625632.1| hypothetical protein ykris0001_14860 [Yersinia kristensenii ATCC
           33638]
 gi|238697084|gb|EEP89857.1| hypothetical protein ykris0001_14860 [Yersinia kristensenii ATCC
           33638]
          Length = 156

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+P+P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H  A  V SPT
Sbjct: 5   VLPLPDEAATVALGGALAHAFEGASVIYLFGDLGAGKTTFSRGFLQALGH--AGHVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  A  PV HFD YRL+  +E+  +G  +  +++ IC++EWP+ G   LP+  +
Sbjct: 63  YTLVEPYALAPRPVYHFDLYRLADPEELEFMGIRDYFDKQAICLVEWPQQGAGFLPQADV 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL+     R+A + A
Sbjct: 123 ELHLAYQAEAREARLVA 139


>gi|157368674|ref|YP_001476663.1| putative ATPase [Serratia proteamaculans 568]
 gi|157320438|gb|ABV39535.1| protein of unknown function UPF0079 [Serratia proteamaculans 568]
          Length = 156

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 80/137 (58%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+P+P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VLPLPDEAATVALGAVLAKACDRASVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y    + V HFD YRL+  +E+  +G  D    + IC++EWP+ G  +LP+  +
Sbjct: 63  YTLVEPYALQPLAVYHFDLYRLADPEELEFMGIRDYFAQDAICLVEWPQQGTGVLPEPDL 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HLS    GR+A I A
Sbjct: 123 ELHLSYQDQGREAKIQA 139


>gi|258543655|ref|YP_003189088.1| ATP/GTP hydrolase [Acetobacter pasteurianus IFO 3283-01]
 gi|256634733|dbj|BAI00709.1| ATP/GTP hydrolase [Acetobacter pasteurianus IFO 3283-01]
 gi|256637789|dbj|BAI03758.1| ATP/GTP hydrolase [Acetobacter pasteurianus IFO 3283-03]
 gi|256640843|dbj|BAI06805.1| ATP/GTP hydrolase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643898|dbj|BAI09853.1| ATP/GTP hydrolase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646953|dbj|BAI12901.1| ATP/GTP hydrolase [Acetobacter pasteurianus IFO 3283-26]
 gi|256650006|dbj|BAI15947.1| ATP/GTP hydrolase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652996|dbj|BAI18930.1| ATP/GTP hydrolase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256656050|dbj|BAI21977.1| ATP/GTP hydrolase [Acetobacter pasteurianus IFO 3283-12]
          Length = 166

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/134 (42%), Positives = 81/134 (60%), Gaps = 7/134 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  TI L   L    R GD + LSG LG+GKS  AR+ +R   H  +LEV SPT+TLVQ
Sbjct: 19  DEDATIKLATKLTEYARAGDAILLSGPLGAGKSLFARAFLRAFCHAPSLEVPSPTYTLVQ 78

Query: 75  LYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIH--- 130
            Y+A S  V+HFD +RL    E+ ELG+DE   E + ++EWP+    LLP+  +++    
Sbjct: 79  SYEAPSCTVSHFDLWRLGGPDELEELGWDEA-REGVVLVEWPQKLEDLLPEDALNLEIHV 137

Query: 131 LSQGKTGRKATISA 144
           L+ G+  R+A +S 
Sbjct: 138 LADGQ--RQARLSG 149


>gi|188493734|ref|ZP_03001004.1| putative P-loop hydrolase [Escherichia coli 53638]
 gi|188488933|gb|EDU64036.1| putative P-loop hydrolase [Escherichia coli 53638]
          Length = 153

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEQATLDLGERVAKACDGATVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYTLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGTGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIHYQAQGREARVSA 139


>gi|146278987|ref|YP_001169146.1| hypothetical protein Rsph17025_2955 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557228|gb|ABP71841.1| protein of unknown function UPF0079 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 161

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 79/135 (58%), Gaps = 2/135 (1%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T  LG  LA  L+ GD L L G +G+GK+ L+R++IR  +  +  EV SPTFTL
Sbjct: 15  LPSEDATAELGARLARRLQPGDVLLLEGPIGAGKTHLSRALIRSALGREE-EVPSPTFTL 73

Query: 73  VQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y+A+   + H D YRL+   EV+ELG +      +C++EWP+    L P   + + L
Sbjct: 74  VQTYEAADHEIWHADLYRLTHPDEVLELGLEAAFATAVCLVEWPDRLGGLAPPDALRLRL 133

Query: 132 SQGKTGRKATISAER 146
                GR+A IS  R
Sbjct: 134 EAEGEGRRAVISGGR 148


>gi|262045402|ref|ZP_06018425.1| ATPase with strong ADP affinity [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259037231|gb|EEW38479.1| ATPase with strong ADP affinity [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 153

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEQATLALGDRIAQACTGATVIYLYGDLGAGKTTFSRGFLQALGHRG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   ++ IC++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYTLENLMVYHFDLYRLADPEELEFMGIRDYFADDAICLVEWPQQGAGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IHL     GR+A I+A
Sbjct: 123 EIHLDYQAQGREARITA 139


>gi|91213717|ref|YP_543703.1| putative ATPase [Escherichia coli UTI89]
 gi|110644525|ref|YP_672255.1| putative ATPase [Escherichia coli 536]
 gi|117626515|ref|YP_859838.1| putative ATPase [Escherichia coli APEC O1]
 gi|191174527|ref|ZP_03036025.1| putative P-loop hydrolase [Escherichia coli F11]
 gi|218561327|ref|YP_002394240.1| ATPase [Escherichia coli S88]
 gi|237703835|ref|ZP_04534316.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|300988655|ref|ZP_07178795.1| hypothetical protein HMPREF9553_03541 [Escherichia coli MS 200-1]
 gi|312965841|ref|ZP_07780067.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|91075291|gb|ABE10172.1| hypothetical protein UTI89_C4768 [Escherichia coli UTI89]
 gi|110346117|gb|ABG72354.1| putative P-loop hydrolase YjeE [Escherichia coli 536]
 gi|115515639|gb|ABJ03714.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|190905207|gb|EDV64848.1| putative P-loop hydrolase [Escherichia coli F11]
 gi|218368096|emb|CAR05903.1| ATPase with strong ADP affinity [Escherichia coli S88]
 gi|226901747|gb|EEH88006.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|294492945|gb|ADE91701.1| ATPase, YjeE family [Escherichia coli IHE3034]
 gi|300305888|gb|EFJ60408.1| hypothetical protein HMPREF9553_03541 [Escherichia coli MS 200-1]
 gi|307629239|gb|ADN73543.1| putative ATPase [Escherichia coli UM146]
 gi|312289084|gb|EFR16978.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|315288449|gb|EFU47847.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS
           110-3]
 gi|323950763|gb|EGB46641.1| hypothetical protein ERKG_03092 [Escherichia coli H252]
 gi|323955455|gb|EGB51219.1| hypothetical protein ERLG_03183 [Escherichia coli H263]
 gi|324013810|gb|EGB83029.1| conserved hypothetical protein TIGR00150 [Escherichia coli MS 60-1]
          Length = 153

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEQATLDLGERVAKACDGATVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYMLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGTGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IH+     GR+A +SA
Sbjct: 123 EIHIDYQAQGREARVSA 139


>gi|152973038|ref|YP_001338184.1| putative ATPase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|238892652|ref|YP_002917386.1| putative ATPase [Klebsiella pneumoniae NTUH-K2044]
 gi|330003320|ref|ZP_08304583.1| hydrolase, P-loop family [Klebsiella sp. MS 92-3]
 gi|150957887|gb|ABR79917.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|238544968|dbj|BAH61319.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|328537013|gb|EGF63302.1| hydrolase, P-loop family [Klebsiella sp. MS 92-3]
          Length = 153

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEQATLALGDRIAQACTGATVIYLYGDLGAGKTTFSRGFLQALGHRG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   ++ IC++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYTLENLMVYHFDLYRLADPEELEFMGIRDYFADDAICLVEWPQQGAGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IHL     GR+A I+A
Sbjct: 123 EIHLDYQAQGREARITA 139


>gi|206579086|ref|YP_002240877.1| conserved hypothetical protein TIGR00150 [Klebsiella pneumoniae
           342]
 gi|288937533|ref|YP_003441592.1| hypothetical protein Kvar_4688 [Klebsiella variicola At-22]
 gi|206568144|gb|ACI09920.1| conserved hypothetical protein TIGR00150 [Klebsiella pneumoniae
           342]
 gi|288892242|gb|ADC60560.1| protein of unknown function UPF0079 [Klebsiella variicola At-22]
          Length = 153

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEQATLALGDRIAQACTGATVIYLYGDLGAGKTTFSRGFLQALGHRG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   ++ IC++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYTLENLMVYHFDLYRLADPEELEFMGIRDYFADDAICLVEWPQQGAGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IHL     GR+A I+A
Sbjct: 123 EIHLDYQAQGREARITA 139


>gi|254428498|ref|ZP_05042205.1| conserved hypothetical protein TIGR00150 [Alcanivorax sp. DG881]
 gi|196194667|gb|EDX89626.1| conserved hypothetical protein TIGR00150 [Alcanivorax sp. DG881]
          Length = 142

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 81/132 (61%), Gaps = 4/132 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+ LG  L   L  G C+ L GDLG+GK+ L R ++R L H+ A  V SPT+T+
Sbjct: 8   LPDEAATLSLGAELGHRLAAGGCVYLEGDLGAGKTTLVRGMLRGLGHEGA--VKSPTYTI 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+ A + + HFD YRL+  +E+  +G  +  +   +C++EWPE G  ++P   + I 
Sbjct: 66  VEPYEIAGVHIYHFDLYRLADPEELELIGVRDYFDASSLCLLEWPERGAGVVPTPDLTIT 125

Query: 131 LSQGKTGRKATI 142
           L+    GRKAT+
Sbjct: 126 LAVNGHGRKATL 137


>gi|261345219|ref|ZP_05972863.1| P-loop hydrolase/phosphotransferase [Providencia rustigianii DSM
           4541]
 gi|282566914|gb|EFB72449.1| P-loop hydrolase/phosphotransferase [Providencia rustigianii DSM
           4541]
          Length = 154

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 81/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
            I + NE+ T+ LGR +AS    G  + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   TIQLANEEQTVALGRAIASACHQGVVINLYGDLGAGKTTFSRGFLQALGHKG--HVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y+ A   V HFD YRL+  +E+  +G  D      IC++EWP+ G+  LP+  +
Sbjct: 63  YTLVEPYELADRQVFHFDLYRLADPEELEFMGIRDYFSGNSICLVEWPQQGKGFLPEADL 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL+    GR+A + A
Sbjct: 123 ELHLTYKDEGRQARLVA 139


>gi|323703403|ref|ZP_08115052.1| protein of unknown function UPF0079 [Desulfotomaculum nigrificans
           DSM 574]
 gi|323531672|gb|EGB21562.1| protein of unknown function UPF0079 [Desulfotomaculum nigrificans
           DSM 574]
          Length = 162

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/126 (39%), Positives = 78/126 (61%), Gaps = 3/126 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI   +   T  LG  LA +L+ GD + L+GDLG+GK+  ++ + R L   D   V SPT
Sbjct: 6   VIKTFSAAETRALGEKLAPLLKPGDVICLNGDLGAGKTAFSQGVARGLGVTDP--VTSPT 63

Query: 70  FTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYID 128
           FTL+  Y   +P+ HFD YRL   +E+ +LG++E    R +C+IEW ++   +LP+  +D
Sbjct: 64  FTLINEYQGRLPLYHFDVYRLGGPEEMEDLGYEEYFYGRGVCLIEWAQLVEDVLPEDRLD 123

Query: 129 IHLSQG 134
           I+L++G
Sbjct: 124 INLTRG 129


>gi|319403515|emb|CBI77094.1| Chlorosome protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 506

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 83/147 (56%), Gaps = 8/147 (5%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           MNFS        + NE+ TI   + LA  L+ GD +T  GDLG+GKS L R++IR L ++
Sbjct: 1   MNFS------FFLENEEATILFAQDLALALKSGDLVTFQGDLGAGKSTLIRALIRTLANN 54

Query: 61  DALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGR 119
             +++ SPTFTLVQ Y      V H D YR+SS +E+ ELG  E   + I +IEWPE G 
Sbjct: 55  CTMDIPSPTFTLVQSYQLPQFEVLHADLYRISSIEEMDELGLHESRKDNILLIEWPEKGA 114

Query: 120 SLLPKKYIDIHLSQGKTGRKATI-SAE 145
            +L      I L     GR  T+ SAE
Sbjct: 115 EVLGPVTFAITLQYKGCGRHITLDSAE 141


>gi|167629799|ref|YP_001680298.1| hypothetical protein HM1_1717 [Heliobacterium modesticaldum Ice1]
 gi|167592539|gb|ABZ84287.1| conserved hypothetical protein [Heliobacterium modesticaldum Ice1]
          Length = 184

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 73/121 (60%), Gaps = 3/121 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T  LGR LA  +R GD L L GDLG+GK+ L R + R L +  A  V SPTFTL
Sbjct: 10  LPDESATEELGRWLAERVRPGDILLLYGDLGAGKTTLVRGLARRLGY--AGRVTSPTFTL 67

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           V  Y+  +P+ HFD YRL    +V E+G+ D +  E +  IEWPE    L+P + + I L
Sbjct: 68  VHEYEGDLPIYHFDLYRLDEPDQVWEIGWADYLRGEGVLCIEWPERLGGLMPDEALTIRL 127

Query: 132 S 132
           S
Sbjct: 128 S 128


>gi|183600309|ref|ZP_02961802.1| hypothetical protein PROSTU_03871 [Providencia stuartii ATCC 25827]
 gi|188020099|gb|EDU58139.1| hypothetical protein PROSTU_03871 [Providencia stuartii ATCC 25827]
          Length = 154

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 82/133 (61%), Gaps = 4/133 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++ + NE+ T+ LGR +A+  + G  + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   ILQLANEEQTVALGRAVANACQRGVVINLYGDLGAGKTTFSRGFLQALGHQG--HVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYI 127
           +TLV+ YD     V HFD YRL+  +E+  +G  +  + E IC++EWP+ G+  LP+  +
Sbjct: 63  YTLVEPYDLPDGQVFHFDLYRLADPEELEFMGIRDYFSPESICLVEWPQQGKGFLPEADL 122

Query: 128 DIHLSQGKTGRKA 140
           ++HL+    GR+A
Sbjct: 123 ELHLTYQDEGRQA 135


>gi|238750067|ref|ZP_04611570.1| hypothetical protein yrohd0001_6470 [Yersinia rohdei ATCC 43380]
 gi|238711611|gb|EEQ03826.1| hypothetical protein yrohd0001_6470 [Yersinia rohdei ATCC 43380]
          Length = 156

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 81/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+P+P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VLPLPDEAATVALGAALAHAFNGASVIYLFGDLGAGKTTFSRGFLQALGH--CGHVKSPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  +  PV HFD YRL+  +E+  +G  +  + + IC++EWP+ G   LP+  +
Sbjct: 63  YTLVEPYALTPRPVYHFDLYRLADPEELEFMGIRDYFDTQAICLVEWPQQGAGFLPQADV 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HLS    GR+A + A
Sbjct: 123 ELHLSYQDEGREARLLA 139


>gi|329895362|ref|ZP_08270987.1| ATPase [gamma proteobacterium IMCC3088]
 gi|328922375|gb|EGG29719.1| ATPase [gamma proteobacterium IMCC3088]
          Length = 152

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 80/132 (60%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E+  +  G+ LA+ L+ G  + L G+LG+GK+ L+R+II+FL H  A  V SPT+TLV+
Sbjct: 10  SEEALLDFGQALAACLKPGLMIELRGELGAGKTTLSRAIIQFLGHKGA--VKSPTYTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+    PV HFD YR++   E+  LG +   NE  IC++EWPE    LLPK  I I L 
Sbjct: 68  PYEHIQPPVYHFDLYRIADPDELHYLGVETYFNEHSICLVEWPERAADLLPKADIVITLE 127

Query: 133 QGKTGRKATISA 144
               GR   ++A
Sbjct: 128 HAMLGRTIAVTA 139


>gi|163742586|ref|ZP_02149972.1| hypothetical protein RG210_06854 [Phaeobacter gallaeciensis 2.10]
 gi|161384171|gb|EDQ08554.1| hypothetical protein RG210_06854 [Phaeobacter gallaeciensis 2.10]
          Length = 159

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/141 (42%), Positives = 78/141 (55%), Gaps = 6/141 (4%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+ + T  L   L + L  GDCL LSG +G+GK+  ARS+I+  M     +V SPT
Sbjct: 8   VIPLPSPEATANLATRLGAELSNGDCLLLSGIIGAGKTHFARSLIQSQMTVPE-DVPSPT 66

Query: 70  FTLVQLYDASIP---VAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKY 126
           FTLVQ YD  +P   + H D YRLSS  E+ ELG        IC+IEWP+    L P   
Sbjct: 67  FTLVQTYD--LPNGELWHADLYRLSSLDEIEELGLISAFESAICLIEWPDQLAELTPAAA 124

Query: 127 IDIHLSQGKTGRKATISAERW 147
           + I L+       A I+  RW
Sbjct: 125 LHISLALDPNEDDARIATLRW 145


>gi|146294371|ref|YP_001184795.1| hypothetical protein Sputcn32_3284 [Shewanella putrefaciens CN-32]
 gi|145566061|gb|ABP76996.1| protein of unknown function UPF0079 [Shewanella putrefaciens CN-32]
          Length = 152

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 84/132 (63%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE +TI +G+ LA  ++    L L+GDLG+GK+ L+R +I+ L H  A  V SPT+TLV+
Sbjct: 10  NEDDTIAVGQQLARYIKAPLTLYLTGDLGAGKTTLSRGLIQGLGHQGA--VKSPTYTLVE 67

Query: 75  LYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+ + + + HFD YRL+  +E+  +G  +  +++ +CI+EWP+ G  LLP   I +HLS
Sbjct: 68  PYELNGVEIYHFDLYRLNDPEELEFMGIRDYFSDKSLCIVEWPDKGEGLLPDADIHLHLS 127

Query: 133 QGKTGRKATISA 144
              + R+  I A
Sbjct: 128 YVNSSREIHIQA 139


>gi|146310016|ref|YP_001175090.1| putative ATPase [Enterobacter sp. 638]
 gi|145316892|gb|ABP59039.1| protein of unknown function UPF0079 [Enterobacter sp. 638]
          Length = 153

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ +P+E+ T+ LG+ LA        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VMALPDEQATLDLGKRLALACDGATVIYLYGDLGAGKTTFSRGFLQALGHKG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYTLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGAGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IHL     GR+A ISA
Sbjct: 123 EIHLDYQAQGREARISA 139


>gi|254470746|ref|ZP_05084149.1| chlorosome protein [Pseudovibrio sp. JE062]
 gi|211959888|gb|EEA95085.1| chlorosome protein [Pseudovibrio sp. JE062]
          Length = 503

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 89/140 (63%), Gaps = 5/140 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +++ T      LA +L+ GD L LSGDLG+GKS L+R+++R L  D  LEV SPTFTL
Sbjct: 5   LEDQRATELFAADLAELLKEGDVLALSGDLGTGKSTLSRALLRHLAADPHLEVPSPTFTL 64

Query: 73  VQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ YD + +PVAHFD YR+   +E+ ELG DE L   + +IEWPE+G      + +D+ L
Sbjct: 65  VQTYDLTRMPVAHFDLYRIEEPEELEELGLDEYLETGVALIEWPEMGDPSYWPEALDLKL 124

Query: 132 SQGKT--GRKATISA--ERW 147
            +G     R+ T++A  E W
Sbjct: 125 IEGAEPDTREITLTANSESW 144


>gi|283786847|ref|YP_003366712.1| hydrolase [Citrobacter rodentium ICC168]
 gi|282950301|emb|CBG89948.1| putative hydrolase [Citrobacter rodentium ICC168]
          Length = 157

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 83/137 (60%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E+ T+ LG  +A+       + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 9   VIPLPDEQATLDLGLRVANACDGATVIYLYGDLGAGKTTFSRGFLQALGH--CGNVKSPT 66

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   ++ V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G+ +LP   I
Sbjct: 67  YTLVEPYTLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGKGVLPDPDI 126

Query: 128 DIHLSQGKTGRKATISA 144
           +I +     GR+A ISA
Sbjct: 127 EIRIDYKAQGREAQISA 143


>gi|146337253|ref|YP_001202301.1| bifunctional ATPase/phosphotransferase [Bradyrhizobium sp. ORS278]
 gi|146190059|emb|CAL74051.1| Conserved Hypothetical protein; Putative Bifunctional
           ATPase/phosphotransferase, cell wall biosynthesis
           [Bradyrhizobium sp. ORS278]
          Length = 509

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 69/117 (58%), Gaps = 5/117 (4%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLS 91
           G  +TL+GDLG+GK+  AR++IR+L  D  LEV SPTFTL Q YD  S P+ H D YR+S
Sbjct: 31  GVLITLTGDLGAGKTAAARAMIRYLADDAELEVPSPTFTLAQSYDLPSFPLVHADLYRIS 90

Query: 92  SHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL----SQGKTGRKATISA 144
              E+ E+G   +    + +IEWPE     LP+  IDI L    +QG   R   I+ 
Sbjct: 91  DASELEEIGLSPLPEATVVLIEWPERAGDALPQDRIDIALRHDAAQGDCARNLEITG 147


>gi|126724549|ref|ZP_01740392.1| hypothetical protein RB2150_11976 [Rhodobacterales bacterium
           HTCC2150]
 gi|126705713|gb|EBA04803.1| hypothetical protein RB2150_11976 [Rhodobacterales bacterium
           HTCC2150]
          Length = 153

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 74/132 (56%), Gaps = 3/132 (2%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSII--RFLMHDDALEVLSPTFTLVQL 75
            TI L   LA  L  G  L LSG +G+GKS +AR+II  R  + +   +V SPTFTLVQ+
Sbjct: 15  QTIALAHALADRLAPGMPLLLSGPVGAGKSLIARTIIQHRLALENKFEDVPSPTFTLVQV 74

Query: 76  YD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
           YD A   + H D YRL    EV ELG DE +   +C+IEWP+    L PK  +++ L   
Sbjct: 75  YDLADTEIWHCDLYRLGDPNEVFELGLDEAMENAVCLIEWPDRLGDLKPKTTLELTLQYD 134

Query: 135 KTGRKATISAER 146
             GR A +   +
Sbjct: 135 GEGRAAMLETPK 146


>gi|319406429|emb|CBI80069.1| Chlorosome protein [Bartonella sp. 1-1C]
          Length = 506

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 82/147 (55%), Gaps = 8/147 (5%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           MNFS        + NE+ T    + LA  L+ GD +T  GDLG+GKS L R++IR L ++
Sbjct: 1   MNFS------FFLENEEATTLFAQDLALALKSGDLVTFQGDLGAGKSTLIRALIRTLANN 54

Query: 61  DALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGR 119
             L++ SPTFTLVQ Y      V H D YR+SS +E+ ELG  E   + I +IEWPE G 
Sbjct: 55  CTLDIPSPTFTLVQSYQLPQFEVLHADLYRISSIEEMDELGLHESRKDNILLIEWPEKGA 114

Query: 120 SLLPKKYIDIHLSQGKTGRKATI-SAE 145
            +L      I L     GR  T+ SAE
Sbjct: 115 EVLGPVTFAITLQYKGCGRHITLDSAE 141


>gi|290473397|ref|YP_003466263.1| nucleoside triP hydrolase domain-containing protein [Xenorhabdus
           bovienii SS-2004]
 gi|289172696|emb|CBJ79467.1| putative enzyme with nucleoside triP hydrolase domain [Xenorhabdus
           bovienii SS-2004]
          Length = 154

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 78/137 (56%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ +PNE  T+ LG  +A+    G  + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VLLLPNENATVALGNAVAATGDRGYVIYLYGDLGAGKTTFSRGFLQALGHQG--HVKSPT 62

Query: 70  FTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y     PV HFD YRLS  +E+  +G  D    + IC++EWP+ G   LP   I
Sbjct: 63  YTLVEPYALLPRPVYHFDLYRLSDPEELEFMGIRDYFHQDAICLVEWPQQGAGFLPDADI 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HLS    GR+A   A
Sbjct: 123 ELHLSYDSEGRRARFVA 139


>gi|89056553|ref|YP_512004.1| hypothetical protein Jann_4062 [Jannaschia sp. CCS1]
 gi|88866102|gb|ABD56979.1| protein of unknown function UPF0079 [Jannaschia sp. CCS1]
          Length = 176

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/123 (45%), Positives = 74/123 (60%), Gaps = 1/123 (0%)

Query: 12  PIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFT 71
           P+P  + T  L   LA +LR GD L LSG LG+GK+ LAR++IR  + + A  V SPTFT
Sbjct: 26  PLPTPEATDALAAALARVLRPGDTLLLSGALGAGKTHLARALIRAHLGNPAEPVPSPTFT 85

Query: 72  LVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIH 130
           LVQ YD     + H D YRL    EV ELG DE + + IC+IEWP+      P   + +H
Sbjct: 86  LVQTYDGDDTALWHADLYRLGDIGEVDELGLDEAMEQAICLIEWPDRLAPDWPGAAVLLH 145

Query: 131 LSQ 133
           L++
Sbjct: 146 LTR 148


>gi|317493565|ref|ZP_07951986.1| YjeE protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918508|gb|EFV39846.1| YjeE protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 156

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 80/137 (58%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ +P+E  TI LG  LA+       + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VLSLPDETATIALGTSLAAACDSATVIYLYGDLGAGKTTFSRGFLQALGHKG--NVKSPT 62

Query: 70  FTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  + + V HFD YRL+  +E+  +G  +  +E  IC++EWP+ G   LPK  +
Sbjct: 63  YTLVEPYALTPMNVYHFDLYRLADPEELEFMGIRDYFDENAICLVEWPQQGEGFLPKPDL 122

Query: 128 DIHLSQGKTGRKATISA 144
            +H+S    GR+A I A
Sbjct: 123 SLHISYQGEGREAAIDA 139


>gi|163738018|ref|ZP_02145434.1| hypothetical protein RGBS107_06389 [Phaeobacter gallaeciensis
           BS107]
 gi|161388634|gb|EDQ12987.1| hypothetical protein RGBS107_06389 [Phaeobacter gallaeciensis
           BS107]
          Length = 159

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 60/141 (42%), Positives = 78/141 (55%), Gaps = 6/141 (4%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+ + T  L   L + L  GDCL LSG +G+GK+  ARS+I+  M     +V SPT
Sbjct: 8   VIPLPSPEATTNLATRLGAELSNGDCLLLSGIIGAGKTHFARSLIQSEMTVPE-DVPSPT 66

Query: 70  FTLVQLYDASIP---VAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKY 126
           FTLVQ YD  +P   + H D YRLSS  E+ ELG        IC+IEWP+    L P   
Sbjct: 67  FTLVQTYD--LPNGELWHADLYRLSSLDEIEELGLISAFESAICLIEWPDRLAELTPAAA 124

Query: 127 IDIHLSQGKTGRKATISAERW 147
           + I L+       A I+  RW
Sbjct: 125 LHISLALDPNEDDARIATLRW 145


>gi|238784778|ref|ZP_04628780.1| hypothetical protein yberc0001_7630 [Yersinia bercovieri ATCC
           43970]
 gi|238797612|ref|ZP_04641109.1| hypothetical protein ymoll0001_5820 [Yersinia mollaretii ATCC
           43969]
 gi|238714291|gb|EEQ06301.1| hypothetical protein yberc0001_7630 [Yersinia bercovieri ATCC
           43970]
 gi|238718609|gb|EEQ10428.1| hypothetical protein ymoll0001_5820 [Yersinia mollaretii ATCC
           43969]
          Length = 156

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+P+P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VLPLPDEAATVALGATLAHAFNGASVIYLFGDLGAGKTTFSRGFLQALGHLG--HVKSPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  +  PV HFD YRL+  +E+  +G  +  +++ IC++EWP+ G   LP+  +
Sbjct: 63  YTLVEPYALTPRPVYHFDLYRLADPEELEFMGIRDYFDKQAICLVEWPQQGAGFLPQADV 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL+    GR+A + A
Sbjct: 123 ELHLAYQDEGREARLIA 139


>gi|157827881|ref|YP_001494123.1| hypothetical protein A1G_00095 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932570|ref|YP_001649359.1| ATP/GTP hydrolase [Rickettsia rickettsii str. Iowa]
 gi|157800362|gb|ABV75615.1| hypothetical protein A1G_00095 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165907657|gb|ABY71953.1| ATP/GTP hydrolase [Rickettsia rickettsii str. Iowa]
          Length = 175

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 75/117 (64%), Gaps = 2/117 (1%)

Query: 16  EKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQL 75
           E+ T  L + LA  L+  D + L+GDLG+GK+F  R II++   ++   ++SPTF L+Q 
Sbjct: 7   EEKTKKLAKLLAQSLKPNDIVLLNGDLGAGKTFFCREIIKYFCGENT-SIISPTFNLLQT 65

Query: 76  YDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           Y AS   + H+D YRL S +E+ ELGF+E LN  + +IEW EI + LL    I+++L
Sbjct: 66  YKASNFTIYHYDLYRLKSPEEIYELGFEEALNGNLILIEWSEIIKHLLTPPLIEVNL 122


>gi|329847318|ref|ZP_08262346.1| hypothetical P-loop hydrolase UPF0079 family protein [Asticcacaulis
           biprosthecum C19]
 gi|328842381|gb|EGF91950.1| hypothetical P-loop hydrolase UPF0079 family protein [Asticcacaulis
           biprosthecum C19]
          Length = 149

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 66/105 (62%), Gaps = 2/105 (1%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T  LG  +A  L+ GD + L+G LG GKS LAR +IR L   D  +V SPTFTL
Sbjct: 7   LPDETATAVLGARIAPRLKAGDVVYLTGALGMGKSSLARGLIRALTSPDQ-DVPSPTFTL 65

Query: 73  VQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           VQ YDA+   + H D YRL S +E  ELG D+ L   + +IEWP+
Sbjct: 66  VQAYDAADFTLLHLDLYRLESPEEAYELGLDDALPSSVLVIEWPD 110


>gi|34581027|ref|ZP_00142507.1| hypothetical protein [Rickettsia sibirica 246]
 gi|229586243|ref|YP_002844744.1| Putative P-loop hydrolase [Rickettsia africae ESF-5]
 gi|28262412|gb|EAA25916.1| unknown [Rickettsia sibirica 246]
 gi|228021293|gb|ACP53001.1| Putative P-loop hydrolase [Rickettsia africae ESF-5]
          Length = 175

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 75/117 (64%), Gaps = 2/117 (1%)

Query: 16  EKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQL 75
           E+ T  L + LA  L+  D + L+GDLG+GK+F  R II++   ++   ++SPTF L+Q 
Sbjct: 7   EEETKKLAKLLAQSLKPNDIVLLNGDLGAGKTFFCREIIKYFCGENT-SIISPTFNLLQT 65

Query: 76  YDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           Y AS   + H+D YRL S +E+ ELGF+E LN  + +IEW EI + LL    I+++L
Sbjct: 66  YKASNFTIYHYDLYRLKSPEEIYELGFEEALNGNLILIEWSEIIKHLLTPPLIEVNL 122


>gi|15891936|ref|NP_359650.1| hypothetical protein RC0013 [Rickettsia conorii str. Malish 7]
 gi|20455408|sp|Q92JQ4|Y013_RICCN RecName: Full=UPF0079 ATP-binding protein RC0013
 gi|15619046|gb|AAL02551.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 175

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 75/117 (64%), Gaps = 2/117 (1%)

Query: 16  EKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQL 75
           E+ T  L + LA  L+  D + L+GDLG+GK+F  R II++   ++   ++SPTF L+Q 
Sbjct: 7   EEETKKLAKLLAQSLKPNDIVLLNGDLGAGKTFFCREIIKYFCGENT-SIISPTFNLLQT 65

Query: 76  YDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           Y AS   + H+D YRL S +E+ ELGF+E LN  + +IEW EI + LL    I+++L
Sbjct: 66  YKASNFTIYHYDLYRLKSPEEIYELGFEEALNGNLILIEWSEIIKHLLTPPLIEVNL 122


>gi|271502157|ref|YP_003335183.1| hypothetical protein Dd586_3647 [Dickeya dadantii Ech586]
 gi|270345712|gb|ACZ78477.1| protein of unknown function UPF0079 [Dickeya dadantii Ech586]
          Length = 160

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++P+P+E  TI LG  LA        + L GDLG+GK+ L+R  ++ L H     V SPT
Sbjct: 5   LLPLPDEAATIALGAALAKACERATIIYLLGDLGAGKTTLSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y     PV HFD YRL+  +E+  +G  + L++  +C+IEWP+ G  +LP+  I
Sbjct: 63  YTLVEPYTLLPRPVYHFDLYRLADPEELEFMGIRDYLSQDALCLIEWPQQGAGILPQADI 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++ L     GR+A I+A
Sbjct: 123 ELLLGYQGEGRQAEINA 139


>gi|238650330|ref|YP_002916182.1| ATPase YjeE, truncated by transposon [Rickettsia peacockii str.
           Rustic]
 gi|238624428|gb|ACR47134.1| ATPase YjeE, truncated by transposon [Rickettsia peacockii str.
           Rustic]
          Length = 151

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 74/117 (63%), Gaps = 2/117 (1%)

Query: 16  EKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQL 75
           E+ T  L + LA  L+  D + L+GDLG+GK+F  R II++   ++   ++SPTF L+Q 
Sbjct: 7   EEKTKKLAKLLAQSLKPNDIVLLNGDLGAGKTFFCREIIKYFCGENT-SIISPTFNLLQT 65

Query: 76  YDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           Y AS   + H+D YRL S +E+ ELGF+E LN    +IEW EI + LL    I+++L
Sbjct: 66  YKASNFTIYHYDLYRLKSPEEIYELGFEEALNGNFILIEWSEIIKHLLTPPLIEVNL 122


>gi|218660308|ref|ZP_03516238.1| hypothetical protein RetlI_12164 [Rhizobium etli IE4771]
          Length = 240

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (66%), Gaps = 1/87 (1%)

Query: 57  LMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           +  DD LEV SPTFTLVQ YD  IPV+HFD YRL    E+ ELGFDE L   IC++EWPE
Sbjct: 1   MADDDGLEVPSPTFTLVQSYDLRIPVSHFDLYRLGDASELTELGFDEALQNGICLVEWPE 60

Query: 117 IGRSLLPKKYIDIHLSQGKTGRKATIS 143
           +  S LP + I + L   + GR+ATI 
Sbjct: 61  MADSELPAERIALTLVH-EGGRRATIE 86


>gi|110835068|ref|YP_693927.1| hypothetical protein ABO_2207 [Alcanivorax borkumensis SK2]
 gi|110648179|emb|CAL17655.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 142

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 79/132 (59%), Gaps = 4/132 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG  L   L  G C+ L GDLG+GK+ L R I+R L H+ A  V SPT+T+
Sbjct: 8   LADEAATLALGAELGHRLAAGGCVYLEGDLGAGKTTLVRGILRGLGHNGA--VKSPTYTI 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+   + + HFD YRLS  +E+  +G  E  +   +C++EWPE G  ++P   + I 
Sbjct: 66  VEPYEIRGVHIYHFDLYRLSDPEELELIGVREYFDAGSLCLLEWPERGAGVVPAPDLTIT 125

Query: 131 LSQGKTGRKATI 142
           L+    GRKAT+
Sbjct: 126 LAVNGHGRKATL 137


>gi|121535445|ref|ZP_01667255.1| protein of unknown function UPF0079 [Thermosinus carboxydivorans
           Nor1]
 gi|121305954|gb|EAX46886.1| protein of unknown function UPF0079 [Thermosinus carboxydivorans
           Nor1]
          Length = 166

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 84/145 (57%), Gaps = 11/145 (7%)

Query: 14  PNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV 73
           P+E  T  LG  LA +L  GD + LSGDLG+GK+   + +   L   D  +V SPTFT++
Sbjct: 9   PDE--TEALGGKLAELLAPGDIVCLSGDLGAGKTLFVQGVAAGL-GADVNDVTSPTFTIM 65

Query: 74  QLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
            +Y A IPV HFD YRL +   +V++GF+E L  + + +IEW +   + LP +Y+DI  +
Sbjct: 66  NVYAARIPVYHFDLYRLENAAALVDIGFEEYLGGDGVALIEWADKFPAALPAQYLDIRFT 125

Query: 133 QGKTGRKATISAERWIISHINQMNR 157
            G+         ER II+ I Q  R
Sbjct: 126 AGEG------PTER-IITMIPQGPR 143


>gi|220921598|ref|YP_002496899.1| hypothetical protein Mnod_1606 [Methylobacterium nodulans ORS 2060]
 gi|219946204|gb|ACL56596.1| protein of unknown function UPF0079 [Methylobacterium nodulans ORS
           2060]
          Length = 529

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 55/108 (50%), Positives = 71/108 (65%), Gaps = 2/108 (1%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I +P+E  T  LGR LA +LR GD + LSG LG GK+ LAR++IR L  D  LEV SPTF
Sbjct: 29  IMLPDESATEDLGRFLAELLRPGDLVALSGGLGGGKTTLARALIRELTGDPELEVPSPTF 88

Query: 71  TLVQLYDA--SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           TL+Q Y+    + + H D YRL    E+VELGFDE+    I ++EWP+
Sbjct: 89  TLIQPYEGRDGLALVHADLYRLRGPDELVELGFDELTERAITLVEWPD 136


>gi|304392408|ref|ZP_07374349.1| P-loop hydrolase/phosphotransferase [Ahrensia sp. R2A130]
 gi|303295512|gb|EFL89871.1| P-loop hydrolase/phosphotransferase [Ahrensia sp. R2A130]
          Length = 502

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 60/138 (43%), Positives = 80/138 (57%), Gaps = 7/138 (5%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  TI  G  LA  LR GD + L GDLG+GK+ LAR+ IR    DD LEV SPTFTL
Sbjct: 8   LSDEAATIRFGETLAMALRAGDMVWLRGDLGAGKTALARATIRAASGDDHLEVPSPTFTL 67

Query: 73  VQLYDASIP---VAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLL--PKKYI 127
           VQ Y + +P   +AH D YR++   EV ELG ++ L     ++EWP+    L+  P   I
Sbjct: 68  VQTY-SDLPFGTLAHADLYRIADPSEVEELGLEDTLAYGAVLVEWPDRAEGLIGQPSLKI 126

Query: 128 DIHLSQGKTGRKATISAE 145
           DI + +    R  TIS +
Sbjct: 127 DIAV-ETDDARTLTISGD 143


>gi|296446568|ref|ZP_06888510.1| protein of unknown function UPF0079 [Methylosinus trichosporium
           OB3b]
 gi|296255922|gb|EFH03007.1| protein of unknown function UPF0079 [Methylosinus trichosporium
           OB3b]
          Length = 509

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 52/125 (41%), Positives = 73/125 (58%), Gaps = 2/125 (1%)

Query: 10  VIPIPNEKNTICLGRHLASILRLG-DCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           +I + +E  T  L R LA I+R G   +TLSGDLG+GK+  AR++IR L  D  LE  SP
Sbjct: 8   IIDVADEAQTAALARRLAPIIRDGVRLVTLSGDLGAGKTSFARALIRILADDPTLETPSP 67

Query: 69  TFTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYI 127
           TFTL+Q Y+     + H D YR+S   E+  LGF+E   + I ++EWPE   +      +
Sbjct: 68  TFTLMQTYEGEDYRLLHADLYRISGEAELEALGFEEASEDAIVLVEWPERAPTFFSGDRL 127

Query: 128 DIHLS 132
            + LS
Sbjct: 128 AVDLS 132


>gi|315497128|ref|YP_004085932.1| protein family upf0079, atpase [Asticcacaulis excentricus CB 48]
 gi|315415140|gb|ADU11781.1| Uncharacterized protein family UPF0079, ATPase [Asticcacaulis
           excentricus CB 48]
          Length = 145

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 84/144 (58%), Gaps = 6/144 (4%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           M FSE     +   ++  T   G  LA+ L+ GD + L GDLG+GKS LAR +IR L   
Sbjct: 1   MTFSESDDCFLA--DDGATAEWGAWLATQLKAGDVVYLLGDLGAGKSTLARGLIRALTTP 58

Query: 61  DALEVLSPTFTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE-IG 118
           D  +V SPTFT+VQ Y+     +AHFD YRL+  +EV E+G  E+ +  +C+IEWP+ +G
Sbjct: 59  DE-DVPSPTFTIVQTYEGRDFDIAHFDLYRLTDPEEVHEIGLFELADTHLCLIEWPQRLG 117

Query: 119 RSLLPKKYIDIHLSQGKTGRKATI 142
                  +I + L +   GR+ T+
Sbjct: 118 HFAFDAPWI-VRLKEEAAGRRVTL 140


>gi|242237983|ref|YP_002986164.1| hypothetical protein Dd703_0531 [Dickeya dadantii Ech703]
 gi|242130040|gb|ACS84342.1| protein of unknown function UPF0079 [Dickeya dadantii Ech703]
          Length = 157

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 81/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++P+P+E  T  LG  LA        + L GDLG+GK+ L+R  ++ L H     V SPT
Sbjct: 5   LLPLPDEAATTALGALLARACDRASIIYLFGDLGAGKTTLSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  S  PV HFD YRL+  +E+  +G  + L++  IC+IEWP+ G  +LP   +
Sbjct: 63  YTLVEPYALSPRPVYHFDLYRLADPEELEFMGIRDYLSQDAICLIEWPQQGAGVLPTADV 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL+     R+A I A
Sbjct: 123 ELHLNYDGRARQAEIHA 139


>gi|119385521|ref|YP_916577.1| hypothetical protein Pden_2797 [Paracoccus denitrificans PD1222]
 gi|119375288|gb|ABL70881.1| protein of unknown function UPF0079 [Paracoccus denitrificans
           PD1222]
          Length = 472

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 66/105 (62%), Gaps = 2/105 (1%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           T CL R +A++L+ GD + L G +G+GK+  AR+ IR    + A EV SPTFTLVQ Y  
Sbjct: 15  TACLARVMAAVLKPGDVVALQGPVGAGKTHFARAFIRARQGEAAEEVPSPTFTLVQTYAD 74

Query: 79  SI--PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSL 121
            +   + H D YRL+  +E+ ELG DE + E + ++EWPE G  L
Sbjct: 75  PLGTEIWHADLYRLTHPEELAELGLDEAMREAVVLVEWPEHGSPL 119


>gi|209543466|ref|YP_002275695.1| hypothetical protein Gdia_1298 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209531143|gb|ACI51080.1| protein of unknown function UPF0079 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 161

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 81/133 (60%), Gaps = 3/133 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P ++ T  L R +AS    GD + LSG LG+GKS  +R+ +R    D  +EV SP++TL
Sbjct: 20  LPTQEATEDLARRIASAATPGDAILLSGVLGAGKSVFSRAFLRAACADPDMEVPSPSYTL 79

Query: 73  VQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ+YDA   P+AHFD +RLS    V ELG+D+   E I ++EWP+   +L P   + I L
Sbjct: 80  VQVYDAPRGPIAHFDLWRLSGPDAVHELGWDDAC-EGIVLVEWPDRLGALAPADALRIDL 138

Query: 132 SQGKTG-RKATIS 143
              + G R+A ++
Sbjct: 139 EVLEDGARRARLT 151


>gi|261342829|ref|ZP_05970687.1| ATPase with strong ADP affinity [Enterobacter cancerogenus ATCC
           35316]
 gi|288314871|gb|EFC53809.1| ATPase with strong ADP affinity [Enterobacter cancerogenus ATCC
           35316]
          Length = 153

 Score = 96.7 bits (239), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 79/137 (57%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
            I +P+E+ T+  G  +A   +    + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   AISLPDEQATLDFGTRVAQACQGATVIYLYGDLGAGKTTFSRGFLQALGHKG--NVKSPT 62

Query: 70  FTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y    + V HFD YRL+  +E+  +G  D   N+ IC++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYTLDHVTVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGAGVLPDPDV 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IHL     GR+A ISA
Sbjct: 123 EIHLEYQAQGREARISA 139


>gi|162146536|ref|YP_001600995.1| hydrolase protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785111|emb|CAP54655.1| putative hydrolase protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 161

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 54/133 (40%), Positives = 81/133 (60%), Gaps = 3/133 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P ++ T  L R +AS+   GD + LSG LG+GKS  +R+ +R    D  +EV SP++TL
Sbjct: 20  LPTQEATEDLARRIASVATPGDAILLSGVLGAGKSVFSRAFLRAACADPDMEVPSPSYTL 79

Query: 73  VQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ+YD    P+AHFD +RLS    V ELG+D+   E I ++EWP+   +L P   + I L
Sbjct: 80  VQVYDTPRGPIAHFDLWRLSGPDAVHELGWDDAC-EGIVLVEWPDRLGALAPADALRIDL 138

Query: 132 SQGKTG-RKATIS 143
              + G R+A ++
Sbjct: 139 EVLEDGARRACLT 151


>gi|113968938|ref|YP_732731.1| hypothetical protein Shewmr4_0594 [Shewanella sp. MR-4]
 gi|117919046|ref|YP_868238.1| hypothetical protein Shewana3_0593 [Shewanella sp. ANA-3]
 gi|113883622|gb|ABI37674.1| protein of unknown function UPF0079 [Shewanella sp. MR-4]
 gi|117611378|gb|ABK46832.1| protein of unknown function UPF0079 [Shewanella sp. ANA-3]
          Length = 152

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 55/132 (41%), Positives = 80/132 (60%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE  TI +G+ LA  ++    L L+GDLG+GK+ L+R +I+ L H  A  V SPT+TLV+
Sbjct: 10  NEDETIAVGQKLARHIQAPLTLYLTGDLGAGKTTLSRGLIQGLGHKGA--VKSPTYTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+   + V HFD YRL+  +E+  +G  D   +  +CI+EWP+ G  LLP   I +HL+
Sbjct: 68  PYELDGVEVYHFDLYRLNDPEELEFMGIRDYFTDSSLCIVEWPDKGHGLLPDADIHLHLN 127

Query: 133 QGKTGRKATISA 144
               GR+  I A
Sbjct: 128 YVNQGREIQIRA 139


>gi|254516805|ref|ZP_05128863.1| conserved hypothetical protein TIGR00150 [gamma proteobacterium
           NOR5-3]
 gi|219674310|gb|EED30678.1| conserved hypothetical protein TIGR00150 [gamma proteobacterium
           NOR5-3]
          Length = 163

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 74/130 (56%), Gaps = 4/130 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I + NE   +  GR LA+ + LG  L L G+LG+GK+ L R I R L H  A  V SPT+
Sbjct: 10  IEVANETEMVDFGRQLATQMSLGTSLYLHGELGAGKTTLTRGIARGLGHSGA--VKSPTY 67

Query: 71  TLVQLY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYID 128
           TLV+ Y D   P+ HFD YRL   +E+  +G  D    + + ++EWPE G   LP   +D
Sbjct: 68  TLVEPYLDLQKPLYHFDLYRLGDPEELEYMGIRDYFGADALVVVEWPERGGDFLPPPDLD 127

Query: 129 IHLSQGKTGR 138
           I L+   TGR
Sbjct: 128 IRLTVIATGR 137


>gi|67458409|ref|YP_246033.1| hypothetical protein RF_0017 [Rickettsia felis URRWXCal2]
 gi|75537118|sp|Q4UNJ0|Y017_RICFE RecName: Full=UPF0079 ATP-binding protein RF_0017
 gi|67003942|gb|AAY60868.1| Conserved hypothetical protein [Rickettsia felis URRWXCal2]
          Length = 171

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 74/118 (62%), Gaps = 2/118 (1%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+ T  L + LA  L+  D + L+GDLG+GK+F  R II+    ++   ++SPTF L+Q
Sbjct: 6   NEEETKKLAKLLAQSLKPNDIVLLNGDLGAGKTFFCREIIKHFCGENT-NIISPTFNLLQ 64

Query: 75  LYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
            Y  S   + H+D YRL S +E+ ELGF+E LN  + +IEW EI + LL    I+++L
Sbjct: 65  TYKTSNFTIYHYDLYRLKSPEEIYELGFEEALNGNLILIEWSEIIKHLLTPPLIEVNL 122


>gi|22124540|ref|NP_667963.1| putative ATPase [Yersinia pestis KIM 10]
 gi|45440379|ref|NP_991918.1| putative ATPase [Yersinia pestis biovar Microtus str. 91001]
 gi|108809905|ref|YP_653821.1| putative ATPase [Yersinia pestis Antiqua]
 gi|108813462|ref|YP_649229.1| putative ATPase [Yersinia pestis Nepal516]
 gi|145600852|ref|YP_001164928.1| putative ATPase [Yersinia pestis Pestoides F]
 gi|150260587|ref|ZP_01917315.1| hypothetical protein YPE_2899 [Yersinia pestis CA88-4125]
 gi|162421620|ref|YP_001605283.1| putative ATPase [Yersinia pestis Angola]
 gi|165926793|ref|ZP_02222625.1| conserved hypothetical protein TIGR00150 [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165936498|ref|ZP_02225066.1| conserved hypothetical protein TIGR00150 [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011883|ref|ZP_02232781.1| conserved hypothetical protein TIGR00150 [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213979|ref|ZP_02240014.1| conserved hypothetical protein TIGR00150 [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167400647|ref|ZP_02306156.1| conserved hypothetical protein TIGR00150 [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167419286|ref|ZP_02311039.1| conserved hypothetical protein TIGR00150 [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167423366|ref|ZP_02315119.1| conserved hypothetical protein TIGR00150 [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167470466|ref|ZP_02335170.1| hypothetical protein YpesF_21897 [Yersinia pestis FV-1]
 gi|170026018|ref|YP_001722523.1| putative ATPase [Yersinia pseudotuberculosis YPIII]
 gi|218927572|ref|YP_002345447.1| putative ATPase [Yersinia pestis CO92]
 gi|229836629|ref|ZP_04456795.1| ATPase with strong ADP affinity [Yersinia pestis Pestoides A]
 gi|229840241|ref|ZP_04460400.1| ATPase with strong ADP affinity [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229842319|ref|ZP_04462474.1| ATPase with strong ADP affinity [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229903942|ref|ZP_04519055.1| ATPase with strong ADP affinity [Yersinia pestis Nepal516]
 gi|270489070|ref|ZP_06206144.1| ATPase, YjeE family [Yersinia pestis KIM D27]
 gi|294502478|ref|YP_003566540.1| hypothetical protein YPZ3_0368 [Yersinia pestis Z176003]
 gi|21957338|gb|AAM84214.1|AE013665_3 hypothetical protein y0626 [Yersinia pestis KIM 10]
 gi|45435235|gb|AAS60795.1| Predicted ATPase or kinase [Yersinia pestis biovar Microtus str.
           91001]
 gi|108777110|gb|ABG19629.1| hypothetical protein YPN_3302 [Yersinia pestis Nepal516]
 gi|108781818|gb|ABG15876.1| hypothetical protein YPA_3915 [Yersinia pestis Antiqua]
 gi|115346183|emb|CAL19051.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145212548|gb|ABP41955.1| hypothetical protein YPDSF_3605 [Yersinia pestis Pestoides F]
 gi|149289995|gb|EDM40072.1| hypothetical protein YPE_2899 [Yersinia pestis CA88-4125]
 gi|162354435|gb|ABX88383.1| conserved hypothetical protein TIGR00150 [Yersinia pestis Angola]
 gi|165915614|gb|EDR34223.1| conserved hypothetical protein TIGR00150 [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921416|gb|EDR38640.1| conserved hypothetical protein TIGR00150 [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989242|gb|EDR41543.1| conserved hypothetical protein TIGR00150 [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166204774|gb|EDR49254.1| conserved hypothetical protein TIGR00150 [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166963280|gb|EDR59301.1| conserved hypothetical protein TIGR00150 [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167050015|gb|EDR61423.1| conserved hypothetical protein TIGR00150 [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167057536|gb|EDR67282.1| conserved hypothetical protein TIGR00150 [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169752552|gb|ACA70070.1| protein of unknown function UPF0079 [Yersinia pseudotuberculosis
           YPIII]
 gi|229679712|gb|EEO75815.1| ATPase with strong ADP affinity [Yersinia pestis Nepal516]
 gi|229690629|gb|EEO82683.1| ATPase with strong ADP affinity [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229696607|gb|EEO86654.1| ATPase with strong ADP affinity [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229706313|gb|EEO92321.1| ATPase with strong ADP affinity [Yersinia pestis Pestoides A]
 gi|262360508|gb|ACY57229.1| hypothetical protein YPD4_0320 [Yersinia pestis D106004]
 gi|262364455|gb|ACY61012.1| hypothetical protein YPD8_0322 [Yersinia pestis D182038]
 gi|270337574|gb|EFA48351.1| ATPase, YjeE family [Yersinia pestis KIM D27]
 gi|294352937|gb|ADE63278.1| hypothetical protein YPZ3_0368 [Yersinia pestis Z176003]
 gi|320013765|gb|ADV97336.1| ATPase with strong ADP affinity [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 156

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 81/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ +P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H+    V SPT
Sbjct: 5   VLLLPDEAATVALGATLAQAFGGASVIYLFGDLGAGKTTFSRGFLQALGHNG--HVKSPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  +  PV HFD YRL+  +E+  +G  +  + + IC++EWP+ G   LP+  +
Sbjct: 63  YTLVEPYTLTPRPVYHFDLYRLADPEELEFMGIRDYFDPQAICLVEWPQQGAGFLPQADV 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL+    GR+A + A
Sbjct: 123 ELHLTYQAAGREARLVA 139


>gi|119776161|ref|YP_928901.1| hypothetical protein Sama_3029 [Shewanella amazonensis SB2B]
 gi|119768661|gb|ABM01232.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 153

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 93/148 (62%), Gaps = 8/148 (5%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +  ++ TI +G+ LA  +     L L+G+LG+GK+ L+R II+ L H  A  V SPT+TL
Sbjct: 8   LETDEQTIAIGQQLAKHIHPPLTLYLTGELGAGKTTLSRGIIQALGHQGA--VKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+  ++ + HFD YRLS  +E+  +G  +  +++ +CI+EWP+ G  LLP+  + +H
Sbjct: 66  VEPYELENVEIYHFDLYRLSDPEELEFMGIRDYFSDKSLCIVEWPDRGFGLLPEADLHLH 125

Query: 131 LSQGKTGRKATI----SAERWIISHINQ 154
           L    TGR+ +I    +A R +I ++++
Sbjct: 126 LVYAGTGRELSIQAGSAAGRAVIENLSE 153


>gi|114328669|ref|YP_745827.1| ATP/GTP hydrolase [Granulibacter bethesdensis CGDNIH1]
 gi|114316843|gb|ABI62903.1| ATP/GTP hydrolase [Granulibacter bethesdensis CGDNIH1]
          Length = 155

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 72/118 (61%), Gaps = 2/118 (1%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +++ T  LGR +A  L  GD + L G LG+GKS L R+++R +  D A+EV SPT+TLVQ
Sbjct: 15  DQEATEALGRQIADTLHPGDVILLEGSLGAGKSTLVRALLRHMAGDPAMEVPSPTYTLVQ 74

Query: 75  LYDASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
            YD     VAH D +RL     + ELG+D +L + I I+EWP+    L P + + I L
Sbjct: 75  GYDTPRGAVAHLDLWRLDGPDALHELGWDALLKD-IVIVEWPDRLEDLRPPQALTIRL 131


>gi|302392826|ref|YP_003828646.1| hypothetical protein Acear_2091 [Acetohalobium arabaticum DSM 5501]
 gi|302204903|gb|ADL13581.1| protein of unknown function UPF0079 [Acetohalobium arabaticum DSM
           5501]
          Length = 157

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 83/145 (57%), Gaps = 4/145 (2%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           K TI LG  +  +L  GD + L G+LG+GK+ LA+ ++  L  +   EV SPT+TL+  Y
Sbjct: 10  KETIELGAKIGELLNSGDIICLQGNLGAGKTCLAKGLLAGL--EVEAEVTSPTYTLINEY 67

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL-SQG 134
              +P  H D YR+S ++E+ ++GF+E L  E + IIEWP+    L+P  Y++I + SQG
Sbjct: 68  QGRLPAYHIDLYRISDYKELYDIGFEEYLYGEGVTIIEWPDKAGPLMPDSYLNITIKSQG 127

Query: 135 KTGRKATISAERWIISHINQMNRST 159
                  I      IS ++++  + 
Sbjct: 128 DNRLIKIIPQANKYISLVSELKENV 152


>gi|114704751|ref|ZP_01437659.1| hypothetical protein FP2506_07441 [Fulvimarina pelagi HTCC2506]
 gi|114539536|gb|EAU42656.1| hypothetical protein FP2506_07441 [Fulvimarina pelagi HTCC2506]
          Length = 538

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 60/150 (40%), Positives = 85/150 (56%), Gaps = 1/150 (0%)

Query: 6   KHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEV 65
           K + ++ + +   T  LG  L+ +L+ GD + L GDLG+GK+ L R+ IR L  DD  EV
Sbjct: 33  KTIKIVELADVAATERLGEDLSLVLKPGDVIALFGDLGAGKTSLVRAAIRALTEDDFHEV 92

Query: 66  LSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKK 125
            SPTFTLVQ YD  I  +HFD YRL+   EV ELGF+E        +EWP+   S+L + 
Sbjct: 93  PSPTFTLVQSYDGRIRTSHFDLYRLADEAEVAELGFEEAAAAGAVFVEWPQRVVSVLTRA 152

Query: 126 YIDIHL-SQGKTGRKATISAERWIISHINQ 154
            + I   +    GR+A ++A    I  I +
Sbjct: 153 NVAIEFRTSANGGRQAAVAASGDAIERIER 182


>gi|51594773|ref|YP_068964.1| ATPase [Yersinia pseudotuberculosis IP 32953]
 gi|153948244|ref|YP_001402611.1| ATPase [Yersinia pseudotuberculosis IP 31758]
 gi|186893780|ref|YP_001870892.1| putative ATPase [Yersinia pseudotuberculosis PB1/+]
 gi|51588055|emb|CAH19661.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|152959739|gb|ABS47200.1| conserved hypothetical protein TIGR00150 [Yersinia
           pseudotuberculosis IP 31758]
 gi|186696806|gb|ACC87435.1| protein of unknown function UPF0079 [Yersinia pseudotuberculosis
           PB1/+]
          Length = 156

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 81/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ +P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H+    V SPT
Sbjct: 5   VLLLPDEAATVALGATLARAFGGASVIYLFGDLGAGKTTFSRGFLQALGHNG--HVKSPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  +  PV HFD YRL+  +E+  +G  +  + + IC++EWP+ G   LP+  +
Sbjct: 63  YTLVEPYTLTPRPVYHFDLYRLADPEELEFMGIRDYFDPQAICLVEWPQQGAGFLPQADV 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL+    GR+A + A
Sbjct: 123 ELHLTYQAAGREARLVA 139


>gi|24372190|ref|NP_716232.1| hypothetical protein SO_0599 [Shewanella oneidensis MR-1]
 gi|24346099|gb|AAN53677.1|AE015507_3 conserved hypothetical protein TIGR00150 [Shewanella oneidensis
           MR-1]
          Length = 152

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/132 (41%), Positives = 80/132 (60%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE  TI +G+ LA  ++    L L+GDLG+GK+ L+R +I+ L H  A  V SPT+TLV+
Sbjct: 10  NEDETIAVGQTLARHIQAPLTLYLTGDLGAGKTTLSRGLIQGLGHKGA--VKSPTYTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+   + V HFD YRL+  +E+  +G  D   +  +CI+EWP+ G  LLP   I +HL+
Sbjct: 68  PYELDGVEVYHFDLYRLNDPEELEFMGIRDYFTDNSLCIVEWPDKGEGLLPDADIHLHLN 127

Query: 133 QGKTGRKATISA 144
               GR+  I A
Sbjct: 128 YVNQGREIHIRA 139


>gi|310817179|ref|YP_003965143.1| ATP-binding protein [Ketogulonicigenium vulgare Y25]
 gi|308755914|gb|ADO43843.1| ATP-binding protein [Ketogulonicigenium vulgare Y25]
          Length = 150

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 73/118 (61%), Gaps = 4/118 (3%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSS 92
           GD L L+G +G+GKSF +R++IR  + +   +V SPTFTLVQ Y+A +P+ H D YRL+ 
Sbjct: 27  GDILLLNGQIGAGKSFFSRALIRARLGNPTEDVPSPTFTLVQTYEADVPIWHCDLYRLTH 86

Query: 93  HQEVVELGFDEILNERICIIEWPEIGRSLLPKKYID---IHLSQGKTGRKATISAERW 147
             EV+ELG  +  +  IC+IEWP+   S+ P   +    I LS G T +     +++W
Sbjct: 87  PDEVIELGLTDAFDTAICLIEWPDRLGSMTPASALTLDFIALSDG-THQVTLTGSKQW 143


>gi|167625544|ref|YP_001675838.1| hypothetical protein Shal_3638 [Shewanella halifaxensis HAW-EB4]
 gi|167355566|gb|ABZ78179.1| protein of unknown function UPF0079 [Shewanella halifaxensis
           HAW-EB4]
          Length = 160

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++ + +E+ T+ LG  LA ++     + LSGDLG+GK+  +R +I+ L H  A  V SPT
Sbjct: 7   ILNLNDEQETVDLGTKLAGLITPPLTVYLSGDLGAGKTTFSRGLIQSLGHQGA--VKSPT 64

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y+  ++ V HFD YRL   +E+  +G  +    R +CI+EWP+ G  LLP   I
Sbjct: 65  YTLVEPYELDALDVYHFDLYRLYDPEELEFMGIRDYFTSRSLCIVEWPDRGHGLLPPADI 124

Query: 128 DIHLSQGKTGRKATISA 144
            IH+    TGR+  + A
Sbjct: 125 HIHIKYVNTGRQVELQA 141


>gi|30248668|ref|NP_840738.1| hydrolase [Nitrosomonas europaea ATCC 19718]
 gi|30180263|emb|CAD84568.1| Uncharacterised P-loop hydrolase UPF0079 [Nitrosomonas europaea
           ATCC 19718]
          Length = 158

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 79/137 (57%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ + +E  T+ LG  LA++   G  + L GDLG+GK+ LAR I++ L H    +V SPT
Sbjct: 6   VVKLDSEAATLALGEQLATLFHPGLTVFLYGDLGAGKTTLARGILKGLGHHG--KVRSPT 63

Query: 70  FTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYI 127
           + LV++Y  S + + HFDFYR +   E  E GF E  N+  IC++EWPE     L    +
Sbjct: 64  YNLVEIYKLSRLYLYHFDFYRFNDSLEWEEAGFREYFNQDSICLVEWPEKAGEFLHAADL 123

Query: 128 DIHLSQGKTGRKATISA 144
           +I +S   T R A  SA
Sbjct: 124 EIRISYSGTRRIAEFSA 140


>gi|254462960|ref|ZP_05076376.1| uncharacterised P-loop hydrolase UPF0079 [Rhodobacterales bacterium
           HTCC2083]
 gi|206679549|gb|EDZ44036.1| uncharacterised P-loop hydrolase UPF0079 [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 157

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/129 (41%), Positives = 76/129 (58%), Gaps = 7/129 (5%)

Query: 10  VIPIPNE-----KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALE 64
           +I +PN+       T  L   + + LR+GD L L GD+G+GKSF AR++I+ L  D   +
Sbjct: 2   LIELPNQILNTSDETADLAARIGAQLRIGDTLLLQGDIGAGKSFFARALIQSL-QDHPED 60

Query: 65  VLSPTFTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLP 123
           V SPTFTLVQ Y  +I  V H D YRL+   E  ELG  E  ++ IC+IEWP+   +L+P
Sbjct: 61  VPSPTFTLVQTYTTNIGEVWHADLYRLNDPSEAEELGLAEAFSDAICLIEWPDRLANLVP 120

Query: 124 KKYIDIHLS 132
              I +  +
Sbjct: 121 PDAITLFFT 129


>gi|253998994|ref|YP_003051057.1| hypothetical protein Msip34_1284 [Methylovorus sp. SIP3-4]
 gi|313201099|ref|YP_004039757.1| hypothetical protein MPQ_1360 [Methylovorus sp. MP688]
 gi|253985673|gb|ACT50530.1| protein of unknown function UPF0079 [Methylovorus sp. SIP3-4]
 gi|312440415|gb|ADQ84521.1| conserved hypothetical protein [Methylovorus sp. MP688]
          Length = 155

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 78/141 (55%), Gaps = 6/141 (4%)

Query: 7   HLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
           H     + +E  T+  G  LA  +  G  + L GDLG+GK+ L R ++  L H  A +V 
Sbjct: 3   HDITFDLADEAATLHFGAQLAKAVTPGLTVYLHGDLGAGKTTLVRGLLHALGH--AGKVK 60

Query: 67  SPTFTLVQLY--DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLP 123
           SPT+TLV+ Y  DA + V HFD YR    +E    GF +  N   IC++EWPE    L+P
Sbjct: 61  SPTYTLVEPYVLDA-LAVYHFDLYRFVDPEEWDAAGFRDYFNPATICLVEWPEKAGDLIP 119

Query: 124 KKYIDIHLSQGKTGRKATISA 144
           +  +DIHL     GRK T+SA
Sbjct: 120 QPDLDIHLQPNAGGRKITVSA 140


>gi|149377528|ref|ZP_01895269.1| hypothetical protein MDG893_01775 [Marinobacter algicola DG893]
 gi|149358220|gb|EDM46701.1| hypothetical protein MDG893_01775 [Marinobacter algicola DG893]
          Length = 168

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 92/149 (61%), Gaps = 8/149 (5%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASIL-RLGDCLT--LSGDLGSGKSFLARSIIRFL 57
           MN + + L++  + +E  T  LGR LA+++ + G   T  L G+LG+GK+ L+R ++R L
Sbjct: 1   MNVTAQELSLF-LEDEVATENLGRGLATVVVQAGQRATVFLEGNLGTGKTTLSRGVMRGL 59

Query: 58  MHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWP 115
            H+ A  V SPT+T+V+ Y+  S P  HFD YRL   +E+  +G  D    + +C+IEWP
Sbjct: 60  GHEGA--VKSPTYTIVEPYEHLSPPAYHFDLYRLGDPEELEYMGIRDYFQGQCLCLIEWP 117

Query: 116 EIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           E G+ +LP+  + I LS    GR+A +SA
Sbjct: 118 ERGQGILPEPDLWIRLSVNGDGRRALVSA 146


>gi|290969289|ref|ZP_06560814.1| ATPase, YjeE family [Megasphaera genomosp. type_1 str. 28L]
 gi|290780795|gb|EFD93398.1| ATPase, YjeE family [Megasphaera genomosp. type_1 str. 28L]
          Length = 155

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 71/125 (56%), Gaps = 6/125 (4%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +T I   +E  T+ LG  L ++LR G+ L L GDLG+GK+   + I R +   +   V+S
Sbjct: 1   MTDIITRSEAETVALGERLGAVLRDGNVLALHGDLGAGKTHFVQGIARGMGITEP--VVS 58

Query: 68  PTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKK-- 125
           PTFT++  Y+  IP+ HFDFYRL    E+  LGFDE +   + +IEW E     +P    
Sbjct: 59  PTFTILNYYEHEIPLQHFDFYRLEEASELAALGFDEYVQHGVTVIEWSEKFPECIPHTAA 118

Query: 126 --YID 128
             YID
Sbjct: 119 HVYID 123


>gi|320539681|ref|ZP_08039345.1| putative ATPase with strong ADP affinity [Serratia symbiotica str.
           Tucson]
 gi|320030293|gb|EFW12308.1| putative ATPase with strong ADP affinity [Serratia symbiotica str.
           Tucson]
          Length = 154

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 78/137 (56%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+P+P+E  T+ +G  LA        + L GDLG+GK+   R   + L H    +V SPT
Sbjct: 5   VLPLPDEAATVAIGAALAKACDRASVIYLYGDLGAGKTTFCRGFFQGLGHQG--KVKSPT 62

Query: 70  FTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           FTLV+ Y    + V HFD YRL+  +E+  +G  D  + + IC++EWP+ G  +LP+  +
Sbjct: 63  FTLVEPYALHPLTVYHFDLYRLADPEELEFMGIRDYFVQDAICLVEWPQQGSGVLPEADL 122

Query: 128 DIHLSQGKTGRKATISA 144
            ++LS    GR A I A
Sbjct: 123 VLYLSYHNQGRAAKIQA 139


>gi|134300721|ref|YP_001114217.1| hypothetical protein Dred_2888 [Desulfotomaculum reducens MI-1]
 gi|134053421|gb|ABO51392.1| protein of unknown function UPF0079 [Desulfotomaculum reducens
           MI-1]
          Length = 161

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 79/125 (63%), Gaps = 3/125 (2%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           L+ I   + + T  LG  LA++L+ GD + L+GDLG+GK+  ++ + R L    A  V S
Sbjct: 3   LSEIKTGSPEETKYLGEQLATLLKPGDVICLNGDLGAGKTAFSQGVARGLGVTGA--VTS 60

Query: 68  PTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKY 126
           PTFTL+  Y+  +P+ HFD YRL   +++ +LG++E      +C+IEW +  R +LP++ 
Sbjct: 61  PTFTLINEYEGRLPLYHFDVYRLDGPEDMEDLGYEEYFYGHGVCLIEWAQRVRDVLPQER 120

Query: 127 IDIHL 131
           +DI+L
Sbjct: 121 LDINL 125


>gi|86136731|ref|ZP_01055309.1| hypothetical protein MED193_13692 [Roseobacter sp. MED193]
 gi|85826055|gb|EAQ46252.1| hypothetical protein MED193_13692 [Roseobacter sp. MED193]
          Length = 177

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 74/115 (64%), Gaps = 8/115 (6%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLM-HDDALEVLSPTFTLVQLYDASI 80
           L RHLA+ L  GDCL L G +G+GK+  ARS+I+ LM H +  +V SPTFTLVQ Y+  +
Sbjct: 35  LARHLATQLNPGDCLLLEGPIGAGKTHFARSLIQSLMVHPE--DVPSPTFTLVQTYN--V 90

Query: 81  P---VAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           P   + H D YRLS+ +E+ ELG  E  ++ IC+IEWP+    L P   + + LS
Sbjct: 91  PRGELWHADLYRLSALEEIEELGLFEAFDDAICLIEWPDRLAELTPPHALHLELS 145


>gi|167038140|ref|YP_001665718.1| hypothetical protein Teth39_1745 [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167039149|ref|YP_001662134.1| hypothetical protein Teth514_0488 [Thermoanaerobacter sp. X514]
 gi|256750888|ref|ZP_05491772.1| protein of unknown function UPF0079 [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300913261|ref|ZP_07130578.1| protein of unknown function UPF0079 [Thermoanaerobacter sp. X561]
 gi|307723725|ref|YP_003903476.1| hypothetical protein Thet_0538 [Thermoanaerobacter sp. X513]
 gi|320116549|ref|YP_004186708.1| hypothetical protein Thebr_1790 [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|166853389|gb|ABY91798.1| protein of unknown function UPF0079 [Thermoanaerobacter sp. X514]
 gi|166856974|gb|ABY95382.1| protein of unknown function UPF0079 [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256750223|gb|EEU63243.1| protein of unknown function UPF0079 [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300889946|gb|EFK85091.1| protein of unknown function UPF0079 [Thermoanaerobacter sp. X561]
 gi|307580786|gb|ADN54185.1| Uncharacterized protein family UPF0079, ATPase [Thermoanaerobacter
           sp. X513]
 gi|319929640|gb|ADV80325.1| Uncharacterized protein family UPF0079, ATPase [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 153

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 74/122 (60%), Gaps = 3/122 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N   TI LG  L  +LR GD + L G+LGSGK+   + I + L  ++   + SPTFTLV 
Sbjct: 9   NRDETIALGEKLGRLLRSGDIILLYGELGSGKTVFTKGIAKGLEINEP--ITSPTFTLVN 66

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            +   IP+ HFD YRL  +  + ++G++E   +E +C IEWPE    LLPK+ +++ + +
Sbjct: 67  EHRGRIPLYHFDLYRLDDYTALYDIGYEEYFYDEGVCAIEWPERLGPLLPKERLEVIIQK 126

Query: 134 GK 135
           G+
Sbjct: 127 GE 128


>gi|91200725|emb|CAJ73777.1| similar to protein YjeE [Candidatus Kuenenia stuttgartiensis]
          Length = 168

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 81/145 (55%), Gaps = 4/145 (2%)

Query: 7   HLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
           H  +    N + TI  G+ L ++L  G  + L GDLG+GK+ + + I+  L   D+  V 
Sbjct: 12  HEIIFTSKNAEETIKFGKALGTLLTNGHVVALIGDLGTGKTTMVKGIVTGLDVKDSRNVK 71

Query: 67  SPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKK 125
           SPTF+L   Y+  IPV H D YRLS  QE++++G DE I    + IIEW +     LP++
Sbjct: 72  SPTFSLAHKYNGRIPVYHIDAYRLSGSQELLDIGSDEMIFGNGVTIIEWADNVPDSLPEE 131

Query: 126 YIDI---HLSQGKTGRKATISAERW 147
           Y+ I   H+S+ +   KA    +R+
Sbjct: 132 YLKITLTHVSEERRNIKACAYGKRY 156


>gi|148251708|ref|YP_001236293.1| hypothetical protein BBta_0086 [Bradyrhizobium sp. BTAi1]
 gi|146403881|gb|ABQ32387.1| hypothetical protein BBta_0086 [Bradyrhizobium sp. BTAi1]
          Length = 509

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 68/117 (58%), Gaps = 5/117 (4%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLS 91
           G  +TL+GDLG+GK+  AR++IR+L  D  LEV SPTFTL Q Y+  S  + H D YR+S
Sbjct: 31  GVLITLTGDLGAGKTAAARAMIRYLADDAELEVPSPTFTLAQSYELPSFALVHADLYRIS 90

Query: 92  SHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL----SQGKTGRKATISA 144
              E+ E+G   +    + +IEWPE     LP   IDI L    S G T R A I+ 
Sbjct: 91  DASELEEIGLSPLPEATVVLIEWPERAGDELPHDRIDIALRHDASHGDTARSAEITG 147


>gi|254477185|ref|ZP_05090571.1| uncharacterized P-loop hydrolase UPF0079 [Ruegeria sp. R11]
 gi|214031428|gb|EEB72263.1| uncharacterized P-loop hydrolase UPF0079 [Ruegeria sp. R11]
          Length = 159

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 75/144 (52%), Gaps = 6/144 (4%)

Query: 7   HLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
           H   IP+P+   T  L   +   L  GDCL L G +G+GK+  ARS+I+  M     +V 
Sbjct: 4   HSLQIPLPSPDVTAALAAEIGQHLTAGDCLLLEGVIGAGKTHFARSLIQSQMPVPE-DVP 62

Query: 67  SPTFTLVQLYDASIPVA---HFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLP 123
           SPTFTL+Q YD  +P A   H D YRLSS  E+ ELG    L   IC+IEWP+    L P
Sbjct: 63  SPTFTLIQTYD--LPQAELWHADLYRLSSLDEIEELGLTSALETAICLIEWPDKLAELTP 120

Query: 124 KKYIDIHLSQGKTGRKATISAERW 147
              + I L   +   +   +  RW
Sbjct: 121 PSALHISLELDQDALEGRFATLRW 144


>gi|209966415|ref|YP_002299330.1| hypothetical protein RC1_3154 [Rhodospirillum centenum SW]
 gi|209959881|gb|ACJ00518.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 155

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/136 (42%), Positives = 80/136 (58%), Gaps = 2/136 (1%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I +P+E  T  L   L  +LR GD + L G LG+GK+  +R++IR L  +   EV SPTF
Sbjct: 7   IDLPDEAATARLAAALGDLLRPGDTVCLHGGLGAGKTAFSRALIRSLSGNPEEEVPSPTF 66

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
           TLVQ+Y      + HFD YRLS  +EVVELG++E       ++EWPE    LLP   +D+
Sbjct: 67  TLVQVYPLPRFDLWHFDLYRLSGPEEVVELGWEEAQAGGCALVEWPERLGDLLPADRLDL 126

Query: 130 HLS-QGKTGRKATISA 144
            L+  G   R AT++ 
Sbjct: 127 MLTVTGPESRIATLAG 142


>gi|156932399|ref|YP_001436315.1| putative ATPase [Cronobacter sakazakii ATCC BAA-894]
 gi|156530653|gb|ABU75479.1| hypothetical protein ESA_00178 [Cronobacter sakazakii ATCC BAA-894]
          Length = 152

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 80/137 (58%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P E+ T+ LG  +A        + L GDLG+GK+  +R  ++   H     V SPT
Sbjct: 5   VIPLPEEQATLDLGARVARACTGATVIHLYGDLGAGKTTFSRGFLQACGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   +  V HFD YRL+  +E+  +G  D   ++ IC++EWP+ G  +LP   I
Sbjct: 63  YTLVEPYTLENRMVYHFDLYRLADPEELEFMGIRDYFTDDAICLVEWPQQGAGVLPSPDI 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IHLS  + GR+A + A
Sbjct: 123 EIHLSWQEQGREARVKA 139


>gi|91794557|ref|YP_564208.1| hypothetical protein Sden_3209 [Shewanella denitrificans OS217]
 gi|91716559|gb|ABE56485.1| protein of unknown function UPF0079 [Shewanella denitrificans
           OS217]
          Length = 157

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 91/147 (61%), Gaps = 4/147 (2%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           M+ S+  + +  +P+E+ ++ +GR +A+ L+    L L+G+LG+GK+ L+R II+ L H+
Sbjct: 1   MSLSKMTVLIKDLPDEQASVAMGRAIAAGLQPPFTLYLTGELGAGKTTLSRGIIQALGHN 60

Query: 61  DALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIG 118
            A  V SPT+TLV+ Y+   I V HFD YR++  +E+  +G  D   N  +C++EWP+ G
Sbjct: 61  GA--VKSPTYTLVEPYELPGIEVFHFDLYRVADPEELEFMGIRDYFNNNSLCLVEWPDRG 118

Query: 119 RSLLPKKYIDIHLSQGKTGRKATISAE 145
             +LP+  + + LS     R+  I A+
Sbjct: 119 FGMLPEADLHLDLSYKGLQRQIKIEAK 145


>gi|170728499|ref|YP_001762525.1| hypothetical protein Swoo_4174 [Shewanella woodyi ATCC 51908]
 gi|169813846|gb|ACA88430.1| protein of unknown function UPF0079 [Shewanella woodyi ATCC 51908]
          Length = 152

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 79/130 (60%), Gaps = 4/130 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE++ + LG+ LA+I+     L LSG+LG+GK+ L+R +I+   H  A  V SPT+ LV+
Sbjct: 10  NEQDMVELGKRLAAIITPPLILNLSGELGAGKTTLSRGLIQAFGHQGA--VKSPTYALVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+ A I + HFD YRLS  +E+  +G  +   E  ICI+EWP+ G  L+P+  I  H+ 
Sbjct: 68  PYELAGIDLFHFDLYRLSDPEELEFMGIRDYFTENSICIVEWPDRGHGLMPEADISCHIK 127

Query: 133 QGKTGRKATI 142
               GR+  I
Sbjct: 128 YLDAGREVEI 137


>gi|329113822|ref|ZP_08242593.1| UPF0079 ATP-binding protein YjeE [Acetobacter pomorum DM001]
 gi|326696832|gb|EGE48502.1| UPF0079 ATP-binding protein YjeE [Acetobacter pomorum DM001]
          Length = 156

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 81/134 (60%), Gaps = 7/134 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  TI L   LA   + GD + LSG LG+GKS  AR+ +R    +  LEV SPT+TLVQ
Sbjct: 9   DEDATIKLATKLAEYAQAGDAILLSGPLGAGKSLFARAFLRAFCQEPNLEVPSPTYTLVQ 68

Query: 75  LYDASIP-VAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIH--- 130
            Y++ +  V+HFD +RL    E+ ELG+DE   E + ++EWP+    LLP+  +++    
Sbjct: 69  SYESPLCIVSHFDLWRLGGPDELEELGWDEA-REGVVLVEWPQKLEDLLPEDALNLEIHV 127

Query: 131 LSQGKTGRKATISA 144
           L+ G+  R+A +S 
Sbjct: 128 LADGQ--RQARLSG 139


>gi|157373932|ref|YP_001472532.1| hypothetical protein Ssed_0793 [Shewanella sediminis HAW-EB3]
 gi|157316306|gb|ABV35404.1| protein of unknown function UPF0079 [Shewanella sediminis HAW-EB3]
          Length = 152

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 84/135 (62%), Gaps = 4/135 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE++T+ LG+ LA+I+     L LSG+LG+GK+ L+R +I+ L H  A  V SPT+ LV+
Sbjct: 10  NEQDTVDLGKRLAAIISPPLMLNLSGELGAGKTTLSRGLIQALGHKGA--VKSPTYALVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+   I + HFD YRLS  +E+  +G  +   E+ +CI+EWP+ G  LLP+  I + ++
Sbjct: 68  PYEFDGIDLYHFDLYRLSDPEELEFMGIRDYFTEKSVCIVEWPDRGHGLLPEADISLQIN 127

Query: 133 QGKTGRKATISAERW 147
                R+  IS+  +
Sbjct: 128 YVGERREVEISSGSY 142


>gi|307243646|ref|ZP_07525789.1| ATPase, YjeE family [Peptostreptococcus stomatis DSM 17678]
 gi|306493015|gb|EFM65025.1| ATPase, YjeE family [Peptostreptococcus stomatis DSM 17678]
          Length = 152

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/132 (40%), Positives = 82/132 (62%), Gaps = 6/132 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFL-MHDDALEVLSPT 69
           I + NEK T  LG+ +  +L  G  L L+GDLG+GK+ L +SI   L + DD   + SPT
Sbjct: 4   IYLENEKATSSLGKKIGEVLFPGAILCLNGDLGAGKTALTKSIALGLDIKDD---ITSPT 60

Query: 70  FTLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYI 127
           FT+V  Y +  + + HFD YR+ S  E+ ++GF+E I +E +CIIEW +I   +LP + +
Sbjct: 61  FTIVNEYEEGRLKLNHFDVYRIGSSDEMYDIGFEEYIGSEGVCIIEWSQIIEDVLPDERL 120

Query: 128 DIHLSQGKTGRK 139
           DI++     GR+
Sbjct: 121 DINIKYEDEGRR 132


>gi|114564476|ref|YP_751990.1| hypothetical protein Sfri_3315 [Shewanella frigidimarina NCIMB 400]
 gi|114335769|gb|ABI73151.1| protein of unknown function UPF0079 [Shewanella frigidimarina NCIMB
           400]
          Length = 152

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 82/132 (62%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+ T+ LG+ +A  ++    + L+GDLG+GK+  +R II+ L H  A  V SPT+TLV+
Sbjct: 10  NEQATVALGQQIAQWIKPPLTIYLTGDLGAGKTTFSRGIIQSLGHQGA--VKSPTYTLVE 67

Query: 75  LYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+ + + V HFD YRL+  +E+  +G  +    R +C++EWP+ G  LLP+  I +HL 
Sbjct: 68  PYEFNDMDVFHFDLYRLADPEELEYMGIRDYFTARSVCLVEWPDNGHGLLPEADIHLHLR 127

Query: 133 QGKTGRKATISA 144
             ++ R+  + A
Sbjct: 128 YKESQRQIELQA 139


>gi|332981836|ref|YP_004463277.1| hypothetical protein Mahau_1261 [Mahella australiensis 50-1 BON]
 gi|332699514|gb|AEE96455.1| Uncharacterized protein family UPF0079, ATPase [Mahella
           australiensis 50-1 BON]
          Length = 152

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 77/130 (59%), Gaps = 3/130 (2%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           K T  LG+ +  +L  GD + L GDLGSGK+ + + I R L  D   E+ SPT+T++  Y
Sbjct: 9   KETFALGKRIGQLLHEGDIIALDGDLGSGKTQIVKGIARGL--DITDEITSPTYTIMSQY 66

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQGK 135
           +  +P+ HFD YRL   +++ ++G++E   ++ + +IEW E  R LLP +Y+ I +  G 
Sbjct: 67  NGRLPLYHFDVYRLEDPEQLYDIGYEEYFFDKGVTVIEWSEKIRELLPAQYMHIRILYGT 126

Query: 136 TGRKATISAE 145
              +  I A+
Sbjct: 127 DENQRIIDAK 136


>gi|330862101|emb|CBX72267.1| UPF0079 ATP-binding protein yjeE [Yersinia enterocolitica W22703]
          Length = 149

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 79/134 (58%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT+TL
Sbjct: 1   LPDEAATVALGGALAHAFEGASVIYLFGDLGAGKTTFSRGFLQALGHSG--HVKSPTYTL 58

Query: 73  VQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y  +  PV HFD YRL+  +E+  +G  +  +++ IC++EWP+ G   LP+  +++H
Sbjct: 59  VEPYALTPRPVYHFDLYRLADPEELEFMGIRDYFDKQAICLVEWPQQGAGFLPQADVELH 118

Query: 131 LSQGKTGRKATISA 144
           L+    GR+A + A
Sbjct: 119 LAYQAEGREARLVA 132


>gi|20807036|ref|NP_622207.1| ATPase or kinase [Thermoanaerobacter tengcongensis MB4]
 gi|20515523|gb|AAM23811.1| predicted ATPase or kinase [Thermoanaerobacter tengcongensis MB4]
          Length = 151

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (60%), Gaps = 3/120 (2%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           ++T  LG  L  +L+ GD + L GDLGSGK+  A+ I + L  +   EV SPTFTLV  Y
Sbjct: 10  EDTKNLGEKLGKLLKKGDIVLLYGDLGSGKTVFAKGIGKGLGIEG--EVTSPTFTLVNEY 67

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQGK 135
                  HFD YR+  + E+ E+G++E   NE +C +EWPE    L+PK+ +++ + +G+
Sbjct: 68  HGREKFYHFDLYRIDDYAELYEIGYEEYFYNEAVCAVEWPERLGPLIPKERLEVLIEKGE 127


>gi|306821174|ref|ZP_07454790.1| ATPase with strong ADP affinity [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304550867|gb|EFM38842.1| ATPase with strong ADP affinity [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 162

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 93/161 (57%), Gaps = 6/161 (3%)

Query: 5   EKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALE 64
           +K   +I + NE +T+ LG  +A  +  G  + L G+LGSGK+ L++SII+ +M     +
Sbjct: 2   KKEWKMIRLENENSTVKLGEIIADTIPQGIIIALIGELGSGKTTLSQSIIKNIMK--IQD 59

Query: 65  VLSPTFTLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILNER--ICIIEWPEIGRSL 121
           V SPTF +V  Y D +  + HFDFYRL    E+  +GFD+ L+++  I +IEW +    +
Sbjct: 60  VSSPTFNIVNEYRDKNQTIYHFDFYRLEDESELFGIGFDDYLSDKKSIMLIEWADKFLDM 119

Query: 122 LPKKYIDIHLSQGKTGRKATI-SAERWIISHINQMNRSTSQ 161
           LP+ Y++I   +G+  R   + S  +  I  +N++    SQ
Sbjct: 120 LPRNYLEIVFYKGEDYRDVEVKSVGKKYIDVVNEIIEKFSQ 160


>gi|311695394|gb|ADP98267.1| protein containing uncharacterized protein family UPF0079, ATPase
           bacteria domains [marine bacterium HP15]
          Length = 162

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 81/137 (59%), Gaps = 7/137 (5%)

Query: 13  IPNEKNTICLGRHLA-SILRLGDCLT--LSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           + NE  T  LGR LA +++  G  L   L G+LG GK+ ++R ++R L H+ A  V SPT
Sbjct: 9   LENEAETEHLGRELARTVVESGHGLVVYLDGELGMGKTTISRGVMRGLGHEGA--VKSPT 66

Query: 70  FTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y+  + P  HFD YRL   +E+  +G  D    E +C+IEWPE G+ +LP+  +
Sbjct: 67  YTLVEPYETLNPPTYHFDLYRLGDAEELEYMGIRDYFSAENLCLIEWPERGKGILPEPDL 126

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL     GR   + A
Sbjct: 127 EVHLETRGEGRSVVLRA 143


>gi|152981588|ref|YP_001352155.1| hypothetical protein mma_0465 [Janthinobacterium sp. Marseille]
 gi|151281665|gb|ABR90075.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 161

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 76/135 (56%), Gaps = 8/135 (5%)

Query: 16  EKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQL 75
           E  T+ LG  LA  L+ G  + L GDLG+GK+ L R+++  L H     V SPT+TL + 
Sbjct: 11  EAGTLALGASLAHALQPGLTIYLHGDLGAGKTALTRAMLHALGHVG--HVKSPTYTLAEP 68

Query: 76  Y-----DASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDI 129
           Y       ++ V HFD YR+ S +E ++ GF E  N++ ICIIEWPE   ++LP   I I
Sbjct: 69  YIVNIKGEAVNVIHFDLYRMGSAEEFLDAGFREYFNQQTICIIEWPEKAETVLPPPDISI 128

Query: 130 HLSQGKTGRKATISA 144
            L+    GR   + A
Sbjct: 129 SLAVAGEGRDVELHA 143


>gi|303240928|ref|ZP_07327439.1| protein of unknown function UPF0079 [Acetivibrio cellulolyticus
           CD2]
 gi|302591514|gb|EFL61251.1| protein of unknown function UPF0079 [Acetivibrio cellulolyticus
           CD2]
          Length = 154

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 72/117 (61%), Gaps = 3/117 (2%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
            T  +GR L SIL  GD + L+GDLG+GK+ L   I   L  +D   + SPTFT+V  Y 
Sbjct: 11  ETTQVGRALGSILNRGDVVCLTGDLGTGKTALTNGIASALGIEDY--ITSPTFTIVNEYK 68

Query: 78  ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
             +P+ HFD YR+S  +E+ ++GF+E L  E + +IEW E+ + +LP   I + +S+
Sbjct: 69  TEVPLYHFDVYRISDPEEMYDIGFEEYLYGEGVVVIEWAELIKGILPDDLIWVKISK 125


>gi|330862103|emb|CBX72268.1| UPF0079 ATP-binding protein yjeE [Yersinia enterocolitica W22703]
          Length = 133

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 79/133 (59%), Gaps = 6/133 (4%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+P+P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VLPLPDEAATVALGGALAHAFEGASVIYLFGDLGAGKTTFSRGFLQALGHSG--HVKSPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  +  PV HFD YRL+  +E+  +G  +  +++ IC++EWP+ G   LP+  +
Sbjct: 63  YTLVEPYALTPRPVYHFDLYRLADPEELEFMGIRDYFDKQAICLVEWPQQGAGFLPQADV 122

Query: 128 DIHLSQGKTGRKA 140
           ++HL+    GR A
Sbjct: 123 ELHLAY--PGRGA 133


>gi|268592884|ref|ZP_06127105.1| P-loop hydrolase/phosphotransferase [Providencia rettgeri DSM 1131]
 gi|291311674|gb|EFE52127.1| P-loop hydrolase/phosphotransferase [Providencia rettgeri DSM 1131]
          Length = 154

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
            I + NE  T+ LG  +A     G  + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   TIQLANEAQTVALGNAIAKACHQGTIIHLYGDLGAGKTTFSRGFLQALGHQG--HVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y+ A   V HFD YRL+  +E+  +G  D      IC++EWP+ G+  LP+  +
Sbjct: 63  YTLVEPYELADRQVFHFDLYRLADPEELEFMGIRDYFSGNSICLVEWPQQGKGFLPEADL 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL+    GR+A   A
Sbjct: 123 ELHLTYQGEGRQAHFVA 139


>gi|157963358|ref|YP_001503392.1| hypothetical protein Spea_3544 [Shewanella pealeana ATCC 700345]
 gi|157848358|gb|ABV88857.1| protein of unknown function UPF0079 [Shewanella pealeana ATCC
           700345]
          Length = 160

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 80/134 (59%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ T+ LG  LA ++     + LSGDLG+GK+  +R +I+ L H  A  V SPT+TL
Sbjct: 10  LSDEQETVNLGTELAGLITPPLTVYLSGDLGAGKTTFSRGLIQSLGHQGA--VKSPTYTL 67

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+   + V HFD YRL   +E+  +G  +   +R +CI+EWP+ G  LLP   + IH
Sbjct: 68  VEPYELDGLDVYHFDLYRLYDPEELEFMGIRDYFTDRSLCIVEWPDRGHGLLPCADVHIH 127

Query: 131 LSQGKTGRKATISA 144
           +    TGR+  + A
Sbjct: 128 IEYVNTGRQVELQA 141


>gi|121729714|ref|ZP_01682156.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|153217198|ref|ZP_01950962.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|153827308|ref|ZP_01979975.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|254227108|ref|ZP_04920660.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|254292135|ref|ZP_04962907.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|297582271|ref|ZP_06944185.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|121628565|gb|EAX61047.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|124113781|gb|EAY32601.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|125620363|gb|EAZ48745.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|149738774|gb|EDM53116.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|150421934|gb|EDN13909.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|297533490|gb|EFH72337.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 188

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +  + +E+ TI LGR LA I      L L GDLG+GK+  +R  IR L H     V SPT
Sbjct: 39  IFSLKDEQATIELGRALALICSQQTTLYLHGDLGAGKTTFSRGFIRALGHQG--NVKSPT 96

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   +  V HFD YRL+  +E+  +G  D    + IC++EWPE G  LLP   +
Sbjct: 97  YTLVEPYQLGMWQVYHFDLYRLADPEELEFMGIRDYFSADAICLVEWPEKGHGLLPNADL 156

Query: 128 DIHLSQGKTGRKATISA 144
           DI L      R AT++A
Sbjct: 157 DIDLRYDGEQRVATLTA 173


>gi|261209764|ref|ZP_05924070.1| ATPase YjeE [Vibrio sp. RC341]
 gi|260841180|gb|EEX67690.1| ATPase YjeE [Vibrio sp. RC341]
          Length = 188

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +  + +E+ TI LG  LA+I      L L GDLG+GK+  +R  IR L H     V SPT
Sbjct: 39  IFSLKDEQETIELGSALAAICSQQTTLYLHGDLGAGKTTFSRGFIRALGHKG--NVKSPT 96

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   +  V HFD YRL+  +E+  +G  D    + IC++EWPE G  LLP   +
Sbjct: 97  YTLVEPYQLGAWQVYHFDLYRLADPEELEFMGIRDYFTADAICLVEWPEKGHGLLPNADL 156

Query: 128 DIHLSQGKTGRKATISA 144
           DI L      R AT++A
Sbjct: 157 DIDLRYDGEQRIATLTA 173


>gi|238918364|ref|YP_002931878.1| hypothetical protein NT01EI_0405 [Edwardsiella ictaluri 93-146]
 gi|238867932|gb|ACR67643.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 154

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ +P+E  TI LG  LA   +    + L GDLG+GK+  +R  ++ + H   ++  SPT
Sbjct: 5   VLQLPDEAATIVLGGALARACQRATVIYLYGDLGAGKTTFSRGFLQAMGHQGTVK--SPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  A  PV HFD YRL+  +E+  +G  D    + + ++EWP+ G   LP+  I
Sbjct: 63  YTLVEPYPLAPRPVYHFDLYRLADPEELEFMGIRDYFAQDALLLVEWPQQGMGFLPEPDI 122

Query: 128 DIHLSQGKTGRKATISA 144
            +HL+    GR+A I A
Sbjct: 123 TLHLTYTDGGRQAVIEA 139


>gi|260599484|ref|YP_003212055.1| ADP-binding protein [Cronobacter turicensis z3032]
 gi|260218661|emb|CBA33993.1| UPF0079 ATP-binding protein yjeE [Cronobacter turicensis z3032]
          Length = 152

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 79/137 (57%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P E+ T+ LG  +A        + L GDLG+GK+  +R  ++   H     V SPT
Sbjct: 5   VIPLPEEQATLDLGARVARACTGATVIHLYGDLGAGKTTFSRGFLQACGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   +  V HFD YRL+  +E+  +G  D   ++ IC++EWP+ G  +LP   I
Sbjct: 63  YTLVEPYTLENRMVYHFDLYRLADPEELEFMGIRDYFTDDAICLVEWPQQGAGVLPPPDI 122

Query: 128 DIHLSQGKTGRKATISA 144
           +IHLS    GR+A + A
Sbjct: 123 EIHLSWQDQGREARVKA 139


>gi|121591552|ref|ZP_01678812.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|147673406|ref|YP_001218612.1| hypothetical protein VC0395_A2754 [Vibrio cholerae O395]
 gi|153823678|ref|ZP_01976345.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|227080555|ref|YP_002809106.1| hypothetical protein VCM66_0327 [Vibrio cholerae M66-2]
 gi|254851654|ref|ZP_05241004.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|298501243|ref|ZP_07011041.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|121546592|gb|EAX56787.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|126518795|gb|EAZ76018.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|146315289|gb|ABQ19828.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|227008443|gb|ACP04655.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|227012199|gb|ACP08409.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|254847359|gb|EET25773.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|297539997|gb|EFH76060.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 188

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +  + +E+ TI LGR LA I      L L GDLG+GK+  +R  IR L H     V SPT
Sbjct: 39  IFSLKDEQATIELGRALALICSQQTTLYLHGDLGAGKTTFSRGFIRALGHQG--NVKSPT 96

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   +  V HFD YRL+  +E+  +G  D    + IC++EWPE G  LLP   +
Sbjct: 97  YTLVEPYQLGMWQVYHFDLYRLADPEELEFMGIRDYFSADAICLVEWPEKGHGLLPNADL 156

Query: 128 DIHLSQGKTGRKATISA 144
           DI L      R AT++A
Sbjct: 157 DIDLRYDGDQRVATLTA 173


>gi|99082682|ref|YP_614836.1| hypothetical protein TM1040_2842 [Ruegeria sp. TM1040]
 gi|99038962|gb|ABF65574.1| protein of unknown function UPF0079 [Ruegeria sp. TM1040]
          Length = 158

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 78/136 (57%), Gaps = 2/136 (1%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+   T  L RH+A IL  GD + L G +G+GK+  ARS+I+ LM +   +V SPTFTL
Sbjct: 10  LPSSDATTELARHIARILVPGDVVLLQGPIGAGKTHFARSLIQSLM-EVPEDVPSPTFTL 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ+Y+ A+  + H D YRLS   EV ELG      + IC+IEWPE    L P   + + L
Sbjct: 69  VQVYNVATGELWHADLYRLSHVDEVEELGLLAAFEDAICLIEWPEKLEDLRPASALTMEL 128

Query: 132 SQGKTGRKATISAERW 147
           S  +    A ++   W
Sbjct: 129 SLDEDHDDARMAELMW 144


>gi|229512379|ref|ZP_04401854.1| ATPase YjeE [Vibrio cholerae TMA 21]
 gi|229519946|ref|ZP_04409377.1| ATPase YjeE [Vibrio cholerae TM 11079-80]
 gi|229526907|ref|ZP_04416310.1| ATPase YjeE [Vibrio cholerae bv. albensis VL426]
 gi|229336076|gb|EEO01095.1| ATPase YjeE [Vibrio cholerae bv. albensis VL426]
 gi|229343074|gb|EEO08061.1| ATPase YjeE [Vibrio cholerae TM 11079-80]
 gi|229350594|gb|EEO15539.1| ATPase YjeE [Vibrio cholerae TMA 21]
          Length = 154

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +  + +E+ TI LGR LA I      L L GDLG+GK+  +R  IR L H     V SPT
Sbjct: 5   IFSLKDEQATIELGRALALICSQQTTLYLHGDLGAGKTTFSRGFIRALGHQG--NVKSPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   +  V HFD YRL+  +E+  +G  D    + IC++EWPE G  LLP   +
Sbjct: 63  YTLVEPYQLGMWQVYHFDLYRLADPEELEFMGIRDYFSADAICLVEWPEKGHGLLPNADL 122

Query: 128 DIHLSQGKTGRKATISA 144
           DI L      R AT++A
Sbjct: 123 DIDLRYDGEQRVATLTA 139


>gi|319935558|ref|ZP_08009992.1| ATP/GTP hydrolase [Coprobacillus sp. 29_1]
 gi|319809435|gb|EFW05856.1| ATP/GTP hydrolase [Coprobacillus sp. 29_1]
          Length = 147

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 76/120 (63%), Gaps = 5/120 (4%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N+++ I  G  LAS L  G  LTL GDLG+GK+   + I + L     +   SPTFT+V+
Sbjct: 6   NQQDMIDFGEKLASYLFPGAILTLEGDLGAGKTTFTKGIGKGLGIQKIIN--SPTFTIVK 63

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
           +Y  ++P+ HFD YRL    E  ELGF+E+  +E +C++EWP   + +LP++ +DI +++
Sbjct: 64  IYQGNLPLYHFDAYRLEGQNE--ELGFEEMFEDEGVCVVEWPIYIQDILPQERLDITITK 121


>gi|114048924|ref|YP_739474.1| hypothetical protein Shewmr7_3436 [Shewanella sp. MR-7]
 gi|113890366|gb|ABI44417.1| protein of unknown function UPF0079 [Shewanella sp. MR-7]
          Length = 152

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 55/132 (41%), Positives = 79/132 (59%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE  TI LG+ LA  ++    L L+GDLG+GK+ L+R +I+ L H  A  V SPT+TLV+
Sbjct: 10  NEDETIALGQKLARHIQAPLTLYLTGDLGAGKTTLSRGLIQGLGHKGA--VKSPTYTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+   + V HFD YRL+  +E+  +G  D   +  +CI+EWP+ G  LLP   I +HL+
Sbjct: 68  PYELDGVEVYHFDLYRLNDPEELEFMGIRDYFTDSSLCIVEWPDKGHGLLPDADIHLHLN 127

Query: 133 QGKTGRKATISA 144
                R+  I A
Sbjct: 128 YVNQRREIQIRA 139


>gi|229506861|ref|ZP_04396369.1| ATPase YjeE [Vibrio cholerae BX 330286]
 gi|229508665|ref|ZP_04398159.1| ATPase YjeE [Vibrio cholerae B33]
 gi|229516047|ref|ZP_04405498.1| ATPase YjeE [Vibrio cholerae RC9]
 gi|229526995|ref|ZP_04416391.1| ATPase YjeE [Vibrio cholerae 12129(1)]
 gi|229606375|ref|YP_002877023.1| ATPase YjeE [Vibrio cholerae MJ-1236]
 gi|255747143|ref|ZP_05421086.1| ATPase YjeE [Vibrio cholera CIRS 101]
 gi|262147193|ref|ZP_06027998.1| ATPase YjeE [Vibrio cholerae INDRE 91/1]
 gi|262166931|ref|ZP_06034651.1| ATPase YjeE [Vibrio cholerae RC27]
 gi|229335518|gb|EEO00999.1| ATPase YjeE [Vibrio cholerae 12129(1)]
 gi|229346950|gb|EEO11917.1| ATPase YjeE [Vibrio cholerae RC9]
 gi|229354300|gb|EEO19229.1| ATPase YjeE [Vibrio cholerae B33]
 gi|229355966|gb|EEO20885.1| ATPase YjeE [Vibrio cholerae BX 330286]
 gi|229369030|gb|ACQ59453.1| ATPase YjeE [Vibrio cholerae MJ-1236]
 gi|255735192|gb|EET90594.1| ATPase YjeE [Vibrio cholera CIRS 101]
 gi|262024636|gb|EEY43317.1| ATPase YjeE [Vibrio cholerae RC27]
 gi|262031374|gb|EEY49983.1| ATPase YjeE [Vibrio cholerae INDRE 91/1]
 gi|327483206|gb|AEA77613.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Vibrio cholerae LMA3894-4]
          Length = 154

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +  + +E+ TI LGR LA I      L L GDLG+GK+  +R  IR L H     V SPT
Sbjct: 5   IFSLKDEQATIELGRALALICSQQTTLYLHGDLGAGKTTFSRGFIRALGHQG--NVKSPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   +  V HFD YRL+  +E+  +G  D    + IC++EWPE G  LLP   +
Sbjct: 63  YTLVEPYQLGMWQVYHFDLYRLADPEELEFMGIRDYFSADAICLVEWPEKGHGLLPNADL 122

Query: 128 DIHLSQGKTGRKATISA 144
           DI L      R AT++A
Sbjct: 123 DIDLRYDGDQRVATLTA 139


>gi|300310173|ref|YP_003774265.1| ATPase/kinase [Herbaspirillum seropedicae SmR1]
 gi|300072958|gb|ADJ62357.1| ATPase/kinase protein [Herbaspirillum seropedicae SmR1]
          Length = 161

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 78/138 (56%), Gaps = 8/138 (5%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T  LG  LA +L  G  + L GDLG+GK+ L R+++    +     V SPT+TL
Sbjct: 8   LPDEAATAHLGADLARVLAPGLAIYLHGDLGAGKTALTRALLHAAGYQG--RVKSPTYTL 65

Query: 73  VQLYDA-----SIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKY 126
            + Y+       + V HFD YR++S +E ++ GF E  NE  +CI+EWPE G  +LP   
Sbjct: 66  AEPYEVMLAGRMVTVIHFDLYRMASPEEFLDAGFREHFNENAVCIVEWPEKGDPVLPPPD 125

Query: 127 IDIHLSQGKTGRKATISA 144
           I ++L+    GR   + A
Sbjct: 126 IHVNLTLAGDGRDVELRA 143


>gi|302875849|ref|YP_003844482.1| hypothetical protein Clocel_3028 [Clostridium cellulovorans 743B]
 gi|307689282|ref|ZP_07631728.1| hypothetical protein Ccel74_14081 [Clostridium cellulovorans 743B]
 gi|302578706|gb|ADL52718.1| uncharacterized protein family UPF0079, ATPase [Clostridium
           cellulovorans 743B]
          Length = 152

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 85/147 (57%), Gaps = 7/147 (4%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N  +T+ LG  + ++ R GD + ++GDLG+GK+ L + I + L  D+   + SPTF +V 
Sbjct: 7   NVADTLSLGEKIGNLARSGDIICINGDLGTGKTHLTKGIAKGLSIDE--HITSPTFNIVN 64

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +   HFD YR++   E+  +GFDE I ++ + +IEW      L+PK++IDI + +
Sbjct: 65  EYEGRLKFYHFDVYRVNDPDEIYAIGFDEYIFSDGVSVIEWSNYINELIPKEHIDITIEK 124

Query: 134 ----GKTGRKATISAERWIISHINQMN 156
               G   RK +I+ E     ++ ++N
Sbjct: 125 LTDMGDDYRKISITYEGSKYDYLKEIN 151


>gi|126666947|ref|ZP_01737923.1| putative nucleotide-binding protein [Marinobacter sp. ELB17]
 gi|126628663|gb|EAZ99284.1| putative nucleotide-binding protein [Marinobacter sp. ELB17]
          Length = 171

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 80/137 (58%), Gaps = 7/137 (5%)

Query: 13  IPNEKNTICLGRHLASILRLGD---CLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           + ++  T  LGR LA +++  +    + L GDLG GK+ L+R ++R L H+ A  V SPT
Sbjct: 12  LADDSETERLGRELARLVQRAENALAIYLGGDLGMGKTTLSRGLLRGLGHEGA--VKSPT 69

Query: 70  FTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYI 127
           +T+V+ Y+    PV HFD YRL   +E+  +G  +  N+  +C++EWPE G  LLP   +
Sbjct: 70  YTIVEPYENLQPPVYHFDLYRLKDPEELEFMGIRDYFNDHNLCLMEWPERGEELLPTADL 129

Query: 128 DIHLSQGKTGRKATISA 144
            +HL     GR A + A
Sbjct: 130 TVHLESQGNGRSAILRA 146


>gi|259417504|ref|ZP_05741423.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259346410|gb|EEW58224.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 158

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 60/143 (41%), Positives = 83/143 (58%), Gaps = 7/143 (4%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+ + T  L  ++A IL  GD + L G +G+GK+  ARS+I+ LM D   +V SPTFTL
Sbjct: 10  LPSSEATSKLAHNIARILVPGDVVLLEGPIGAGKTHFARSLIQSLM-DVPEDVPSPTFTL 68

Query: 73  VQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ YD  I  + H D YRLS   EV ELG     ++ IC+IEWP+    L P   + + L
Sbjct: 69  VQTYDVPIGELWHADLYRLSHVDEVEELGLIAAFDDAICLIEWPDKLDDLCPDDALTLRL 128

Query: 132 S---QGKTGRKATI--SAERWII 149
           S   + +  R+A    SAE+W I
Sbjct: 129 SLDAEIEDARQAEFVWSAEKWNI 151


>gi|182419835|ref|ZP_02951075.1| conserved hypothetical protein [Clostridium butyricum 5521]
 gi|237666814|ref|ZP_04526799.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT
           E BL5262]
 gi|182376383|gb|EDT73965.1| conserved hypothetical protein [Clostridium butyricum 5521]
 gi|237658013|gb|EEP55568.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT
           E BL5262]
          Length = 153

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 55/139 (39%), Positives = 83/139 (59%), Gaps = 10/139 (7%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  LG  L  +L  GD + L+GDLG+GK+ + + I R L  DD   + SPTFT+V  Y
Sbjct: 9   EETTKLGIQLGKLLNPGDIVCLTGDLGTGKTHITKGIARGLDIDD--NITSPTFTIVNEY 66

Query: 77  DAS-IPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKK----YIDIH 130
           D+  + + HFD YR+S   E+  +GFD+ I ++ + IIEW      +LPK     YI+  
Sbjct: 67  DSGRLKLNHFDVYRVSDPDEIYAIGFDDYIFSDAVSIIEWANYIEEILPKDLLHIYIEKD 126

Query: 131 LSQGKTGRKATIS--AERW 147
           LS+G++ RK T++   ER+
Sbjct: 127 LSKGESYRKITLTPYGERY 145


>gi|163749343|ref|ZP_02156592.1| hypothetical protein KT99_08773 [Shewanella benthica KT99]
 gi|161331062|gb|EDQ01988.1| hypothetical protein KT99_08773 [Shewanella benthica KT99]
          Length = 165

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 81/132 (61%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE++T+ LG+ LA  +     L LSG+LG+GK+ L+R +I+ L H+ A  V SPT+ LV+
Sbjct: 23  NEQDTVELGKRLAQFITPPLTLNLSGELGAGKTTLSRGLIQALGHEGA--VKSPTYALVE 80

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+   I + HFD YRLS  +E+  +G  D   ++ IC++EWP+ G  L+P   I I + 
Sbjct: 81  PYELGDIELFHFDLYRLSDPEELEYMGIRDYFTDKSICLVEWPDRGHGLMPVADISIAIK 140

Query: 133 QGKTGRKATISA 144
              T R+  I++
Sbjct: 141 YVGTSREVEITS 152


>gi|269137706|ref|YP_003294406.1| putative ATPase [Edwardsiella tarda EIB202]
 gi|267983366|gb|ACY83195.1| putative ATPase [Edwardsiella tarda EIB202]
 gi|304557760|gb|ADM40424.1| ATPase YjeE [Edwardsiella tarda FL6-60]
          Length = 154

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ +P+E  TI LG  LA   +    + L GDLG+GK+  +R  ++ + H   ++  SPT
Sbjct: 5   VLQLPDEAATIALGGALARACQRATVIYLYGDLGAGKTTFSRGFLQAMGHQGTVK--SPT 62

Query: 70  FTLVQLY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  A  PV HFD YRL+  +E+  +G  D    + + ++EWP+ G   LP+  I
Sbjct: 63  YTLVEPYLLAPRPVYHFDLYRLADPEELEFMGIRDYFAQDALLLVEWPQQGMGFLPEPDI 122

Query: 128 DIHLSQGKTGRKATISA 144
            +HL+    GR+A I A
Sbjct: 123 TLHLTYTGGGRQAVIEA 139


>gi|170738835|ref|YP_001767490.1| aminoglycoside phosphotransferase [Methylobacterium sp. 4-46]
 gi|168193109|gb|ACA15056.1| aminoglycoside phosphotransferase [Methylobacterium sp. 4-46]
          Length = 514

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 53/108 (49%), Positives = 71/108 (65%), Gaps = 2/108 (1%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I +P+E  T  LGR LA +L+ GD + LSG LG GK+ LAR++IR L  +  L+V SPTF
Sbjct: 14  IVLPDESATEDLGRFLAELLQPGDLVALSGGLGGGKTTLARALIRELTGEPDLDVPSPTF 73

Query: 71  TLVQLYD--ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           TL+Q Y+    + V H D YRL    E+VELGFDE+    I ++EWP+
Sbjct: 74  TLIQPYEGRGGVAVVHADLYRLRGPDELVELGFDELTERAITLVEWPD 121


>gi|197117651|ref|YP_002138078.1| hypothetical protein Gbem_1263 [Geobacter bemidjiensis Bem]
 gi|197087011|gb|ACH38282.1| protein of unknown function UPF0079 [Geobacter bemidjiensis Bem]
          Length = 153

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 73/130 (56%), Gaps = 1/130 (0%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T+ LG  L  +L  GD + L G+LG+GK+  A+ +   L  D    V SPT+T++ +Y
Sbjct: 10  EETVELGARLGRLLEPGDFVALVGELGAGKTQFAKGVALGLEVDPETPVTSPTYTILNVY 69

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQGK 135
              IP+ HFD YRL    EV +LGF+E  + +  C++EW E     +P++ + + LS   
Sbjct: 70  QGRIPLYHFDLYRLQGADEVADLGFEEYFSGDGACVVEWAERLEDEVPEELLTVELSHRG 129

Query: 136 TGRKATISAE 145
            GR  +  AE
Sbjct: 130 EGRCVSFHAE 139


>gi|227326203|ref|ZP_03830227.1| putative ATPase [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 160

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (57%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ +P+E  TI LG  LA        + L GDLG+GK+  +R  ++   H     V SPT
Sbjct: 5   VLLLPDEAATISLGTALAKACDGACVIHLYGDLGAGKTTFSRGFLQARGHQG--NVKSPT 62

Query: 70  FTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  S + V HFD YRL+  +E+  +G  D +  + IC+IEWP+ G  +LP   I
Sbjct: 63  YTLVEPYALSPLAVYHFDLYRLADPEELEFMGIRDYLTQDAICLIEWPQQGAGVLPDADI 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL     GR+A +SA
Sbjct: 123 ELHLRYQDQGRQAELSA 139


>gi|227115184|ref|ZP_03828840.1| putative ATPase [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 160

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (57%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ +P+E  TI LG  LA        + L GDLG+GK+  +R  ++   H     V SPT
Sbjct: 5   VLLLPDEAATISLGTALAKACDGACVIHLYGDLGAGKTTFSRGFLQARGHQG--NVKSPT 62

Query: 70  FTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  S + V HFD YRL+  +E+  +G  D +  + IC+IEWP+ G  +LP   I
Sbjct: 63  YTLVEPYALSPLAVYHFDLYRLADPEELEFMGIRDYLTQDAICLIEWPQQGAGVLPDADI 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL     GR+A +SA
Sbjct: 123 ELHLRYQDQGRQAELSA 139


>gi|90414479|ref|ZP_01222455.1| putative nucleotide-binding protein [Photobacterium profundum 3TCK]
 gi|90324484|gb|EAS41043.1| putative nucleotide-binding protein [Photobacterium profundum 3TCK]
          Length = 154

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ T+ LG  LA        + L GDLG+GK+  +R  IR L H     V SPT+TL
Sbjct: 8   LADEQATVDLGLSLAKACERQTTIYLHGDLGAGKTTFSRGFIRALGHKG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+     V HFD YRL+  +E+  +G  D   N+ IC++EWPE G+ LLP+  ID+ 
Sbjct: 66  VEPYELPPWQVYHFDLYRLADPEELEFMGIRDYFTNDAICLVEWPEKGQGLLPEPDIDLE 125

Query: 131 LSQGKTGRKATISA 144
           L      R+ TI+A
Sbjct: 126 LRYQGEQRQVTITA 139


>gi|253690086|ref|YP_003019276.1| hypothetical protein PC1_3725 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756664|gb|ACT14740.1| protein of unknown function UPF0079 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 160

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (57%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ +P+E  TI LG  LA        + L GDLG+GK+  +R  ++   H     V SPT
Sbjct: 5   VLLLPDEAATISLGTALAKACDGACVIHLYGDLGAGKTTFSRGFLQARGHQG--NVKSPT 62

Query: 70  FTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  S + V HFD YRL+  +E+  +G  D +  + IC+IEWP+ G  +LP   I
Sbjct: 63  YTLVEPYALSPLAVYHFDLYRLADPEELEFMGIRDYLTQDAICLIEWPQQGAGVLPDADI 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL     GR+A +SA
Sbjct: 123 ELHLRYQDQGRQAELSA 139


>gi|262401565|ref|ZP_06078132.1| ATPase YjeE [Vibrio sp. RC586]
 gi|262352280|gb|EEZ01409.1| ATPase YjeE [Vibrio sp. RC586]
          Length = 154

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +  + +E+ TI LGR LA+I      L L GDLG+GK+  +R  IR L H+    V SPT
Sbjct: 5   IFSLKDEQATIELGRALAAICSQQTTLYLHGDLGAGKTTFSRGFIRALGHNG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           + LV+ Y      V HFD YRL+  +E+  +G  D    + IC++EWPE G  LLP   +
Sbjct: 63  YALVEPYQLGEWQVYHFDLYRLADPEELEFMGIRDYFSTDAICLVEWPEKGHGLLPHADL 122

Query: 128 DIHLSQGKTGRKATISA 144
           D+ L      R AT++A
Sbjct: 123 DLDLRYDGEQRIATLTA 139


>gi|50122858|ref|YP_052025.1| putative ATPase [Pectobacterium atrosepticum SCRI1043]
 gi|49613384|emb|CAG76835.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 160

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (57%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ +P+E  TI LG  LA        + L GDLG+GK+  +R  ++   H     V SPT
Sbjct: 5   VLLLPDEAATISLGTALAKACDGACVIHLYGDLGAGKTTFSRGFLQARGHQG--NVKSPT 62

Query: 70  FTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  S + V HFD YRL+  +E+  +G  D +  + IC+IEWP+ G  +LP   I
Sbjct: 63  YTLVEPYALSPLTVYHFDLYRLADPEELEFMGIRDYLTQDAICLIEWPQQGAGVLPDADI 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL     GR+A +SA
Sbjct: 123 ELHLRYQDEGRQAELSA 139


>gi|289577773|ref|YP_003476400.1| hypothetical protein Thit_0537 [Thermoanaerobacter italicus Ab9]
 gi|289527486|gb|ADD01838.1| protein of unknown function UPF0079 [Thermoanaerobacter italicus
           Ab9]
          Length = 153

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 73/122 (59%), Gaps = 3/122 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N   T+ LG  L  +LR  D + L GDLGSGK+   + I + L  ++   + SPTFTLV 
Sbjct: 9   NRDETVSLGEKLGKLLRSRDIILLYGDLGSGKTVFTKGIAKGLGINEP--ITSPTFTLVN 66

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            +   IP+ HFD YRL  +  + ++G++E   +E +C IEWPE    LLPK+ +++ + +
Sbjct: 67  EHRGRIPLYHFDLYRLDDYTALYDIGYEEYFYDEGVCAIEWPERLGPLLPKERLEVIIQK 126

Query: 134 GK 135
           G+
Sbjct: 127 GE 128


>gi|187776760|ref|ZP_02993233.1| hypothetical protein CLOSPO_00275 [Clostridium sporogenes ATCC
           15579]
 gi|187775419|gb|EDU39221.1| hypothetical protein CLOSPO_00275 [Clostridium sporogenes ATCC
           15579]
          Length = 164

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 78/130 (60%), Gaps = 7/130 (5%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           TI +G  + S    GD L L+GDLG+GK+ L++ I + L   D   + SPTF +V  YD 
Sbjct: 23  TIDIGNFIGSHCNSGDILCLNGDLGAGKTHLSKGIAKGLNIKD--NITSPTFNIVNEYDG 80

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLS----Q 133
            + + HFD YR++   E+  +GFDE I  E I IIEW +    L+P +++DI ++    +
Sbjct: 81  RLKLYHFDVYRVNDPDEIEAIGFDEYIFGEGISIIEWSDYIEDLIPNEHMDIRINKIPEK 140

Query: 134 GKTGRKATIS 143
           G++ RK TI+
Sbjct: 141 GESYRKVTIN 150


>gi|148260453|ref|YP_001234580.1| hypothetical protein Acry_1453 [Acidiphilium cryptum JF-5]
 gi|146402134|gb|ABQ30661.1| protein of unknown function UPF0079 [Acidiphilium cryptum JF-5]
          Length = 149

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 67/110 (60%), Gaps = 2/110 (1%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQE 95
           L LSG+LG+GKS  AR+ IR    D +L+V SP+FTLVQ Y+   PV HFD +RL+   +
Sbjct: 31  LLLSGNLGAGKSTFARAFIRARAGDASLDVPSPSFTLVQTYELDPPVTHFDLWRLTGPDD 90

Query: 96  VVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTG-RKATISA 144
           V ELG D  L   I +IEWP+    L P++ I + L  G+   R AT S 
Sbjct: 91  VAELGLDAALAG-IALIEWPDRLGPLAPREAITLALGWGEGNTRTATASG 139


>gi|294139252|ref|YP_003555230.1| hypothetical protein SVI_0481 [Shewanella violacea DSS12]
 gi|293325721|dbj|BAJ00452.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 152

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 82/132 (62%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE++T+ LG+ LA I+     L LSG+LG+GK+ L+R +I+ L H+ A  V SPT+ LV+
Sbjct: 10  NEQDTVDLGKRLAQIITPPLTLNLSGELGAGKTTLSRGLIQALGHEGA--VKSPTYALVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+   I + HFD YRLS  +E+  +G  D   ++ +C++EWP+ G  L+P   I + + 
Sbjct: 68  PYELDGIDLYHFDLYRLSDPEELEYMGIRDYFTDKSVCLVEWPDRGHGLMPVADISVDIK 127

Query: 133 QGKTGRKATISA 144
              T R+  +++
Sbjct: 128 YVGTSREVEMTS 139


>gi|258623495|ref|ZP_05718497.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258625640|ref|ZP_05720521.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|262172559|ref|ZP_06040237.1| ATPase YjeE [Vibrio mimicus MB-451]
 gi|258582095|gb|EEW06963.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258584207|gb|EEW08954.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|261893635|gb|EEY39621.1| ATPase YjeE [Vibrio mimicus MB-451]
          Length = 154

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +  + +E+ TI LG  LA+I      L L GDLG+GK+  +R  IR L H+    V SPT
Sbjct: 5   IFSLKDEQATIELGSALAAICSQQTTLYLHGDLGAGKTTFSRGFIRALGHNG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y      V HFD YRL+  +E+  +G  D    + IC++EWPE G  LLP   +
Sbjct: 63  YTLVEPYQLGEWQVYHFDLYRLADPEELEFMGIRDYFSADAICLVEWPEKGHGLLPHADL 122

Query: 128 DIHLSQGKTGRKATISA 144
           DI L      R AT++A
Sbjct: 123 DIDLRYDGEQRIATLTA 139


>gi|254283176|ref|ZP_04958144.1| uncharacterized P-loop hydrolase UPF0079 [gamma proteobacterium
           NOR51-B]
 gi|219679379|gb|EED35728.1| uncharacterized P-loop hydrolase UPF0079 [gamma proteobacterium
           NOR51-B]
          Length = 158

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 77/144 (53%), Gaps = 4/144 (2%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           MN        +P+ +E  TI LG  LA+ L+    + L GDLG+GK+ LAR ++R L H 
Sbjct: 1   MNRKTPSRISVPLADEAATIALGNALAASLKPPAVMYLEGDLGAGKTTLARGLLRGLGHV 60

Query: 61  DALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIG 118
            +  V SPT+TLV+ Y+    PV H D YRL   +E+  LG  D    E + +IEWPE G
Sbjct: 61  GS--VKSPTYTLVEPYELEQFPVYHCDLYRLGDPEELEYLGMRDYSSREGVLVIEWPERG 118

Query: 119 RSLLPKKYIDIHLSQGKTGRKATI 142
              LP   I + L     GR A I
Sbjct: 119 AHRLPAADIRVCLRPSGEGRVADI 142


>gi|297544060|ref|YP_003676362.1| hypothetical protein Tmath_0598 [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296841835|gb|ADH60351.1| protein of unknown function UPF0079 [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 153

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 73/122 (59%), Gaps = 3/122 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N   TI LG  L  +L+  D + L GDLGSGK+   + I + L  ++   + SPTFTLV 
Sbjct: 9   NRDETISLGEKLGRLLKRRDIILLYGDLGSGKTVFTKGIAKGLGINEP--ITSPTFTLVN 66

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            +   IP+ HFD YRL  +  + ++G++E   +E +C IEWPE    LLPK+ +++ + +
Sbjct: 67  EHKGRIPLYHFDLYRLDDYTALYDIGYEEYFYDEGVCAIEWPERLGPLLPKERLEVIIQK 126

Query: 134 GK 135
           G+
Sbjct: 127 GE 128


>gi|254486298|ref|ZP_05099503.1| uncharacterized P-loop hydrolase UPF0079 [Roseobacter sp. GAI101]
 gi|214043167|gb|EEB83805.1| uncharacterized P-loop hydrolase UPF0079 [Roseobacter sp. GAI101]
          Length = 158

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 84/149 (56%), Gaps = 7/149 (4%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           M  S + LT + + + + T    R L  +LR GD + L+GD+G+GK+  ARS+I+ L+  
Sbjct: 1   MRMSTQFLT-LSLTSPEQTTRTARDLGVVLRNGDTILLTGDVGAGKTHFARSLIQSLLTT 59

Query: 61  DALEVLSPTFTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGR 119
              +V SPTFTLVQ Y+     + H D YRLSS  EV ELG  +  +  IC++EWP+   
Sbjct: 60  PE-DVPSPTFTLVQTYETPQGQIWHADLYRLSSSIEVEELGLTDAFDTSICLVEWPDRLG 118

Query: 120 SLLPKKYIDIHL-SQGKTGRKATISAERW 147
           +L P   +D+   + G   R+ T    RW
Sbjct: 119 NLRPADALDLSFETTGDDTRRLTA---RW 144


>gi|261363940|ref|ZP_05976823.1| ATPase with strong ADP affinity [Neisseria mucosa ATCC 25996]
 gi|288567960|gb|EFC89520.1| ATPase with strong ADP affinity [Neisseria mucosa ATCC 25996]
          Length = 158

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 77/134 (57%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E++T+ LG   A  LR    + L GDLG+GK+   R I+R L H  A  V SPT+ +
Sbjct: 11  LPDEESTLKLGESWAKSLRAPLVIHLQGDLGAGKTTFTRGILRGLGHTGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y   +  + HFD YR +S +E  + G D++ + + +CIIEWP+ G +  P   I + 
Sbjct: 69  VESYPLEAFTLHHFDLYRFASPEEWEDAGLDDLFSPDSVCIIEWPQQGGAFTPPADITVS 128

Query: 131 LSQGKTGRKATISA 144
           L+    GR  T +A
Sbjct: 129 LNHAAQGRICTATA 142


>gi|332971519|gb|EGK10469.1| P-loop hydrolase/phosphotransferase [Kingella kingae ATCC 23330]
          Length = 151

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 73/133 (54%), Gaps = 3/133 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + NE  T+ LG   AS L     + L GDLG+GK+   R ++R + HD A  V SPT+ +
Sbjct: 7   LANESETLALGTSWASSLHAPLVVYLQGDLGAGKTTFTRGLLRGMGHDGA--VKSPTYAI 64

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           V+ Y  A   V HFD YR ++  E  + G D+++   IC+IEW E G   +P   + I L
Sbjct: 65  VESYPLAQQTVHHFDLYRFATPDEWEDAGLDDLIANSICLIEWAEQGGDYVPAPDLLIQL 124

Query: 132 SQGKTGRKATISA 144
           +  + GR  TI A
Sbjct: 125 THQENGRLCTIKA 137


>gi|237746876|ref|ZP_04577356.1| TriP hydrolase domain-containing protein [Oxalobacter formigenes
           HOxBLS]
 gi|229378227|gb|EEO28318.1| TriP hydrolase domain-containing protein [Oxalobacter formigenes
           HOxBLS]
          Length = 161

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 81/151 (53%), Gaps = 8/151 (5%)

Query: 7   HLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
           H     + NE +T  LG+ LA++L+ G  + L GDLG+GK+ L R++++   H    +V 
Sbjct: 2   HQKTFYLKNESDTCALGKSLAAVLKAGLKIYLHGDLGAGKTTLIRAMLKEAGHKG--KVK 59

Query: 67  SPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRS 120
           SPT+TLV+ Y     +  + + HFD YRL   +E +E GF E  NE+ IC IEW E    
Sbjct: 60  SPTYTLVEPYSIDLNNRPVDLLHFDLYRLGCPEEFLEAGFREHFNEKTICFIEWAEKADP 119

Query: 121 LLPKKYIDIHLSQGKTGRKATISAERWIISH 151
            LP   + I L     GR A + A     SH
Sbjct: 120 ELPPPDLVISLEVTGDGRTACLKASSDKGSH 150


>gi|126738531|ref|ZP_01754236.1| hypothetical protein RSK20926_08702 [Roseobacter sp. SK209-2-6]
 gi|126720330|gb|EBA17036.1| hypothetical protein RSK20926_08702 [Roseobacter sp. SK209-2-6]
          Length = 165

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 78/141 (55%), Gaps = 7/141 (4%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P   +T  L   ++  L  GDCL L G +G+GK+  AR++I+  +  +  +V SPTFTL
Sbjct: 10  LPTPDDTTTLASKISKSLSPGDCLLLEGPIGAGKTHFARALIQSRLGREE-DVPSPTFTL 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ YD     + H D YRL+S  E+ ELG  E +   IC+IEWP+      P   + + L
Sbjct: 69  VQCYDLPETELWHADLYRLTSLDEIEELGLSEAMETAICLIEWPDRLGEYWPNHALHLSL 128

Query: 132 S---QGKTGRKATI--SAERW 147
           S   Q +  R+ TI  S E+W
Sbjct: 129 SLVPQAEDARQITITFSDEKW 149


>gi|110677848|ref|YP_680855.1| hypothetical protein RD1_0456 [Roseobacter denitrificans OCh 114]
 gi|109453964|gb|ABG30169.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 158

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 79/145 (54%), Gaps = 3/145 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
            + + + + T  L   L   LR GD L L G +G+GK+  AR +I+ L+ +   +V SPT
Sbjct: 7   TVTVGSAEETAQLAVALGVRLRPGDTLLLDGAVGAGKTHFARHMIQSLLREPE-DVPSPT 65

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYID 128
           FTLVQ YD +S  + H D YRLSS  E+ ELG  E  +  IC+IEWP+    L P   + 
Sbjct: 66  FTLVQTYDTSSGSLWHADLYRLSSVYEIEELGLSEAFDTAICLIEWPDRLGQLTPNDALF 125

Query: 129 IHLSQGKTGRKATISAERWIISHIN 153
           +  +QG T     ++A RW     N
Sbjct: 126 LRFTQGATDDSRIVTA-RWTDPKWN 149


>gi|157964081|ref|YP_001498905.1| putative P-loop hydrolase [Rickettsia massiliae MTU5]
 gi|157843857|gb|ABV84358.1| Putative P-loop hydrolase [Rickettsia massiliae MTU5]
          Length = 177

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 77/119 (64%), Gaps = 4/119 (3%)

Query: 16  EKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQL 75
           E+ T  L + LA  L+  D + L+GDLG+GK+F  R II++   ++   ++SPTF L+Q 
Sbjct: 7   EEETKKLAKLLAQSLKPNDIVLLNGDLGAGKTFFCREIIKYFCGENT-SIISPTFNLLQT 65

Query: 76  YD--ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHL 131
           Y+  ++  + H+D YRL S +E+ ELGF+E +LN  + +IEW EI + LL    I+++L
Sbjct: 66  YNKASNFTIYHYDLYRLKSPEEIYELGFEEALLNGNLILIEWSEIIKHLLTPPLIEVNL 124


>gi|307265599|ref|ZP_07547153.1| protein of unknown function UPF0079 [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|326389641|ref|ZP_08211207.1| Uncharacterized protein family UPF0079, ATPase [Thermoanaerobacter
           ethanolicus JW 200]
 gi|306919397|gb|EFN49617.1| protein of unknown function UPF0079 [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|325994356|gb|EGD52782.1| Uncharacterized protein family UPF0079, ATPase [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 153

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 74/122 (60%), Gaps = 3/122 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N+  TI LG  L  +LR GD + L G+LGSGK+   + I + L  ++   + SPTFTLV 
Sbjct: 9   NKDETIALGEKLGRLLRSGDIILLYGELGSGKTVFTKGIAKGLEINEP--ITSPTFTLVN 66

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            +   I + HFD YRL  +  + ++G++E   +E +C IEWPE    LLPK+ +++ + +
Sbjct: 67  EHRGRISLYHFDLYRLDDYTALYDIGYEEYFYDEGVCAIEWPERLGPLLPKERLEVIIQK 126

Query: 134 GK 135
           G+
Sbjct: 127 GE 128


>gi|326387829|ref|ZP_08209435.1| hypothetical protein Y88_0743 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207875|gb|EGD58686.1| hypothetical protein Y88_0743 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 150

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 82/146 (56%), Gaps = 7/146 (4%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +T++ +P+   T  L   +A ++R GD + L G LG+GK+ LAR+I+  L H+   EV S
Sbjct: 1   MTIVELPDFAATDRLAAQIARLVRPGDVVALEGGLGAGKTTLARAILAALGHEG--EVPS 58

Query: 68  PTFTLVQLYDAS---IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE-IGRSLLP 123
           PTF ++++YD     +PV H DFYRL +  E  E+G +E     + + EWPE  G  +  
Sbjct: 59  PTFQIIEVYDPPTVRMPVVHADFYRLENPDETDEIGLEEYRQGAVLLAEWPENAGGFVHE 118

Query: 124 KKYIDIHLSQGKTGRKATISAER-WI 148
              + I +   + GR+A +   R W+
Sbjct: 119 PGCLSIRVEMAEKGRRAIVEPGRDWL 144


>gi|304317574|ref|YP_003852719.1| hypothetical protein Tthe_2158 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779076|gb|ADL69635.1| protein of unknown function UPF0079 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 152

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 83/144 (57%), Gaps = 11/144 (7%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           M+F  K     PI  EK    +G  L ++L+ G  + +SG+LG GK+ L + I + +  D
Sbjct: 3   MSFKTKS----PIETEK----IGFKLGNLLKRGSIVLISGELGVGKTVLTKGIAKGMGID 54

Query: 61  DALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGR 119
           D   V SPTF +V  +   IP+ HFD YR+  + E+ ++G++E    + +C+IEWPE  +
Sbjct: 55  DY--VTSPTFMIVNEHLGDIPLYHFDVYRIDDYTELYDIGYEEYFYGDGVCVIEWPEKIK 112

Query: 120 SLLPKKYIDIHLSQGKTGRKATIS 143
            L+PK+ I I ++ G T  + TI 
Sbjct: 113 PLIPKENIFIRMNMGDTFDERTIE 136


>gi|116749599|ref|YP_846286.1| hypothetical protein Sfum_2169 [Syntrophobacter fumaroxidans MPOB]
 gi|116698663|gb|ABK17851.1| protein of unknown function UPF0079 [Syntrophobacter fumaroxidans
           MPOB]
          Length = 167

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 14  PNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV 73
           P+E+ T  +GR +A +L  GD L L G+LG+GK+FLA +I   L    ++ + SPTFT +
Sbjct: 9   PSEECTCAIGRGIAELLEPGDVLALWGELGAGKTFLAGAIAHGLGVPVSVPITSPTFTFI 68

Query: 74  QLYDASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHL 131
             Y+  +P+AH D YRLS   ++  L + D +      +IEWPE   +LLP++  D+ +
Sbjct: 69  NEYEGRLPLAHIDLYRLSGPDDLDTLPWQDAVYGAAAAVIEWPERMGALLPEERWDLGI 127


>gi|158422335|ref|YP_001523627.1| hypothetical protein AZC_0711 [Azorhizobium caulinodans ORS 571]
 gi|158329224|dbj|BAF86709.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 517

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 54/144 (37%), Positives = 80/144 (55%), Gaps = 5/144 (3%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
           +T  L   L   L  GD + LSGDLG+GK+ LAR ++R L  D  LEV SPTF+LV  Y+
Sbjct: 24  DTAQLAATLTPWLSNGDVVALSGDLGAGKTALARFLVRALAGDPRLEVPSPTFSLVITYE 83

Query: 78  -ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS---- 132
                V H D YRL+  +E+ E+G+DE+  + I I+EWP+   S +P   +D+ L     
Sbjct: 84  FGRGKVTHADLYRLADPEELDEIGWDEMCEDGILIVEWPDRAGSHMPASRLDVALELAPD 143

Query: 133 QGKTGRKATISAERWIISHINQMN 156
            G   R+A +         ++++N
Sbjct: 144 LGPDARRALLVGSGAFAERLDRLN 167


>gi|154250590|ref|YP_001411414.1| hypothetical protein Plav_0134 [Parvibaculum lavamentivorans DS-1]
 gi|154154540|gb|ABS61757.1| protein of unknown function UPF0079 [Parvibaculum lavamentivorans
           DS-1]
          Length = 164

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/138 (39%), Positives = 80/138 (57%), Gaps = 8/138 (5%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIR--FLM 58
           M+   K +    +P+   T  LG  LA+ L  G  + L GDLG+GK+ LAR++++     
Sbjct: 1   MSEKTKAIHEFDLPDAAATARLGEALAARLEAGGLILLRGDLGAGKTTLARALVQAHLAS 60

Query: 59  HDDALEVLSPTFTLVQLYDASIP-VAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEI 117
           H  A EV SPTFTLVQ Y++ +  +AH D YR+    E+ ELG  E+L+E + ++EWPE 
Sbjct: 61  HGIAEEVPSPTFTLVQTYESPVLLIAHADLYRIEEPSELQELGLAEMLDEGVLLVEWPER 120

Query: 118 G----RSLLPKKYIDIHL 131
                R L P + +DI L
Sbjct: 121 AEEELRRLTPDR-LDISL 137


>gi|71908663|ref|YP_286250.1| hypothetical protein Daro_3050 [Dechloromonas aromatica RCB]
 gi|71848284|gb|AAZ47780.1| Protein of unknown function UPF0079 [Dechloromonas aromatica RCB]
          Length = 153

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 75/119 (63%), Gaps = 4/119 (3%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASI 80
           LG  LA +L  G  + L GDLG+GK+ L+R++IR L H   ++  SPT++LV++Y  +S+
Sbjct: 3   LGEALAPLLVPGLVIFLEGDLGAGKTTLSRAMIRALGHSGPVK--SPTYSLVEVYVISSL 60

Query: 81  PVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHLSQGKTGR 138
            + HFDFYR  S +E ++ GFDE  N+  +C++EWPE  +  +P   + + L     GR
Sbjct: 61  YLYHFDFYRFESPEEFLDAGFDEYFNDTSVCLVEWPEHAQGCVPSPDLRLRLHHAGVGR 119


>gi|254509330|ref|ZP_05121420.1| conserved hypothetical protein TIGR00150 [Vibrio parahaemolyticus
           16]
 gi|219547759|gb|EED24794.1| conserved hypothetical protein TIGR00150 [Vibrio parahaemolyticus
           16]
          Length = 157

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 76/134 (56%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ TI LG  LA +      + L GDLG+GK+  +R  +R L HD    V SPT+TL
Sbjct: 11  LKDEQATILLGTALAKLCSQQTTIYLHGDLGAGKTTFSRGFVRALGHDG--NVKSPTYTL 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y   +  V HFD YRL+  +E+  +G  D    + IC++EWPE G+ LLP   +DI 
Sbjct: 69  VEPYQLDAWQVYHFDLYRLADPEELEFMGIRDYFTPDAICLVEWPEKGQGLLPSADLDIE 128

Query: 131 LSQGKTGRKATISA 144
           L      R A ++A
Sbjct: 129 LRYNGEQRVAELTA 142


>gi|253701618|ref|YP_003022807.1| hypothetical protein GM21_3020 [Geobacter sp. M21]
 gi|251776468|gb|ACT19049.1| protein of unknown function UPF0079 [Geobacter sp. M21]
          Length = 153

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 72/130 (55%), Gaps = 1/130 (0%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T+ LG  L  +L   D + L G+LG+GK+  A+ I   L  D    V SPT+T++ +Y
Sbjct: 10  EETVELGARLGRLLEPADFVALVGELGAGKTQFAKGIALGLEVDPETPVTSPTYTILNIY 69

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQGK 135
              IP+ HFD YRL    EV +LGF+E  + +  C++EW E     +P++ + + LS   
Sbjct: 70  QGRIPLYHFDLYRLQGADEVADLGFEEYFSGDGACVVEWAERLEDEVPEELLTVELSHRG 129

Query: 136 TGRKATISAE 145
            GR  +  AE
Sbjct: 130 EGRCVSFRAE 139


>gi|220931044|ref|YP_002507952.1| conserved hypothetical nucleotide-binding protein TIGR00150
           [Halothermothrix orenii H 168]
 gi|219992354|gb|ACL68957.1| conserved hypothetical nucleotide-binding protein TIGR00150
           [Halothermothrix orenii H 168]
          Length = 158

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 76/131 (58%), Gaps = 5/131 (3%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
            T+ +G+    ++  G  + L+GDLG+GK+   R +   L  D+  +V SPT+ L+  YD
Sbjct: 15  ETLKIGKITGELVEPGQIILLAGDLGAGKTVFTRGLAEGLGVDE--DVTSPTYNLINEYD 72

Query: 78  ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKK--YIDIHLSQG 134
             +P+ H D YRL   +++ ++GF+E L+ E + +IEWP+I   ++P+   Y+ I  S  
Sbjct: 73  GDLPLFHMDLYRLEEEEDIYDIGFEEYLDREGVVVIEWPDIVYDVIPQDFIYVKIEKSNH 132

Query: 135 KTGRKATISAE 145
            T RK T  AE
Sbjct: 133 DTRRKLTFEAE 143


>gi|255067506|ref|ZP_05319361.1| ATPase with strong ADP affinity [Neisseria sicca ATCC 29256]
 gi|255048301|gb|EET43765.1| ATPase with strong ADP affinity [Neisseria sicca ATCC 29256]
          Length = 158

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 77/133 (57%), Gaps = 4/133 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E++T+ LG   A  LR    + L GDLG+GK+   R I+R L H  A  V SPT+ +
Sbjct: 11  LPDEESTLELGGSWAKSLRAPLVIHLQGDLGAGKTTFTRGILRGLGHTGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y   +  + HFD YR +S +E  + G D++ + + +CIIEWP+ G +  P   I + 
Sbjct: 69  VESYPLEAFTLHHFDLYRFASPEEWEDAGLDDLFSPDSVCIIEWPQQGGAFTPPADITVS 128

Query: 131 LSQGKTGRKATIS 143
           L+  + GR  T +
Sbjct: 129 LNHAEQGRTCTAT 141


>gi|51473226|ref|YP_066983.1| hypothetical protein RT0012 [Rickettsia typhi str. Wilmington]
 gi|81610847|sp|Q68XZ1|Y012_RICTY RecName: Full=UPF0079 ATP-binding protein RT0012
 gi|51459538|gb|AAU03501.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 144

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 78/139 (56%), Gaps = 3/139 (2%)

Query: 16  EKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQL 75
           EK T    +  A  L+  D + L+GDLG+GK+F  R II+     +   ++SPTF L+Q+
Sbjct: 7   EKETKNFAKLFAQNLKPNDIVLLNGDLGAGKTFFCREIIKHFCGKNT-NIISPTFNLLQI 65

Query: 76  YDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS-Q 133
           Y   +  + H+D YR+ S +E+ ELGF+E LN  + +IEW EI + LL    I+++L   
Sbjct: 66  YKTPNFNIYHYDMYRIKSPEEIYELGFEEALNGNLILIEWSEIIKHLLTPPLIEVNLKIL 125

Query: 134 GKTGRKATISAERWIISHI 152
               R  +I  E ++   +
Sbjct: 126 DNNKRLCSIKKENFLFDFL 144


>gi|148381263|ref|YP_001255804.1| hypothetical protein CBO3320 [Clostridium botulinum A str. ATCC
           3502]
 gi|153932769|ref|YP_001385639.1| hypothetical protein CLB_3378 [Clostridium botulinum A str. ATCC
           19397]
 gi|153937225|ref|YP_001389045.1| hypothetical protein CLC_3265 [Clostridium botulinum A str. Hall]
 gi|148290747|emb|CAL84878.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC
           3502]
 gi|152928813|gb|ABS34313.1| conserved hypothetical protein TIGR00150 [Clostridium botulinum A
           str. ATCC 19397]
 gi|152933139|gb|ABS38638.1| conserved hypothetical protein TIGR00150 [Clostridium botulinum A
           str. Hall]
          Length = 152

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/127 (40%), Positives = 77/127 (60%), Gaps = 11/127 (8%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           +GRH  S    GD L L+GDLG+GK+ L++ I + L   D   + SPTF +V  YD  + 
Sbjct: 18  IGRHCNS----GDILCLNGDLGAGKTHLSKGIAKGLNIKD--NITSPTFNIVNEYDGRLK 71

Query: 82  VAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLS----QGKT 136
           + HFD YR++   E+  +GFDE I  E I IIEW +    L+P ++IDI ++    +G++
Sbjct: 72  LYHFDVYRVNDPDEIEAIGFDEYIFGEGISIIEWSDYIEDLIPNEHIDIRINKIPEKGES 131

Query: 137 GRKATIS 143
            RK TI+
Sbjct: 132 YRKITIN 138


>gi|329297961|ref|ZP_08255297.1| ADP-binding protein [Plautia stali symbiont]
          Length = 158

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E  T+ LG  LA +      + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEAATLNLGAQLARVCSSAVVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y      + HFD YRL+  +E+  +G  D    + +C++EWP+ G  +LP+  +
Sbjct: 63  YTLVEPYQLGDRSLYHFDLYRLADPEELEFMGIRDYFSGDALCLVEWPQQGAGVLPEPDL 122

Query: 128 DIHLSQGKTGRKATISA 144
            + LS   + R+A ISA
Sbjct: 123 ALTLSYVASAREAEISA 139


>gi|261823155|ref|YP_003261261.1| ATPase [Pectobacterium wasabiae WPP163]
 gi|261607168|gb|ACX89654.1| protein of unknown function UPF0079 [Pectobacterium wasabiae
           WPP163]
          Length = 160

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (57%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ +P+E  TI LG  LA        + L GDLG+GK+  +R  ++   H     V SPT
Sbjct: 5   VLLLPDEAATISLGTALAKACDGACVIHLYGDLGAGKTTFSRGFLQARGHLG--NVKSPT 62

Query: 70  FTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  S + V HFD YRL+  +E+  +G  D +  + IC+IEWP+ G  +LP   I
Sbjct: 63  YTLVEPYALSPLSVYHFDLYRLADPEELEFMGIRDYLTQDAICLIEWPQQGAGVLPDADI 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HL     GR+A +SA
Sbjct: 123 ELHLRYQDEGRQAELSA 139


>gi|220934072|ref|YP_002512971.1| protein of unknown function UPF0079 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995382|gb|ACL71984.1| protein of unknown function UPF0079 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 156

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 79/135 (58%), Gaps = 5/135 (3%)

Query: 13  IPNEKNTICLGRHLA-SILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFT 71
           +P+E+  + LG  LA S    G  + L+GDLG+GK+ L R  +R L H  A  V SPT+T
Sbjct: 9   LPDEQAMMALGARLAASRPEGGRVVHLTGDLGAGKTTLTRGWLRALGHSGA--VKSPTYT 66

Query: 72  LVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDI 129
           LV+ Y  A   V HFD YRL+  +E+  LG D+  + + +C++EWPE G  +L    + I
Sbjct: 67  LVESYRLAGRDVHHFDLYRLADPEELDYLGLDDYFDGQALCLVEWPERGEGVLKTPDLAI 126

Query: 130 HLSQGKTGRKATISA 144
            L+    GR+A I A
Sbjct: 127 RLTVAGEGREARIEA 141


>gi|37681259|ref|NP_935868.1| ATPase or kinase [Vibrio vulnificus YJ016]
 gi|326423818|ref|NP_760218.2| ATPase YjeE [Vibrio vulnificus CMCP6]
 gi|37200010|dbj|BAC95839.1| predicted ATPase or kinase [Vibrio vulnificus YJ016]
 gi|319999185|gb|AAO09745.2| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Vibrio vulnificus CMCP6]
          Length = 187

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (55%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ TI LG  LA +      + L GDLG+GK+  +R  +R L H  A  V SPT+TL
Sbjct: 41  LKDEQATILLGTQLAHLCSQQTTIYLHGDLGAGKTTFSRGFVRALGH--AGNVKSPTYTL 98

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y  A   V HFD YRL+  +E+  +G  D    + IC++EWPE G  LLPK  +DI 
Sbjct: 99  VEPYQLADWQVYHFDLYRLADPEELEFMGIRDYFTADAICLVEWPEKGEGLLPKPDLDID 158

Query: 131 LSQGKTGRKATISA 144
           +      R A + A
Sbjct: 159 IRYQGEQRIAQVKA 172


>gi|157825182|ref|YP_001492902.1| hypothetical protein A1C_00305 [Rickettsia akari str. Hartford]
 gi|157799140|gb|ABV74394.1| hypothetical protein A1C_00305 [Rickettsia akari str. Hartford]
          Length = 171

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (60%), Gaps = 2/120 (1%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + NE  T  L +  A  L+  D + L+G+LG+GK+F  R II+     +   ++SPTF L
Sbjct: 4   LNNEAETKKLAKLFAQSLKPNDIVLLNGNLGAGKTFFCREIIKHFC-GETTSIISPTFNL 62

Query: 73  VQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           +Q Y AS   + H+D YRL S +E+ ELG +E LN  + +IEW EI + LL +  I+++L
Sbjct: 63  LQTYKASNFTIYHYDLYRLKSPEEIYELGLEEALNCNLILIEWSEIIKHLLSQPLIEVNL 122


>gi|15640370|ref|NP_229997.1| hypothetical protein VC0343 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|9654759|gb|AAF93516.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
          Length = 188

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 76/137 (55%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +  + +E+ TI LGR LA I      L L  DLG+GK+  +R  IR L H     V SPT
Sbjct: 39  IFSLKDEQATIELGRALALICSQQTTLYLHXDLGAGKTTFSRGFIRALGHQG--NVKSPT 96

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y   +  V HFD YRL+  +E+  +G  D    + IC++EWPE G  LLP   +
Sbjct: 97  YTLVEPYQLGMWQVYHFDLYRLADPEELEFMGIRDYFSADAICLVEWPEKGHGLLPNADL 156

Query: 128 DIHLSQGKTGRKATISA 144
           DI L      R AT++A
Sbjct: 157 DIDLRYDGDQRVATLTA 173


>gi|28899595|ref|NP_799200.1| putative nucleotide-binding protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153840362|ref|ZP_01993029.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|260361484|ref|ZP_05774535.1| conserved hypothetical protein [Vibrio parahaemolyticus K5030]
 gi|260876664|ref|ZP_05889019.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|260896643|ref|ZP_05905139.1| conserved hypothetical protein [Vibrio parahaemolyticus Peru-466]
 gi|260900903|ref|ZP_05909298.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ4037]
 gi|28807831|dbj|BAC61084.1| putative nucleotide-binding protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149745976|gb|EDM57106.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|308086317|gb|EFO36012.1| conserved hypothetical protein [Vibrio parahaemolyticus Peru-466]
 gi|308093976|gb|EFO43671.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|308106510|gb|EFO44050.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ4037]
 gi|308111303|gb|EFO48843.1| conserved hypothetical protein [Vibrio parahaemolyticus K5030]
 gi|328472279|gb|EGF43149.1| putative nucleotide-binding protein [Vibrio parahaemolyticus 10329]
          Length = 154

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 76/134 (56%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ T+ LG  LA +      + L GDLG+GK+  +R  +R L H     V SPT+TL
Sbjct: 8   LKDEQETVALGTELAQLCSQQTTIYLHGDLGAGKTTFSRGFVRALGHQG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      V HFD YRL+  +E+  +G  D   ++ IC++EWPE G+ LLP+  +D+ 
Sbjct: 66  VEPYQLDKWQVYHFDLYRLADPEELEFMGIRDYFTDDAICLVEWPEKGQGLLPQPDLDVE 125

Query: 131 LSQGKTGRKATISA 144
           +      R A I+A
Sbjct: 126 IRYQGEQRVAEITA 139


>gi|322831152|ref|YP_004211179.1| Uncharacterized protein family UPF0079, ATPase [Rahnella sp. Y9602]
 gi|321166353|gb|ADW72052.1| Uncharacterized protein family UPF0079, ATPase [Rahnella sp. Y9602]
          Length = 155

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 76/136 (55%), Gaps = 4/136 (2%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I +P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT+
Sbjct: 6   ISLPDEAATLQLGASLAKACEGSTVIHLYGDLGAGKTTFSRGFLQALGHQG--NVKSPTY 63

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYID 128
           TLV+ Y    I V HFD YRL+  +E+  +G  D    + IC++EWP+ G  +LP+  I+
Sbjct: 64  TLVEPYQLEKIAVYHFDLYRLADPEELEFMGIRDYFAQDAICLVEWPQQGAGVLPEPDIE 123

Query: 129 IHLSQGKTGRKATISA 144
           + L    TGR A + A
Sbjct: 124 LTLDYSLTGRTAKLVA 139


>gi|90416477|ref|ZP_01224408.1| hypothetical protein GB2207_04727 [marine gamma proteobacterium
           HTCC2207]
 gi|90331676|gb|EAS46904.1| hypothetical protein GB2207_04727 [marine gamma proteobacterium
           HTCC2207]
          Length = 180

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 80/128 (62%), Gaps = 5/128 (3%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASI-PVAHFDFYRLSSHQ 94
           + L GDLG+GK+ L+R ++  L H  A  V SPT+TLV+LY+ ++  V HFDFYRL   +
Sbjct: 49  IALQGDLGAGKTTLSRGLLTGLGHVGA--VKSPTYTLVELYELTLGQVCHFDFYRLQDPE 106

Query: 95  EVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAERWIISH-I 152
           E+  +GF D ++  ++C++EWPE G   LP+  + I + Q   GRK T++       + I
Sbjct: 107 ELEYMGFRDYLVESQLCLVEWPERGAGFLPEADMLIEIVQLAEGRKLTLNGRSEQAKNII 166

Query: 153 NQMNRSTS 160
           +Q++R  +
Sbjct: 167 SQLDREIT 174


>gi|119502788|ref|ZP_01624873.1| ATPase with strong ADP affinity [marine gamma proteobacterium
           HTCC2080]
 gi|119461134|gb|EAW42224.1| ATPase with strong ADP affinity [marine gamma proteobacterium
           HTCC2080]
          Length = 158

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 82/135 (60%), Gaps = 4/135 (2%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I +P+E++TI  G  LA + +    + LSG+LG+GK+ L+R  +R L H     V SPT+
Sbjct: 9   IDLPDEQSTIAFGGRLAQVCKPPLRIYLSGELGAGKTTLSRGFLRGLGHPG--NVKSPTY 66

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYID 128
           TLV+ Y+  S+ V HFD YR++  +E+  +GF D ++   + ++EW E G   LP+  + 
Sbjct: 67  TLVEPYEFDSVMVFHFDLYRVADPEELAYMGFEDYLMTPAVLLVEWAERGGDWLPQPDLL 126

Query: 129 IHLSQGKTGRKATIS 143
           +HLS    GR  ++S
Sbjct: 127 VHLSLTGGGRNLSLS 141


>gi|284006622|emb|CBA71883.1| ATP/GTP hydrolase [Arsenophonus nasoniae]
          Length = 152

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++ + NEK TI LG  LA + +    L L GDLG+GK+  +R  ++ L +     V SPT
Sbjct: 5   ILLLANEKATIALGHRLAHLCKQRFILYLYGDLGAGKTTFSRGFLQGLGYQG--HVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y     PV HFD YRL+  +E+  +G  +  + + IC++EWP+ G  +LP   +
Sbjct: 63  YTLVESYLLVPNPVYHFDLYRLTDPEELEFMGIRDYFDWQAICLVEWPKKGEGILPSADL 122

Query: 128 DIHLSQGKTGRKATISA 144
           +++LS    GR+A   A
Sbjct: 123 ELYLSYDNNGRQARFVA 139


>gi|300856961|ref|YP_003781945.1| putative ATPase [Clostridium ljungdahlii DSM 13528]
 gi|300437076|gb|ADK16843.1| putative ATPase [Clostridium ljungdahlii DSM 13528]
          Length = 151

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 77/132 (58%), Gaps = 7/132 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           ++TI LG+ + S+L  GD + L+GDLG+GK+   + I + L  DD   + SPTFT+V  Y
Sbjct: 9   EDTINLGKKIGSLLNAGDIICLNGDLGTGKTHFTKGIAKGLNIDDP--ITSPTFTIVNEY 66

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHL---- 131
              + + HFD YR++   E+ E+GFDE I ++ + IIEW      L+PK+ I + +    
Sbjct: 67  YGRLKLYHFDVYRVNDIDEIAEIGFDEYIFSDAVSIIEWANYIEELIPKECIWVSIYKLP 126

Query: 132 SQGKTGRKATIS 143
            +G   RK  I 
Sbjct: 127 EKGPNYRKIIIK 138


>gi|294084830|ref|YP_003551590.1| hypothetical protein SAR116_1263 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664405|gb|ADE39506.1| hypothetical protein SAR116_1263 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 165

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (56%), Gaps = 9/134 (6%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA--S 79
           LG+ L+  L  GD + L G LG+GKS LAR++I  L   +  ++ SPTFTLVQ YD    
Sbjct: 17  LGQFLSQGLAAGDVIALYGPLGAGKSALARALINRLCPYET-DIPSPTFTLVQTYDMPDG 75

Query: 80  IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL-----SQG 134
            P+ H D YR+ S  + +ELG ++ L +  C+IEWPE   +LLP   + I +     S  
Sbjct: 76  TPLWHLDLYRIESPDDAIELGIEDALLDAACLIEWPERLETLLPDSCLSIQINPVSASLD 135

Query: 135 KTGRKATISAE-RW 147
              R+  ISA  RW
Sbjct: 136 SQMRQVQISAPARW 149


>gi|254480906|ref|ZP_05094152.1| conserved hypothetical protein TIGR00150 [marine gamma
           proteobacterium HTCC2148]
 gi|41582284|gb|AAS07898.1| conserved hypothetical protein TIGR00150 [uncultured marine
           bacterium 463]
 gi|214038701|gb|EEB79362.1| conserved hypothetical protein TIGR00150 [marine gamma
           proteobacterium HTCC2148]
          Length = 157

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 75/132 (56%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E+  + LG  LA  L+ G  L L GDLG GK+ L+R I+R   H  A  V SPT+TLV+
Sbjct: 12  GEEAMVSLGNRLARALQPGSVLYLEGDLGMGKTTLSRGIVRGFGHSGA--VKSPTYTLVE 69

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+ A + + HFD YRL   +E+  +G  D    + IC++EWP  G  +LP   + I++ 
Sbjct: 70  PYELAELNLYHFDLYRLGDPEELEFMGIRDYFTGDSICLVEWPGRGLGILPPADLVINIE 129

Query: 133 QGKTGRKATISA 144
           +   GR+   +A
Sbjct: 130 RKGMGRQLAFNA 141


>gi|332298182|ref|YP_004440104.1| Uncharacterized protein family UPF0079, ATPase [Treponema
           brennaborense DSM 12168]
 gi|332181285|gb|AEE16973.1| Uncharacterized protein family UPF0079, ATPase [Treponema
           brennaborense DSM 12168]
          Length = 144

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 75/139 (53%), Gaps = 4/139 (2%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + TI LGR +   L+ G  L + G L +GK+ + + I   L    A  + SPTFTLV  Y
Sbjct: 9   EETIALGRRIGKKLKPGAVLAMEGTLAAGKTTITKGIAESL--GVAETITSPTFTLVSEY 66

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQGK 135
           + ++P+ H D YRL S ++ + LG +++L  + +CIIEW E  R  LP   I + L    
Sbjct: 67  EGNVPLYHMDVYRLDSAEDFLNLGVEDMLYGKGVCIIEWSEKVRKELPTTTITVRLEADD 126

Query: 136 TGRKATISAERWIISHINQ 154
            G + TI+ E W    I +
Sbjct: 127 DGAR-TITVENWPYGDITE 144


>gi|226941423|ref|YP_002796497.1| P-loop hydrolase [Laribacter hongkongensis HLHK9]
 gi|226716350|gb|ACO75488.1| Uncharacterized P-loop hydrolase UPF0079 [Laribacter hongkongensis
           HLHK9]
          Length = 154

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 82/143 (57%), Gaps = 5/143 (3%)

Query: 5   EKHLTV-IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDAL 63
           + H T+ + + +E  T+  G  LAS L  G  + L GDLG+GK+ L R I+R   H  A 
Sbjct: 2   DTHTTLTVGLADEAATLAFGEALASRLVPGMTVFLEGDLGAGKTTLTRGILRGFGH--AG 59

Query: 64  EVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSL 121
            V SPT+ LV+ Y+   + V HFD YR +  +E V+ GF ++ +   + +IEWPE   +L
Sbjct: 60  RVKSPTYALVESYELPQLAVHHFDLYRFADPEEWVDAGFRDLFDAGSLALIEWPEKALAL 119

Query: 122 LPKKYIDIHLSQGKTGRKATISA 144
           LP   + + L     GR+AT++A
Sbjct: 120 LPAPDLTLTLHPDGPGRQATLTA 142


>gi|153938131|ref|YP_001392666.1| hypothetical protein CLI_3493 [Clostridium botulinum F str.
           Langeland]
 gi|152934027|gb|ABS39525.1| conserved hypothetical protein TIGR00150 [Clostridium botulinum F
           str. Langeland]
 gi|295320650|gb|ADG01028.1| conserved hypothetical protein TIGR00150 [Clostridium botulinum F
           str. 230613]
 gi|322807628|emb|CBZ05203.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Clostridium botulinum H04402 065]
          Length = 152

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 77/127 (60%), Gaps = 11/127 (8%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           +GRH  S    GD L L+GDLG+GK+ L++ I + L   D   + SPTF +V  YD  + 
Sbjct: 18  IGRHCNS----GDILCLNGDLGAGKTHLSKGIAKGLNIKD--NITSPTFNIVNEYDGRLK 71

Query: 82  VAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLS----QGKT 136
           + HFD YR++   E+  +GFDE I  E I IIEW +    L+P +++DI ++    +G++
Sbjct: 72  LYHFDVYRVNDPDEIEAIGFDEYIFGEGISIIEWSDYIEDLIPNEHMDIRINKIPEKGES 131

Query: 137 GRKATIS 143
            RK TI+
Sbjct: 132 YRKITIN 138


>gi|326203852|ref|ZP_08193714.1| Uncharacterized protein family UPF0079, ATPase [Clostridium
           papyrosolvens DSM 2782]
 gi|325985950|gb|EGD46784.1| Uncharacterized protein family UPF0079, ATPase [Clostridium
           papyrosolvens DSM 2782]
          Length = 150

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 76/131 (58%), Gaps = 7/131 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T+ +G  L  +L+ GD + LSGDLG+GK+ L   I + L  D    + SPTF LV  Y
Sbjct: 10  EETVEVGLKLGKVLKAGDVIWLSGDLGTGKTALTNGIAKALGIDAY--ITSPTFNLVNEY 67

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDI----HL 131
           +  +P+ HFD YR++  +E+ ++GFDE LN   + +IEW E    +LP   I +    +L
Sbjct: 68  EGRLPLYHFDVYRIADSEEMFDIGFDEYLNNGGVTVIEWGEQISEILPADIIRVTIEKNL 127

Query: 132 SQGKTGRKATI 142
            +G   R+ TI
Sbjct: 128 QKGLDVREITI 138


>gi|168179031|ref|ZP_02613695.1| conserved hypothetical protein TIGR00150 [Clostridium botulinum
           NCTC 2916]
 gi|226950746|ref|YP_002805837.1| hypothetical protein CLM_3756 [Clostridium botulinum A2 str. Kyoto]
 gi|182670216|gb|EDT82192.1| conserved hypothetical protein TIGR00150 [Clostridium botulinum
           NCTC 2916]
 gi|226844189|gb|ACO86855.1| conserved hypothetical protein TIGR00150 [Clostridium botulinum A2
           str. Kyoto]
          Length = 152

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 77/127 (60%), Gaps = 11/127 (8%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           +GRH  S    GD L L+GDLG+GK+ L++ I + L   D   + SPTF +V  YD  + 
Sbjct: 18  IGRHCNS----GDILCLNGDLGAGKTHLSKGIAKGLNIKD--NITSPTFNIVNEYDGRLK 71

Query: 82  VAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLS----QGKT 136
           + HFD YR++   E+  +GFDE I  E I IIEW +    L+P +++DI ++    +G++
Sbjct: 72  LYHFDVYRVNDPDEIEAIGFDEYIFGEGISIIEWSDYIEDLIPNEHMDIRINKIPEKGES 131

Query: 137 GRKATIS 143
            RK TI+
Sbjct: 132 YRKITIN 138


>gi|88858900|ref|ZP_01133541.1| hypothetical protein PTD2_07849 [Pseudoalteromonas tunicata D2]
 gi|88819126|gb|EAR28940.1| hypothetical protein PTD2_07849 [Pseudoalteromonas tunicata D2]
          Length = 149

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 78/132 (59%), Gaps = 4/132 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + NE  T+ +G  LA +++ G  + L GDLG+GK+ L R II+   H    +V SPT+T+
Sbjct: 6   LENELATVAMGNALAEVIKSGAVIFLHGDLGAGKTTLTRGIIQGFGHQG--KVKSPTYTI 63

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+ A+  + HFD YRL+  +E+  +G  D   +  IC+IEWPE G  LL +  +DI 
Sbjct: 64  VEPYELAAQQIYHFDLYRLADPEELEFMGIRDYFASNAICLIEWPEKGGMLLAEPDLDIT 123

Query: 131 LSQGKTGRKATI 142
           L      RK +I
Sbjct: 124 LEYVDEQRKISI 135


>gi|253991557|ref|YP_003042913.1| hypothetical protein PAU_04084 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638435|emb|CAR67057.1| Conserved Hypothetical Protein [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253783007|emb|CAQ86172.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 154

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 77/134 (57%), Gaps = 6/134 (4%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ + +E  T+ LG  +A     G  + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VLSLQDEDATVSLGSAVAVACNRGSVIYLYGDLGAGKTTFSRGFLQSLGHKG--HVKSPT 62

Query: 70  FTLVQLYDASIP--VAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKY 126
           +TLV+ Y A IP  V HFD YRL+  +E+  +G  D    + IC++EWP+ G  +LP   
Sbjct: 63  YTLVEPY-ALIPRPVYHFDLYRLADPEELEFMGIRDYFHQDAICLVEWPQQGEGVLPDAD 121

Query: 127 IDIHLSQGKTGRKA 140
           I +HLS    GR+A
Sbjct: 122 IKLHLSYQSEGRQA 135


>gi|168182055|ref|ZP_02616719.1| ATPase, YjeE family [Clostridium botulinum Bf]
 gi|237796760|ref|YP_002864312.1| hypothetical protein CLJ_B3602 [Clostridium botulinum Ba4 str. 657]
 gi|182674899|gb|EDT86860.1| ATPase, YjeE family [Clostridium botulinum Bf]
 gi|229263366|gb|ACQ54399.1| conserved hypothetical protein TIGR00150 [Clostridium botulinum Ba4
           str. 657]
          Length = 152

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 76/127 (59%), Gaps = 11/127 (8%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           +GRH  S    GD L L+GDLG+GK+ L++ I + L   D   + SPTF +V  YD  + 
Sbjct: 18  IGRHCNS----GDILCLNGDLGAGKTHLSKGIAKGLNIKD--NITSPTFNIVNEYDGRLK 71

Query: 82  VAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLS----QGKT 136
           + HFD YR++   E+  +GFDE I  E I IIEW +    L+P +++DI ++    +G+ 
Sbjct: 72  LYHFDVYRVNDPDEIEAIGFDEYIFGEGISIIEWSDYIEDLIPNEHMDIRINKIPEKGEN 131

Query: 137 GRKATIS 143
            RK TI+
Sbjct: 132 YRKITIN 138


>gi|260431942|ref|ZP_05785913.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415770|gb|EEX09029.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 156

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 75/135 (55%), Gaps = 5/135 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+ +NT  L   LA  L  GD + L G +GSGK+  ARS+I+  + +   +V SPTFTL
Sbjct: 9   LPSPENTARLAVDLAGRLEPGDVILLDGPIGSGKTHFARSLIQASLPEPE-DVPSPTFTL 67

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIH- 130
           +Q+YD  S  + H D YRL+S  EV ELG  E      C++EWPE    L P   + +  
Sbjct: 68  IQVYDTGSHEIWHADLYRLTSQDEVEELGLVEAFETAACVVEWPEKLGDLRPATALTVQF 127

Query: 131 --LSQGKTGRKATIS 143
             L   +  R+ T++
Sbjct: 128 QTLPDAEDARQLTLT 142


>gi|241667345|ref|ZP_04754923.1| hypothetical protein FphipA2_01155 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254875896|ref|ZP_05248606.1| nucleotide-binding protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254841917|gb|EET20331.1| nucleotide-binding protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 136

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 76/135 (56%), Gaps = 4/135 (2%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +  I + +EK      +  A  L+ G  + L GDLG+GK+   + +++ L +     V S
Sbjct: 1   MKSIIVKSEKQMFEFAQEYAKKLQAGQIIYLHGDLGAGKTTFVKGVLKSLGYKG--NVKS 58

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+  +  + HFD YRL+  +E+  +G  + LN+  IC +EWPE GR  LPK 
Sbjct: 59  PTYTLVESYEFDNFNIYHFDLYRLADPEELEWIGIRDYLNDNSICFVEWPEKGRGFLPKN 118

Query: 126 YIDIHLSQGKTGRKA 140
            IDI++     GR+ 
Sbjct: 119 SIDIYIKYLSEGRQV 133


>gi|170754550|ref|YP_001782944.1| hypothetical protein CLD_1201 [Clostridium botulinum B1 str. Okra]
 gi|170758663|ref|YP_001788636.1| hypothetical protein CLK_2737 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169119762|gb|ACA43598.1| conserved hypothetical protein TIGR00150 [Clostridium botulinum B1
           str. Okra]
 gi|169405652|gb|ACA54063.1| conserved hypothetical protein TIGR00150 [Clostridium botulinum A3
           str. Loch Maree]
          Length = 152

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 76/127 (59%), Gaps = 11/127 (8%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           +GRH  S    GD L L+GDLG+GK+ L++ I + L   D   + SPTF +V  YD  + 
Sbjct: 18  IGRHCNS----GDILCLNGDLGAGKTHLSKGIAKGLNIKD--NITSPTFNIVNEYDGRLK 71

Query: 82  VAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLS----QGKT 136
           + HFD YR++   E+  +GFDE I  E I IIEW +    L+P +++DI ++    +G+ 
Sbjct: 72  LYHFDVYRVNDPDEIEAIGFDEYIFGEGISIIEWSDYIEDLIPNEHMDIRINKIPEKGEN 131

Query: 137 GRKATIS 143
            RK TI+
Sbjct: 132 YRKITIN 138


>gi|163732942|ref|ZP_02140386.1| hypothetical protein RLO149_09790 [Roseobacter litoralis Och 149]
 gi|161393477|gb|EDQ17802.1| hypothetical protein RLO149_09790 [Roseobacter litoralis Och 149]
          Length = 158

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 76/140 (54%), Gaps = 2/140 (1%)

Query: 7   HLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
           H     + + + T      L ++LR GD + L G +G+GK+  AR +I+ L+ D A +V 
Sbjct: 4   HTCSFTVGSAEQTAQRAVALGALLRPGDTILLDGVVGAGKTHFARHLIQSLL-DVAEDVP 62

Query: 67  SPTFTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKK 125
           SPTFTLVQ YD  S  + H D YRLSS  E+ ELG  E     IC+IEWP+    L P  
Sbjct: 63  SPTFTLVQTYDTRSGSLWHADLYRLSSVFEIEELGLTEAFETAICLIEWPDRLAQLTPND 122

Query: 126 YIDIHLSQGKTGRKATISAE 145
            + I  +QG      T++ +
Sbjct: 123 AMTIRFAQGAPENSRTLTVD 142


>gi|83942006|ref|ZP_00954468.1| hypothetical protein EE36_07218 [Sulfitobacter sp. EE-36]
 gi|83847826|gb|EAP85701.1| hypothetical protein EE36_07218 [Sulfitobacter sp. EE-36]
          Length = 156

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 82/132 (62%), Gaps = 9/132 (6%)

Query: 20  ICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA- 78
           + LGR L +    GD + L+GD+G+GK+  AR++I+ L+     +V SPTFTLVQ YDA 
Sbjct: 21  VTLGRALTA----GDVVLLTGDVGAGKTHFARALIQSLLAVPE-DVPSPTFTLVQTYDAP 75

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS-QGKTG 137
           +  + H D YRL+S  E+ ELG  +  ++ IC++EWP+    L P+  +D+ L+  G   
Sbjct: 76  AAAIWHADLYRLTSVYEIEELGLTDAFSDAICLVEWPDRLGDLRPEDALDLTLTVTGDDT 135

Query: 138 RK--ATISAERW 147
           R+  AT + ++W
Sbjct: 136 RRLSATWNDDKW 147


>gi|241758640|ref|ZP_04756754.1| conserved hypothetical protein [Neisseria flavescens SK114]
 gi|241321151|gb|EER57347.1| conserved hypothetical protein [Neisseria flavescens SK114]
          Length = 156

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 79/148 (53%), Gaps = 10/148 (6%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E+ T+ LG+  +  L     + L G LG+GK+ L R I+R L H  A  V SPT+T+
Sbjct: 11  LPDEEATLKLGKEWSKQLSAPLTIYLEGGLGAGKTTLTRGILRGLGHTGA--VKSPTYTI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y   +  + HFD YR +  +E  + G DE+   + +C+IEWP+ G    P   I I 
Sbjct: 69  VESYPLDTFTLHHFDLYRFTMPEEWEDAGLDELFAPDSVCLIEWPQQGGEFTPPADITIT 128

Query: 131 LSQGKTGRKATISAERWIISHINQMNRS 158
           L+    GR  T SA      H NQ  +S
Sbjct: 129 LTYTDKGRTCTFSA------HTNQGRKS 150


>gi|312144183|ref|YP_003995629.1| Uncharacterized protein family UPF0079, ATPase [Halanaerobium sp.
           'sapolanicus']
 gi|311904834|gb|ADQ15275.1| Uncharacterized protein family UPF0079, ATPase [Halanaerobium sp.
           'sapolanicus']
          Length = 161

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 76/122 (62%), Gaps = 3/122 (2%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
             + +A+ +     + L G+LGSGK+ +A+ I   L ++   EV SPTF LVQ Y  ++ 
Sbjct: 19  FAQKIAAYIEPPVLILLKGELGSGKTLIAQGIASALGYEK--EVTSPTFNLVQEYQGALE 76

Query: 82  VAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKA 140
           + H D YRL+  +E++E+GF++ LN + + +IEWPEI  SL+P  +I I +++  + ++ 
Sbjct: 77  IIHMDLYRLNKSEELIEIGFEDYLNRDAVILIEWPEIALSLIPADFIFIEINKITSNKRE 136

Query: 141 TI 142
            I
Sbjct: 137 II 138


>gi|303275708|ref|XP_003057148.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226461500|gb|EEH58793.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 280

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 72/144 (50%), Gaps = 18/144 (12%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +++ T  + R LA+  R GD + L GD+G+GKS  +R+ +R +  D  LEV SPT+ L Q
Sbjct: 66  SQRATEKVARMLAASARAGDVICLHGDVGAGKSVFSRAYVRAVAEDARLEVPSPTYLLQQ 125

Query: 75  LYDASI----------------PVAHFDFYRLSSH--QEVVELGFDEILNERICIIEWPE 116
           +YDA                  PV HFD YR+     +    LG      E  C++EW E
Sbjct: 126 VYDAHCERDAKNPKKLAKTSRPPVHHFDLYRVDDDPARAAKRLGLKTSFAEAACVVEWAE 185

Query: 117 IGRSLLPKKYIDIHLSQGKTGRKA 140
             R L P   +D+++S     RKA
Sbjct: 186 RLRHLAPAHRLDVYVSMTSGARKA 209


>gi|304414427|ref|ZP_07395696.1| putative ATPase [Candidatus Regiella insecticola LSR1]
 gi|304283212|gb|EFL91612.1| putative ATPase [Candidatus Regiella insecticola LSR1]
          Length = 168

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 81/135 (60%), Gaps = 4/135 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI + +E  T  LG  +A        + L GDLG+GK+  +R  +R L +D   +V SPT
Sbjct: 12  VISLLDEAATAALGASMARACSSASIVYLLGDLGTGKTTFSRGFLRALGYDG--KVKSPT 69

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  +   V HFD YRL+  +E+  +G  +  +++ IC++EWP+ G  +LPK  I
Sbjct: 70  YTLVEPYILTPRTVYHFDLYRLADAEELEFMGIRDYFDQQAICLVEWPQRGAGILPKADI 129

Query: 128 DIHLSQGKTGRKATI 142
           +++L+  + GR+A +
Sbjct: 130 ELYLTYNQQGRQAQL 144


>gi|168705133|ref|ZP_02737410.1| hypothetical protein GobsU_36709 [Gemmata obscuriglobus UQM 2246]
          Length = 157

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 66/112 (58%), Gaps = 1/112 (0%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           T   GR L ++L  G  + L G +G+GK+ L R+I   L   +   V SPTF L+Q Y A
Sbjct: 13  TEAFGRKLGTLLFPGAVVALVGQMGAGKTHLTRAIAEGLSVKNPAAVNSPTFVLIQEYPA 72

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDI 129
            +P+ HFD YRLS   E  ELG DE L  + +C+IEW +   + LP++++ +
Sbjct: 73  RLPIYHFDTYRLSGPTEFAELGADEYLRGDGVCVIEWADKVETALPREHLRV 124


>gi|302849624|ref|XP_002956341.1| hypothetical protein VOLCADRAFT_119353 [Volvox carteri f.
           nagariensis]
 gi|300258247|gb|EFJ42485.1| hypothetical protein VOLCADRAFT_119353 [Volvox carteri f.
           nagariensis]
          Length = 245

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 58/98 (59%), Gaps = 2/98 (2%)

Query: 21  CLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD--A 78
           CL    AS +R GDC  L G +G+GKS  +R+ IR +  DD L V SPTF L   YD   
Sbjct: 3   CLAALFASHIRPGDCYCLFGAVGAGKSVFSRAFIRAVAEDDFLPVPSPTFLLQNTYDEHQ 62

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
             P+ HFDFYRL+S Q+   L  +  L   +C++EWPE
Sbjct: 63  GPPIHHFDFYRLTSVQDFNRLDLEGSLTRAVCLMEWPE 100


>gi|188585038|ref|YP_001916583.1| protein of unknown function UPF0079 [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179349725|gb|ACB83995.1| protein of unknown function UPF0079 [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 160

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 75/130 (57%), Gaps = 6/130 (4%)

Query: 16  EKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQL 75
           E+ TI +   LA++L  GD + L+GDLG+GK+   + I + L  D+   V SP+FTL+  
Sbjct: 8   ERQTISIAEQLAALLGPGDIVLLTGDLGAGKTTFTKGIAQGLDIDEP--VTSPSFTLMNQ 65

Query: 76  YDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQG 134
           Y  SIP+ HFD YR+   +E +ELG +E L  + I ++EW E     LP  Y+ + L  G
Sbjct: 66  YSGSIPLYHFDLYRIEDPEEFLELGIEEFLYGKGISVVEWSE-KLPELPNSYLQVSLKLG 124

Query: 135 K--TGRKATI 142
               GR+  I
Sbjct: 125 ADPEGRQIII 134


>gi|159471652|ref|XP_001693970.1| predicted protein [Chlamydomonas reinhardtii]
 gi|158277137|gb|EDP02906.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 103

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 58/98 (59%), Gaps = 2/98 (2%)

Query: 21  CLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD--A 78
           CL    AS +R GDC  L G +G+GKS  +RS IR +  DD L V SPTF L   YD   
Sbjct: 4   CLAALFASHIRAGDCYCLFGAVGAGKSVFSRSFIRAVAEDDFLPVPSPTFLLQNTYDEHQ 63

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
             P+ HFDFYRL+S Q+   L  +  L   +C++EWPE
Sbjct: 64  GPPIHHFDFYRLASVQDFNRLDLEGSLTRAVCLMEWPE 101


>gi|300715036|ref|YP_003739839.1| conserved uncharacterized protein YjeE [Erwinia billingiae Eb661]
 gi|299060872|emb|CAX57979.1| conserved uncharacterized protein YjeE [Erwinia billingiae Eb661]
          Length = 158

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 78/139 (56%), Gaps = 8/139 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI + +E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIALSDEAATLTLGASLARACHGAAMIYLFGDLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYDASIP---VAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKK 125
           +TLV+ Y  S+P   V HFD YRL+  +E+  +G  D    + +C++EWP+ G   LP  
Sbjct: 63  YTLVEPY--SLPDRQVYHFDLYRLADPEELEFMGIRDYFGGDSVCLVEWPQQGAGFLPVP 120

Query: 126 YIDIHLSQGKTGRKATISA 144
            I++HLS   T R+A + A
Sbjct: 121 DIELHLSYQGTARQAELKA 139


>gi|149177977|ref|ZP_01856574.1| hypothetical protein PM8797T_32200 [Planctomyces maris DSM 8797]
 gi|148843170|gb|EDL57536.1| hypothetical protein PM8797T_32200 [Planctomyces maris DSM 8797]
          Length = 160

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 73/118 (61%), Gaps = 2/118 (1%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E +T  LG+ LA  L  G  + L+G+LG+GK+ L ++I   L  D A EV SPTF L+Q
Sbjct: 13  SELDTQRLGKKLAEYLTPGTVIALNGNLGAGKTRLVQAIATALDVDPA-EVTSPTFVLIQ 71

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL 131
            Y   +P+ HFD YRL    E +ELG D++L +  +C+IEW +  R +LP   + I++
Sbjct: 72  EYQGRLPLYHFDTYRLRDTDEFLELGADDLLYSNGVCLIEWADKVRDVLPGDLLQINI 129


>gi|146283984|ref|YP_001174137.1| ATPase or kinase [Pseudomonas stutzeri A1501]
 gi|145572189|gb|ABP81295.1| predicted ATPase or kinase [Pseudomonas stutzeri A1501]
 gi|327482311|gb|AEA85621.1| ATPase or kinase [Pseudomonas stutzeri DSM 4166]
          Length = 156

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 9/143 (6%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E   + LG  +A +      + L GDLG+GK+ L+R +IR   H+   +V SPTFTLV+
Sbjct: 10  DEAAMLALGARIARVTGGRGVIYLHGDLGAGKTTLSRGLIRGFGHEG--KVKSPTFTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+   + V HFD YRL   +E+  LG  D      +C+IEWPE G  +LPK  +DI ++
Sbjct: 68  PYELGEVQVFHFDLYRLVDPEELEFLGIRDYFEGNALCLIEWPERGAGILPKADMDITIT 127

Query: 133 QGKTGRKATIS-----AERWIIS 150
             + GR   +S      E W ++
Sbjct: 128 PHEAGRTLRLSPHTARGEAWCVA 150


>gi|157826467|ref|YP_001495531.1| putative P-loop hydrolase [Rickettsia bellii OSU 85-389]
 gi|157801771|gb|ABV78494.1| Putative P-loop hydrolase [Rickettsia bellii OSU 85-389]
          Length = 142

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 71/117 (60%), Gaps = 2/117 (1%)

Query: 16  EKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQL 75
           E+ T    +  A+ L+  + + L+GDLG GK+F  R II++   ++   ++SPTF L+Q 
Sbjct: 11  EEETKNFAKAFAATLKPNNIVLLNGDLGVGKTFFCREIIKYFCGENT-SIISPTFNLLQT 69

Query: 76  YDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           Y      + H+D YRL S +E+ ELG +E L+  + +IEW EI + LLP   I+++L
Sbjct: 70  YKTPHFTIYHYDLYRLKSPEEIYELGLEEALSGNLTLIEWSEIIKHLLPTPLIEVNL 126


>gi|294634449|ref|ZP_06712985.1| ATPase with strong ADP affinity [Edwardsiella tarda ATCC 23685]
 gi|291092159|gb|EFE24720.1| ATPase with strong ADP affinity [Edwardsiella tarda ATCC 23685]
          Length = 154

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ +P+E  TI LG  LA        + L GDLG+GK+  +R  ++ L H   ++  SPT
Sbjct: 5   VLQLPDEAATIALGDALARACHSATVIYLYGDLGAGKTTFSRGFLQALGHQGTVK--SPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  +  PV HFD YRL+  +E+  +G  D    + + ++EWP+ G   LP+  I
Sbjct: 63  YTLVEPYLLTPRPVYHFDLYRLADPEELEFMGIRDYFAQDALLLVEWPQQGMGFLPEPDI 122

Query: 128 DIHLSQGKTGRKATISA 144
            +HL+     R+A I A
Sbjct: 123 TLHLTYSGDARQAVIEA 139


>gi|170750931|ref|YP_001757191.1| hypothetical protein Mrad2831_4542 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170657453|gb|ACB26508.1| protein of unknown function UPF0079 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 529

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 54/106 (50%), Positives = 66/106 (62%), Gaps = 2/106 (1%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P E  T  LG  L+  L  GD + LSG LG GK+ LAR+IIR L  D  LEV SPTFTL
Sbjct: 28  LPEETATEDLGLFLSEFLMPGDVVALSGGLGGGKTTLARAIIRELAGDARLEVPSPTFTL 87

Query: 73  VQLYDA--SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           +Q Y A    P+ H D YRL    E+VELGFDE+    I ++EWP+
Sbjct: 88  IQPYAARDGRPIVHADLYRLRDPDELVELGFDEMAEGAITLVEWPD 133


>gi|120555684|ref|YP_960035.1| hypothetical protein Maqu_2773 [Marinobacter aquaeolei VT8]
 gi|120325533|gb|ABM19848.1| protein of unknown function UPF0079 [Marinobacter aquaeolei VT8]
          Length = 165

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 78/135 (57%), Gaps = 7/135 (5%)

Query: 15  NEKNTICLGRHLASIL---RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFT 71
           +E  T  LG  LA +    R G  + L G+LG GK+ L+R ++R L H+ A  V SPT+T
Sbjct: 14  DEAETEKLGGELARLASHAREGLTVFLDGELGMGKTTLSRGVMRGLGHEGA--VKSPTYT 71

Query: 72  LVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDI 129
           LV+ Y+    PV HFD YRL   +E+  +G  D   ++ I IIEWPE G+ +LP   ++I
Sbjct: 72  LVEPYEHLEPPVYHFDLYRLGDPEELEYMGIRDYFASQSIRIIEWPERGQGVLPDPDLEI 131

Query: 130 HLSQGKTGRKATISA 144
           HL +   GR   + A
Sbjct: 132 HLEREGQGRSVVLRA 146


>gi|54310434|ref|YP_131454.1| putative nucleotide-binding protein [Photobacterium profundum SS9]
 gi|46914875|emb|CAG21652.1| putative nucleotide-binding protein [Photobacterium profundum SS9]
          Length = 154

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 77/134 (57%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ T+ LG  LA        + L GDLG+GK+  +R  IR L H     V SPT+TL
Sbjct: 8   LADEQATVDLGLCLAKACERQTTIYLHGDLGAGKTTFSRGFIRALGHKG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+     V HFD YRL+  +E+  +G  D   ++ IC++EWPE G+ LLP+  +D+ 
Sbjct: 66  VEPYELPPWQVYHFDLYRLADPEELEFMGIRDYFTDDAICLVEWPEKGQGLLPEPDLDLE 125

Query: 131 LSQGKTGRKATISA 144
           L      R+ TI+A
Sbjct: 126 LRYQGEQRQVTITA 139


>gi|308048234|ref|YP_003911800.1| hypothetical protein Fbal_0512 [Ferrimonas balearica DSM 9799]
 gi|307630424|gb|ADN74726.1| protein of unknown function UPF0079 [Ferrimonas balearica DSM 9799]
          Length = 154

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 78/131 (59%), Gaps = 4/131 (3%)

Query: 16  EKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQL 75
           E +T+ LGR LA  +     + L GDLG+GK+ L R +++ + H  A  V SPT+TLV+ 
Sbjct: 11  EADTLALGRELAERVSAPFVIHLHGDLGAGKTTLTRGLVQAMGHQGA--VKSPTYTLVEP 68

Query: 76  YD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
           Y+  SI + HFD YRL+  +E+  +G  D   +  + ++EWP  G  +LP+  + I L+ 
Sbjct: 69  YELGSIQLYHFDLYRLADPEELEFMGIRDYFADNTLALVEWPSKGHGVLPEPDLSIELAY 128

Query: 134 GKTGRKATISA 144
              GR+ T++A
Sbjct: 129 LNEGRRVTMTA 139


>gi|304439896|ref|ZP_07399790.1| nucleotide-binding protein [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304371635|gb|EFM25247.1| nucleotide-binding protein [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 153

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 79/141 (56%), Gaps = 13/141 (9%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           M F+ K L        + T  LGR L SIL  G  + L GDLG+GK+   +SI   L  D
Sbjct: 4   MKFTTKSL--------EETKSLGRRLGSILNPGQVIALEGDLGAGKTTFTKSIALGLGVD 55

Query: 61  DALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGR 119
           D   V SPTF L+  Y   +PV HFD YRL    +   +GFDE L ++ +CIIEW +  +
Sbjct: 56  DV--VTSPTFNLINEYMGRLPVYHFDVYRLDG-IDADYMGFDEYLFSDGVCIIEWADKIK 112

Query: 120 SLLPKKYIDIHLSQ-GKTGRK 139
            LLP+  + I++ +  +TGR+
Sbjct: 113 ELLPEDTLYIYIKKISETGRE 133


>gi|82703646|ref|YP_413212.1| hypothetical protein Nmul_A2531 [Nitrosospira multiformis ATCC
           25196]
 gi|82411711|gb|ABB75820.1| Protein of unknown function UPF0079 [Nitrosospira multiformis ATCC
           25196]
          Length = 162

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 81/154 (52%), Gaps = 14/154 (9%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG  +A  LR G  + L G+LG+GK+   R I+R L +    +V SPT+ L
Sbjct: 10  LADETATLALGTAMAPALRPGLVVFLQGELGAGKTTFTRGILRGLGYQG--KVKSPTYNL 67

Query: 73  VQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIH 130
           ++LY  S + + HFDFYR ++  E  E GF +  N + IC++EWPE    LLP   +   
Sbjct: 68  IELYKISRLYLYHFDFYRFNNPHEWEEAGFRDYFNADSICLVEWPEKANGLLPPADLKFI 127

Query: 131 LSQGKTGRKATISAE---------RWIISHINQM 155
               + GR   I A+         RW IS  N M
Sbjct: 128 FKVAE-GRDVEIQADTEAGKLCVKRWQISSRNNM 160


>gi|94496375|ref|ZP_01302952.1| predicted ATPase [Sphingomonas sp. SKA58]
 gi|94424121|gb|EAT09145.1| predicted ATPase [Sphingomonas sp. SKA58]
          Length = 152

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 68/118 (57%), Gaps = 6/118 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
            + +P+E   +  GRHLA  +R+GD + L G LG+GK+ LAR +++ L      E  SP+
Sbjct: 5   AVDLPDESAMVAFGRHLARHVRIGDVIALEGGLGAGKTTLARGLLKALGLQG--EAPSPS 62

Query: 70  FTLVQLYDAS---IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE-IGRSLLP 123
           F +VQ YD     +PV H D YRL    E  EL   + L + + +IEWP+ +G SL P
Sbjct: 63  FAIVQPYDVPEVRVPVTHVDLYRLDDVAEADELALGDYLMDGLLLIEWPDRLGTSLWP 120


>gi|58039098|ref|YP_191062.1| hypothetical protein GOX0629 [Gluconobacter oxydans 621H]
 gi|58001512|gb|AAW60406.1| Hypothetical protein GOX0629 [Gluconobacter oxydans 621H]
          Length = 149

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 67/125 (53%), Gaps = 2/125 (1%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASI-PVAHFDFYRLS 91
           GDCL LSG LG+GKS  AR+ +R L  D  +EV SP+F LVQ Y+     V H+D +RL 
Sbjct: 25  GDCLALSGGLGAGKSTFARAFLRHLAQDPQMEVPSPSFALVQPYETPKGAVHHYDLWRLD 84

Query: 92  SHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAERWIISH 151
               + EL +DE   E I ++EWPE    LLP+  + +  + G +     +    W    
Sbjct: 85  GPDALYELAWDEAC-EGIMLVEWPERAEDLLPEGALHLTFASGGSEDSRLVDLTGWPEER 143

Query: 152 INQMN 156
           +  +N
Sbjct: 144 LAGLN 148


>gi|255263166|ref|ZP_05342508.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255105501|gb|EET48175.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 156

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 75/139 (53%), Gaps = 4/139 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+  +T  L    A+I+  GD L L G++G+GKS  ARS+I+  +  +  +V SPTFTL
Sbjct: 11  LPSPGDTARLAEQFAAIVGPGDTLLLEGEIGAGKSHFARSLIKSKI-PNVGDVPSPTFTL 69

Query: 73  VQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y D  + + H D YRL+   E VELG  E     +C++EWP+     +P K + +  
Sbjct: 70  VQTYQDGDLEIWHCDLYRLTHPDEAVELGLLEAFETAVCLVEWPDRMGPDVPSKAVTLRF 129

Query: 132 SQGKTGRKATISAE--RWI 148
                G    I++    WI
Sbjct: 130 EAMPDGHHVQITSRDINWI 148


>gi|260770595|ref|ZP_05879527.1| ATPase YjeE [Vibrio furnissii CIP 102972]
 gi|260614425|gb|EEX39612.1| ATPase YjeE [Vibrio furnissii CIP 102972]
 gi|315178348|gb|ADT85262.1| hypothetical nucleotide-binding protein [Vibrio furnissii NCTC
           11218]
          Length = 154

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 74/137 (54%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
              + +E  T+ LG  LA +      L L GDLG+GK+  +R  IR L H     V SPT
Sbjct: 5   TFTLKDEHATVDLGTALAKLCTQQTTLYLHGDLGAGKTTFSRGFIRALGHTG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  A   V HFD YRL+  +E+  +G  D   ++ IC++EWPE G  +LP   +
Sbjct: 63  YTLVEPYQLAQWQVYHFDLYRLADPEELEFMGIRDYFTDDAICLVEWPEKGHGMLPTSDL 122

Query: 128 DIHLSQGKTGRKATISA 144
           D+ +      R+A  +A
Sbjct: 123 DLDMRYDGNQRQAVFTA 139


>gi|83953055|ref|ZP_00961777.1| hypothetical protein NAS141_12141 [Sulfitobacter sp. NAS-14.1]
 gi|83842023|gb|EAP81191.1| hypothetical protein NAS141_12141 [Sulfitobacter sp. NAS-14.1]
          Length = 156

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 81/137 (59%), Gaps = 5/137 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +   T  L   L   L  GD + L+GD+G+GK+  AR++I+ L+     +V SPTFTLVQ
Sbjct: 12  DADQTARLAVTLGCALTAGDVVLLTGDVGAGKTHFARALIQSLLPVPE-DVPSPTFTLVQ 70

Query: 75  LYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS- 132
            YDA +  + H D YRL+S  E+ ELG  +  ++ IC++EWP+    L P+  +D+ L+ 
Sbjct: 71  TYDAPAAAIWHADLYRLTSVYEIEELGLTDAFSDAICLVEWPDRLGDLRPEDALDLTLTV 130

Query: 133 QGKTGRK--ATISAERW 147
            G   R+  AT + ++W
Sbjct: 131 TGDDTRRLSATWNDDKW 147


>gi|323496868|ref|ZP_08101900.1| putative nucleotide-binding protein [Vibrio sinaloensis DSM 21326]
 gi|323318054|gb|EGA71033.1| putative nucleotide-binding protein [Vibrio sinaloensis DSM 21326]
          Length = 154

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 75/134 (55%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ TI LG  LA +      + L GDLG+GK+  +R  +R L H+    V SPT+TL
Sbjct: 8   LKDEQETIQLGTALAKVCSQQTTIYLHGDLGAGKTTFSRGFVRALGHEG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      V HFD YRL+  +E+  +G  D    + IC++EWPE G+ LLP   +DI 
Sbjct: 66  VEPYQLDQWQVYHFDLYRLADPEELEFMGIRDYFTPDAICLVEWPEKGQGLLPAADLDIE 125

Query: 131 LSQGKTGRKATISA 144
           +      R A ++A
Sbjct: 126 MRYNGEQRIAELTA 139


>gi|84514940|ref|ZP_01002303.1| hypothetical protein SKA53_11988 [Loktanella vestfoldensis SKA53]
 gi|84511099|gb|EAQ07553.1| hypothetical protein SKA53_11988 [Loktanella vestfoldensis SKA53]
          Length = 154

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I + +E  T      +A++LR GD + L G +G+GKS  AR +IR  ++    +V SPTF
Sbjct: 8   ISLADEAATNRFAAAMAALLRPGDTILLQGPIGAGKSAFARGVIRARLNR-MEDVPSPTF 66

Query: 71  TLVQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           TLVQ YDA    + H D YRL+   EV+ELG DE     IC+IEWP+
Sbjct: 67  TLVQTYDAPDGDIWHCDLYRLTDPSEVLELGLDEAFQTAICLIEWPD 113


>gi|299143694|ref|ZP_07036774.1| ATP/GTP hydrolase [Peptoniphilus sp. oral taxon 386 str. F0131]
 gi|298518179|gb|EFI41918.1| ATP/GTP hydrolase [Peptoniphilus sp. oral taxon 386 str. F0131]
          Length = 149

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 79/134 (58%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + N + T   G  L S+L+ GD + L+GDL +GK+ L +SI   +  DD   + SPTFT+
Sbjct: 5   LNNLEETKKFGEKLGSLLKKGDVVCLNGDLAAGKTTLTKSIGIGMGIDDY--ITSPTFTI 62

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL 131
           V  Y   + + HFD YRL    +V  LGFDE    + +C++EW +   S LP+ Y+++++
Sbjct: 63  VNEYYGKLNLYHFDTYRLEGDNDVYYLGFDEYFYGDGVCVVEWADRISSSLPECYLELNI 122

Query: 132 SQ-GKTGRKATISA 144
           +Q  +  RK  I+A
Sbjct: 123 TQLDENKRKIEINA 136


>gi|261379929|ref|ZP_05984502.1| ATPase with strong ADP affinity [Neisseria subflava NJ9703]
 gi|284797638|gb|EFC52985.1| ATPase with strong ADP affinity [Neisseria subflava NJ9703]
          Length = 156

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 78/148 (52%), Gaps = 10/148 (6%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E+ T+ LG   +  L     + L G LG+GK+ L R I+R L H  A  V SPT+T+
Sbjct: 11  LPDEEATLQLGEEWSKQLSAPLTIYLEGGLGAGKTTLTRGILRGLGHTGA--VKSPTYTI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y   +  + HFD YR +  +E  + G DE+   + IC+IEWP+ G    P   I I 
Sbjct: 69  VESYPLDTFTLHHFDLYRFTMPEEWEDAGLDELFAPDSICLIEWPQQGGEFTPLADITIT 128

Query: 131 LSQGKTGRKATISAERWIISHINQMNRS 158
           L+    GR  T SA      H NQ  +S
Sbjct: 129 LTYTDKGRTCTFSA------HTNQGRKS 150


>gi|15603893|ref|NP_220408.1| hypothetical protein RP013 [Rickettsia prowazekii str. Madrid E]
 gi|6226308|sp|Q9ZED0|Y013_RICPR RecName: Full=UPF0079 ATP-binding protein RP013
 gi|3860584|emb|CAA14485.1| unknown [Rickettsia prowazekii]
 gi|292571609|gb|ADE29524.1| Putative P-loop hydrolase [Rickettsia prowazekii Rp22]
          Length = 144

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 77/139 (55%), Gaps = 3/139 (2%)

Query: 16  EKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQL 75
           +K T    +  A  L+  D + L+GDLG+GK+F  R II+     +   ++SPTF L+Q+
Sbjct: 7   KKETKNFAKLFAQNLKPNDIVLLNGDLGAGKTFFCREIIKHFCGKNT-NIISPTFNLLQI 65

Query: 76  YDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQ- 133
           Y      + H+D YR+ S +E+ ELGF+E LN  + +IEW EI + LL    I+++L   
Sbjct: 66  YKTPKFNIYHYDMYRIKSPEEIYELGFEEALNGNLILIEWSEIIKHLLTPPLIEVNLKVL 125

Query: 134 GKTGRKATISAERWIISHI 152
               R  +I  E ++   +
Sbjct: 126 DNNKRLCSIHKENFLFDFL 144


>gi|91775733|ref|YP_545489.1| hypothetical protein Mfla_1380 [Methylobacillus flagellatus KT]
 gi|91709720|gb|ABE49648.1| protein of unknown function UPF0079 [Methylobacillus flagellatus
           KT]
          Length = 127

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 66/109 (60%), Gaps = 4/109 (3%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-IPVAHFDFYRLSSHQEV 96
           L GDLG+GK+ L R ++R L H  A +V SPT+TLV+ Y  S + + HFD YR    +E 
Sbjct: 5   LHGDLGAGKTTLVRGLLRALGH--AGKVKSPTYTLVEPYTVSRLHLYHFDLYRFVDPEEW 62

Query: 97  VELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
              GF +  N E +C++EWPE  R LLP   ID+ L     GR+A +SA
Sbjct: 63  DAAGFRDYFNPESLCLVEWPEKARELLPAPDIDVRLQPEGQGRRAIVSA 111


>gi|301384440|ref|ZP_07232858.1| hypothetical protein PsyrptM_17465 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302064107|ref|ZP_07255648.1| hypothetical protein PsyrptK_29335 [Pseudomonas syringae pv. tomato
           K40]
 gi|302132272|ref|ZP_07258262.1| hypothetical protein PsyrptN_12813 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|330873789|gb|EGH07938.1| hypothetical protein PSYMP_04895 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330965977|gb|EGH66237.1| hypothetical protein PSYAC_15302 [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331014606|gb|EGH94662.1| hypothetical protein PLA106_01855 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 156

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 75/140 (53%), Gaps = 9/140 (6%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E+  +  G  LA +      + L GDLG+GK+ L+R +IR   H  A  V SPTFTLV+
Sbjct: 10  GEEAMMSFGARLAQVTEGAGVIFLDGDLGAGKTTLSRGMIRGFGHAGA--VKSPTFTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+  +I V HFD YRL   +E+  +G  D   ++ +C+IEWP+ G   LPK  + I + 
Sbjct: 68  PYEIGAIRVFHFDLYRLVDPEELEYMGARDYFDDDALCLIEWPQRGAGFLPKPDLTITIG 127

Query: 133 QGKTGRKATIS-----AERW 147
               GR   +S      ERW
Sbjct: 128 PHGEGRSVILSPLGSRGERW 147


>gi|118580676|ref|YP_901926.1| hypothetical protein Ppro_2261 [Pelobacter propionicus DSM 2379]
 gi|118503386|gb|ABK99868.1| protein of unknown function UPF0079 [Pelobacter propionicus DSM
           2379]
          Length = 164

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/126 (39%), Positives = 67/126 (53%), Gaps = 2/126 (1%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           LGR L  +L  G  + L G+LG GK+   R ++       A  V SPTF ++  Y  + P
Sbjct: 17  LGRRLGEMLIPGTFVALCGELGGGKTCFTRGVVSGAAPQSAHLVASPTFAIMNEYPGTPP 76

Query: 82  VAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ-GKTGRK 139
           + HFDFYRLSS  E+ ELGF++    E IC+ EW E    LLP + + +     G   R 
Sbjct: 77  IYHFDFYRLSSCHEIAELGFEDFFQGEGICLAEWSERLEELLPVERLSVTFQHDGDDRRI 136

Query: 140 ATISAE 145
            TI AE
Sbjct: 137 ITIQAE 142


>gi|320155083|ref|YP_004187462.1| ATPase YjeE [Vibrio vulnificus MO6-24/O]
 gi|319930395|gb|ADV85259.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Vibrio vulnificus MO6-24/O]
          Length = 156

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 74/134 (55%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ TI LG  LA +      + L GDLG+GK+  +R  ++ L H     V SPT+TL
Sbjct: 10  LKDEQATILLGTQLAHLCSQQTTIYLHGDLGAGKTTFSRGFVKALGH--VGNVKSPTYTL 67

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y  A   V HFD YRL+  +E+  +G  D    + IC++EWPE G  LLPK  +DI 
Sbjct: 68  VEPYQLADWQVYHFDLYRLADPEELEFMGIRDYFTADAICLVEWPEKGEGLLPKPDLDID 127

Query: 131 LSQGKTGRKATISA 144
           +      R A + A
Sbjct: 128 IRYQGEQRIAQVKA 141


>gi|289423345|ref|ZP_06425153.1| ATPase, YjeE family [Peptostreptococcus anaerobius 653-L]
 gi|289156276|gb|EFD04933.1| ATPase, YjeE family [Peptostreptococcus anaerobius 653-L]
          Length = 152

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 79/130 (60%), Gaps = 4/130 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I + +E  T  +G+ +   L  G  + L+GDLG+GK+ + +SI + L  D+  ++ SPTF
Sbjct: 4   IYLADESFTYDMGQKIGRALFSGAIICLNGDLGAGKTAMTKSIAKALGIDE--DITSPTF 61

Query: 71  TLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYID 128
           T+V  Y D  + + HFD YR+ S  E+ ++GFDE +N + + IIEW  I   +LP++ +D
Sbjct: 62  TIVNEYRDGRLKLNHFDVYRIGSSDEMYDIGFDEYINSDGVSIIEWSTIIEDILPEERLD 121

Query: 129 IHLSQGKTGR 138
           I ++    GR
Sbjct: 122 IDINYEGMGR 131


>gi|254520258|ref|ZP_05132314.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
 gi|226914007|gb|EEH99208.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
          Length = 153

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 82/139 (58%), Gaps = 10/139 (7%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  +G  +  +L  GD + L+GDLG+GK+ + + I + L  DD   + SPTFT+V  Y
Sbjct: 9   EETTKIGFSIGKLLNPGDIICLTGDLGTGKTHITKGIAKGLDIDD--HITSPTFTIVNEY 66

Query: 77  DAS-IPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDI----H 130
           D+  + + HFD YR+S   E+  +GFD+ I ++ + IIEW      +LPK Y+ I     
Sbjct: 67  DSGRLKLYHFDVYRVSDPDEIYAIGFDDYIFSDGVSIIEWANYIEEILPKDYLHILIEKD 126

Query: 131 LSQGKTGRKATIS--AERW 147
           LS+G+  RK +I+   ER+
Sbjct: 127 LSRGENFRKISITPYGERY 145


>gi|260428817|ref|ZP_05782794.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260419440|gb|EEX12693.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 157

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 72/140 (51%), Gaps = 6/140 (4%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+   T  L   LA  L  GD L LSG +G+GK+  AR +I+ L  +   +V SPTFTL
Sbjct: 10  LPSPDATCALAARLAPRLTPGDVLLLSGGIGAGKTHFARCLIQSL-QETPEDVPSPTFTL 68

Query: 73  VQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ+YD     + H D YRLS   + VELG  +     IC++EWP+  + L P   + +  
Sbjct: 69  VQVYDTPAGELWHADLYRLSDPDQCVELGLADAFETAICLVEWPDRLQDLTPSTALSLSF 128

Query: 132 SQGKTGRKATISAE----RW 147
             G       +S +    RW
Sbjct: 129 DAGSADESRQLSLDWSDPRW 148


>gi|89075989|ref|ZP_01162361.1| putative nucleotide-binding protein [Photobacterium sp. SKA34]
 gi|90581381|ref|ZP_01237177.1| putative nucleotide-binding protein [Vibrio angustum S14]
 gi|89048338|gb|EAR53917.1| putative nucleotide-binding protein [Photobacterium sp. SKA34]
 gi|90437491|gb|EAS62686.1| putative nucleotide-binding protein [Vibrio angustum S14]
          Length = 154

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 74/134 (55%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ T+ LG  LA        + L GDLG+GK+  +R  IR L H     V SPT+TL
Sbjct: 8   LADEQATVDLGLKLAKACTQQTTIYLHGDLGAGKTTFSRGFIRALGHQG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ YD A   V HFD YRL+  +E+  +G  D    + IC++EWPE G  LLP+  +++ 
Sbjct: 66  VEPYDLAPWQVYHFDLYRLADPEELEFMGIRDYFTQDAICLVEWPEKGDGLLPQPDLELE 125

Query: 131 LSQGKTGRKATISA 144
           +      RK  I A
Sbjct: 126 MCYHGEQRKVLIRA 139


>gi|260587149|ref|ZP_05853062.1| nucleotide-binding protein, YjeE [Blautia hansenii DSM 20583]
 gi|331083536|ref|ZP_08332647.1| hypothetical protein HMPREF0992_01571 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|260542344|gb|EEX22913.1| nucleotide-binding protein, YjeE [Blautia hansenii DSM 20583]
 gi|330403747|gb|EGG83299.1| hypothetical protein HMPREF0992_01571 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 145

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 76/141 (53%), Gaps = 8/141 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I   N K T CLG  +      G   TL+GDLG GK+   + + + L   +   V SPT
Sbjct: 2   IIETYNAKETFCLGEKIGQQALPGQVYTLNGDLGVGKTVFTQGVAKGLGITEP--VNSPT 59

Query: 70  FTLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYI 127
           FT++Q Y +  +P  HFD YR+   +E+ E+G+D+    + +C+IEW E+ + +LP   I
Sbjct: 60  FTIIQEYEEGRLPFYHFDVYRIGDIEEMEEIGYDDYFFGQGVCLIEWAELIKEILPSDII 119

Query: 128 DI----HLSQGKTGRKATISA 144
            I     L +G   RK TI+ 
Sbjct: 120 SITIEKDLEKGFDYRKITITG 140


>gi|37528404|ref|NP_931749.1| hypothetical protein plu4585 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787842|emb|CAE16957.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 141

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 76/136 (55%), Gaps = 6/136 (4%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ + +E  T+ LG  +A+    G  + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VLSLKDEDATVSLGSAVAAACNSGSVIYLYGDLGAGKTTFSRGFLQSLGHKG--HVKSPT 62

Query: 70  FTLVQLYDASIP--VAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKY 126
           +TLV+ Y A  P  V HFD YRL+  +E+  +G  D    + IC++EWP+ G  +LP   
Sbjct: 63  YTLVEPY-ALTPRSVYHFDLYRLADPEELEFMGIRDYFHQDAICLVEWPQQGEGVLPDAD 121

Query: 127 IDIHLSQGKTGRKATI 142
           I++HLS    G   T 
Sbjct: 122 IELHLSYQPEGETGTF 137


>gi|126734384|ref|ZP_01750131.1| hypothetical protein RCCS2_09494 [Roseobacter sp. CCS2]
 gi|126717250|gb|EBA14114.1| hypothetical protein RCCS2_09494 [Roseobacter sp. CCS2]
          Length = 154

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 66/113 (58%), Gaps = 2/113 (1%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +EK T  L   +A  L+ GD L L G++G+GKS  AR++IR  +     +V SPTFTL
Sbjct: 10  LADEKATAALATQIAPRLKAGDTLLLEGEIGAGKSAFARALIRARL-GRMEDVPSPTFTL 68

Query: 73  VQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPK 124
           VQ Y D    + H D YRL+   E +ELG DE     IC+IEWP+    + PK
Sbjct: 69  VQTYEDDHGDIWHCDLYRLTHPDEALELGLDEAFETAICLIEWPDRLGEVAPK 121


>gi|332531851|ref|ZP_08407736.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038827|gb|EGI75269.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Pseudoalteromonas haloplanktis ANT/505]
          Length = 155

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 83/155 (53%), Gaps = 10/155 (6%)

Query: 5   EKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALE 64
           E HLT     +E  T+ +G  +A I+  G  + L GDLG+GK+   R +++   H    +
Sbjct: 6   EFHLT-----DEIATVAMGNRVADIIEQGAVIYLHGDLGAGKTTFTRGVVQGFGHTG--K 58

Query: 65  VLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLL 122
           V SPT+TLV+ Y+     V HFD YRL   +E+  +G  D    + IC++EWPE G   +
Sbjct: 59  VKSPTYTLVEPYELERANVYHFDLYRLGDPEELEYMGIRDYFSADAICVVEWPEKGGEFI 118

Query: 123 PKKYIDIHLSQGKTGRKATI-SAERWIISHINQMN 156
           P   +DI LS     RK  I SA    I+ + ++N
Sbjct: 119 PVPDLDITLSYVGNERKIVINSASERGIAIVEKLN 153


>gi|270158035|ref|ZP_06186692.1| putative ATP-binding protein YjeE [Legionella longbeachae D-4968]
 gi|289163697|ref|YP_003453835.1| ATPase with strong ADP affinity [Legionella longbeachae NSW150]
 gi|269990060|gb|EEZ96314.1| putative ATP-binding protein YjeE [Legionella longbeachae D-4968]
 gi|288856870|emb|CBJ10681.1| ATPase with strong ADP affinity [Legionella longbeachae NSW150]
          Length = 161

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 87/148 (58%), Gaps = 8/148 (5%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           M+ ++ ++ ++ +P+EK+++     LAS L     +T SGDLG+GK+ + R+++++L   
Sbjct: 2   MSTNQSNVLILDLPDEKSSVNFASRLASCLCPSLIMTFSGDLGAGKTTIIRAMLKYLGVQ 61

Query: 61  DALEVLSPTFTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIG 118
            A++  SPTF+LV+ Y   ++ V HFD YR+   +E+  LGF D      IC IEW E  
Sbjct: 62  SAIK--SPTFSLVESYTCHNLLVHHFDLYRIHHEEELEYLGFRDYFTPSSICCIEWAENA 119

Query: 119 RSLLPKKYIDIH--LSQGKTGRKATISA 144
            S LP  YIDI   L+    GR+  I A
Sbjct: 120 GSALP--YIDIRFKLNMKGAGREVQIMA 145


>gi|220928248|ref|YP_002505157.1| hypothetical protein Ccel_0799 [Clostridium cellulolyticum H10]
 gi|219998576|gb|ACL75177.1| protein of unknown function UPF0079 [Clostridium cellulolyticum
           H10]
          Length = 150

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 77/131 (58%), Gaps = 7/131 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T+ +G  L +IL+ GD + LSGDLG+GK+ L   I + L  D    + SPTF LV  Y
Sbjct: 10  EETVEVGIKLGNILKSGDVIWLSGDLGTGKTALTNGIAKALGID--AYITSPTFNLVNEY 67

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDI----HL 131
           +  +P+ HFD YR+S   E+ ++GFDE +++  + +IEW E    +LP   I +    +L
Sbjct: 68  EGRLPLYHFDVYRISDPDEMFDIGFDEYIDDGGVTVIEWGEQIAEILPSDIIRVTIEKNL 127

Query: 132 SQGKTGRKATI 142
            +G   R+ TI
Sbjct: 128 QKGLDVREITI 138


>gi|319637883|ref|ZP_07992649.1| hypothetical protein HMPREF0604_00272 [Neisseria mucosa C102]
 gi|317401038|gb|EFV81693.1| hypothetical protein HMPREF0604_00272 [Neisseria mucosa C102]
          Length = 156

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 78/148 (52%), Gaps = 10/148 (6%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E+ T+ LG   +  L     + L G LG+GK+ L R I+R L +  A  V SPT+T+
Sbjct: 11  LPDEEATLKLGEEWSKQLSAPLTIYLEGGLGAGKTTLTRGILRGLGYTGA--VKSPTYTI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y   +  + HFD YR +  +E  + G DE+   + IC+IEWP+ G    P   I I 
Sbjct: 69  VESYPLDTFTLHHFDLYRFTMPEEWEDAGLDELFAPDSICLIEWPQQGGEFTPPADITIT 128

Query: 131 LSQGKTGRKATISAERWIISHINQMNRS 158
           L+    GR  T SA      H NQ  +S
Sbjct: 129 LTYTDKGRTCTFSA------HTNQGRKS 150


>gi|295110703|emb|CBL24656.1| conserved hypothetical nucleotide-binding protein [Ruminococcus
           obeum A2-162]
          Length = 141

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 75/134 (55%), Gaps = 8/134 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  LG+ +    R G   TL+GDLG GK+   + +   L   +   V SPTFT+VQ+Y
Sbjct: 9   EETYELGKKIGQQARPGQVYTLTGDLGVGKTVFTQGVAAGLGITEP--VSSPTFTIVQIY 66

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDI----H 130
           +   +P  HFD YR+   +E+ E+G+D+    E IC+IEW E+   +LPK  I I    +
Sbjct: 67  EEGRLPFYHFDVYRIGDIEEMEEIGYDDYFFGEGICLIEWAELIEEILPKDRISITIEKN 126

Query: 131 LSQGKTGRKATISA 144
           L+QG   R+ T+  
Sbjct: 127 LAQGFDYRRITVEG 140


>gi|91227457|ref|ZP_01261821.1| putative nucleotide-binding protein [Vibrio alginolyticus 12G01]
 gi|269967711|ref|ZP_06181760.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|91188607|gb|EAS74898.1| putative nucleotide-binding protein [Vibrio alginolyticus 12G01]
 gi|269827689|gb|EEZ81974.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 154

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 75/134 (55%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG  LA +      + L GDLG+GK+  +R  +R L H     V SPT+TL
Sbjct: 8   LKDEHETVALGTALAQLCSQQTTIYLHGDLGAGKTTFSRGFVRALGHQG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      V HFD YRL+  +E+  +G  D   ++ IC++EWPE G  LLP+  +D++
Sbjct: 66  VEPYQLDQWQVYHFDLYRLADPEELEFMGIRDYFTDDAICLVEWPEKGHGLLPQPDLDVN 125

Query: 131 LSQGKTGRKATISA 144
           +      R A ++A
Sbjct: 126 IRYQGEQRVAELTA 139


>gi|218961906|ref|YP_001741681.1| predicted ATPase or kinase [Candidatus Cloacamonas acidaminovorans]
 gi|167730563|emb|CAO81475.1| predicted ATPase or kinase [Candidatus Cloacamonas acidaminovorans]
          Length = 144

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 83/142 (58%), Gaps = 11/142 (7%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +  + +  E++TI L ++LA +L+ GD +TL GDLGSGK+F  + + + L  ++  E+ S
Sbjct: 1   MKTLNLSTEQDTIDLAKYLAPLLKEGDIITLFGDLGSGKTFFVKQLGKALGIEE--EIDS 58

Query: 68  PTFTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKY 126
           P+F L++ Y    +P+ H D YRL + +E+  LG  +IL + I +IEWP +   LLP  Y
Sbjct: 59  PSFVLMKEYSGGRLPLYHLDLYRLRNKEEIYCLGLFDILEQGITVIEWPLLVNDLLP--Y 116

Query: 127 IDIHLSQGKTGRKATISAERWI 148
             + L     G+K      RW+
Sbjct: 117 QTLKLEFHFDGKK------RWV 132


>gi|114769722|ref|ZP_01447332.1| hypothetical protein OM2255_09146 [alpha proteobacterium HTCC2255]
 gi|114549427|gb|EAU52309.1| hypothetical protein OM2255_09146 [alpha proteobacterium HTCC2255]
          Length = 163

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 83/139 (59%), Gaps = 4/139 (2%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD-DALE-VLSP 68
           I + +   T  L    A +L +G+ + L+G +G+GK+  AR++I   ++D +ALE + SP
Sbjct: 5   ILLKSSDETAALATAFAPLLSVGNTILLNGSVGAGKTHFARALISTCLNDINALEDIPSP 64

Query: 69  TFTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYI 127
           TFTLVQ Y+ + + + H D YRL+S  EV ELG D    + IC++EW      +LPK  +
Sbjct: 65  TFTLVQTYELNHVDIWHADLYRLTSLSEVYELGLDTAFEDAICLLEWSNRLGEMLPKNAL 124

Query: 128 DIHLSQGKTG-RKATISAE 145
            ++L+  +   R+AT+  E
Sbjct: 125 TLNLNITEEDLREATLEWE 143


>gi|330444998|ref|ZP_08308652.1| essential protein with weak ATPase activity [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328493116|dbj|GAA03149.1| essential protein with weak ATPase activity [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 154

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 75/135 (55%), Gaps = 4/135 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ T+  G  LA        + L GDLG+GK+  +R  IR L H     V SPT+TL
Sbjct: 8   LADEQATVDFGLKLAKACTQQTTIYLHGDLGAGKTTFSRGFIRALGHQG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ YD A   V HFD YRL+  +E+  +G  D   ++ IC++EWPE G  LLP+  +++ 
Sbjct: 66  VEPYDLAPWQVYHFDLYRLADPEELEFMGIRDYFTHDAICLVEWPEKGEGLLPQPDLELE 125

Query: 131 LSQGKTGRKATISAE 145
           +      RK  I A+
Sbjct: 126 MCYHGEQRKVLIRAK 140


>gi|260774632|ref|ZP_05883539.1| ATPase YjeE [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609422|gb|EEX35567.1| ATPase YjeE [Vibrio coralliilyticus ATCC BAA-450]
          Length = 153

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 75/134 (55%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ TI LG  LA++      + L GDLG+GK+  +R  +R L H     V SPT+TL
Sbjct: 8   LKDEQATIQLGTVLANLCSQQTTIYLHGDLGAGKTTFSRGFVRALGHQG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      V HFD YRL+  +E+  +G  D    + IC++EWPE G+ LLP+  +DI 
Sbjct: 66  VEPYQLDQWQVYHFDLYRLADPEELEFMGIRDYFTPDAICLVEWPEKGQGLLPRADLDIE 125

Query: 131 LSQGKTGRKATISA 144
           L      R   ++A
Sbjct: 126 LRYDGEARMVDLTA 139


>gi|229588071|ref|YP_002870190.1| hypothetical protein PFLU0516 [Pseudomonas fluorescens SBW25]
 gi|229359937|emb|CAY46791.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 156

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 77/133 (57%), Gaps = 4/133 (3%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
            ++ + +E+  +  G+ +A +      + L GDLG+GK+ L+R IIR L H  A  V SP
Sbjct: 4   VILFLADEEAMVAFGQRIAQVTAGAGLIFLEGDLGAGKTTLSRGIIRGLGHAGA--VKSP 61

Query: 69  TFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKY 126
           TFTLV+ Y+   +   HFD YRL   +E+  +G  +  +E  +C+IEWP+ G   LPK  
Sbjct: 62  TFTLVEPYEIGEVRAFHFDLYRLVDPEELEYMGIRDYFDEDALCLIEWPDKGTGFLPKPD 121

Query: 127 IDIHLSQGKTGRK 139
           + I ++  + GR+
Sbjct: 122 LTITITPHEHGRQ 134


>gi|209696187|ref|YP_002264117.1| hypothetical protein VSAL_I2781 [Aliivibrio salmonicida LFI1238]
 gi|208010140|emb|CAQ80465.1| conserved hypothetical protein [Aliivibrio salmonicida LFI1238]
          Length = 154

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +  E +T+  GR L+        + L GDLG+GK+  +R  IR L H     V SPT+TL
Sbjct: 8   LATEDDTVEFGRQLSQACTQQTTIFLHGDLGAGKTTFSRGFIRSLGH--VGNVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+     V HFD YRL+  +E+  +G  D   ++ IC++EWPE G  LLP   IDI 
Sbjct: 66  VEPYELDKWQVYHFDLYRLADPEELEFMGIRDYFTDDAICLVEWPEKGEGLLPNPDIDIE 125

Query: 131 LSQGKTGRKATISA 144
           L      R   I+ 
Sbjct: 126 LRYDGEARHVVITG 139


>gi|91206101|ref|YP_538456.1| putative P-loop hydrolase [Rickettsia bellii RML369-C]
 gi|122425210|sp|Q1RGZ7|Y1286_RICBR RecName: Full=UPF0079 ATP-binding protein RBE_1286
 gi|91069645|gb|ABE05367.1| Putative P-loop hydrolase [Rickettsia bellii RML369-C]
          Length = 144

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 70/117 (59%), Gaps = 2/117 (1%)

Query: 16  EKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQL 75
           E+ T    +  A+ L+  + + L+GDLG GK+F  R II++   ++   ++SPTF L+Q 
Sbjct: 13  EEETKNFAKAFAATLKPNNIVLLNGDLGVGKTFFCREIIKYFCGENT-SIISPTFNLLQT 71

Query: 76  YDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           Y      + H D YRL S +E+ ELG +E L+  + +IEW EI + LLP   I+++L
Sbjct: 72  YKTPHFTIYHCDLYRLKSPEEIYELGLEEALSGNLTLIEWSEIIKHLLPTPLIEVNL 128


>gi|312173802|emb|CBX82056.1| UPF0079 ATP-binding protein yjeE [Erwinia amylovora ATCC BAA-2158]
          Length = 158

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI +P+E  T+ LG  LA        L L G LG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIALPDEAATLELGASLARTCEGAATLYLYGSLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  A   V HFD YRLS  +E+  +G  +    + +C++EWP+ G  +LP+  +
Sbjct: 63  YTLVEPYMLADRRVYHFDLYRLSDPEELEFMGIRDYFGPDSVCLVEWPQQGAGVLPEPDL 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HLS     R+A + A
Sbjct: 123 ELHLSYQDHAREAVLRA 139


>gi|256821739|ref|YP_003145702.1| hypothetical protein Kkor_0514 [Kangiella koreensis DSM 16069]
 gi|256795278|gb|ACV25934.1| protein of unknown function UPF0079 [Kangiella koreensis DSM 16069]
          Length = 159

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 80/137 (58%), Gaps = 4/137 (2%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + + +E  T+ +G+ LA+ ++    +   G+LG+GK+ L R I+R   +  A +  SPT+
Sbjct: 6   VDLSDESQTVLMGQKLAACIKAPMTIYFKGELGAGKTTLVRGILRGFGYQGATK--SPTY 63

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYID 128
           TLV+ Y+   + + HFD YRLS  +E+  +G  E    + I +IEWP+ G+ ++PK  + 
Sbjct: 64  TLVEPYELVDVTIYHFDLYRLSDPEELEFIGIREYQQPDSIMLIEWPDKGKGMIPKPDLV 123

Query: 129 IHLSQGKTGRKATISAE 145
           I L     GR+  +S+E
Sbjct: 124 IELDYNDEGRRVNLSSE 140


>gi|227357132|ref|ZP_03841501.1| ATPase [Proteus mirabilis ATCC 29906]
 gi|227162664|gb|EEI47631.1| ATPase [Proteus mirabilis ATCC 29906]
          Length = 157

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 80/143 (55%), Gaps = 8/143 (5%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLA-SILRLGDCLTLSGDLGSGKSFLARSIIRFLMH 59
           MN  E    V+ + +E  T+ LG  +A +    G  + L GDLG+GK+  +R  ++ L H
Sbjct: 1   MNMKE---WVVTLEDEAATVKLGHSVAMATNNQGLIIYLFGDLGAGKTTFSRGFLQALGH 57

Query: 60  DDALEVLSPTFTLVQLYDASI-PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEI 117
                V SPT+TLV+ Y  +  PV HFD YRL+S +E+  +G  D    + +C+IEWP  
Sbjct: 58  QG--HVKSPTYTLVEPYMLTPRPVYHFDLYRLASAEELEFMGIRDYFAQDPLCLIEWPSQ 115

Query: 118 GRSLLPKKYIDIHLSQGKTGRKA 140
           G   +P   +++HLS    GRKA
Sbjct: 116 GEGFIPNADLELHLSYENEGRKA 138


>gi|292489624|ref|YP_003532514.1| hypothetical protein EAMY_3161 [Erwinia amylovora CFBP1430]
 gi|292898156|ref|YP_003537525.1| hypothetical protein EAM_0432 [Erwinia amylovora ATCC 49946]
 gi|291198004|emb|CBJ45106.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946]
 gi|291555061|emb|CBA23149.1| UPF0079 ATP-binding protein yjeE [Erwinia amylovora CFBP1430]
          Length = 158

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI +P+E  T+ LG  LA        L L G LG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIALPDEAATLELGASLARTCEGAATLYLYGSLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  A   V HFD YRLS  +E+  +G  +    + +C++EWP+ G  +LP+  +
Sbjct: 63  YTLVEPYMLADRRVYHFDLYRLSDPEELEFMGIRDYFGPDSVCLVEWPQQGAGVLPEPDL 122

Query: 128 DIHLSQGKTGRKATISA 144
           ++HLS     R+A + A
Sbjct: 123 ELHLSYQGHAREAVLRA 139


>gi|153953397|ref|YP_001394162.1| ATP-binding protein [Clostridium kluyveri DSM 555]
 gi|219854026|ref|YP_002471148.1| hypothetical protein CKR_0683 [Clostridium kluyveri NBRC 12016]
 gi|146346278|gb|EDK32814.1| Predicted ATP-binding protein [Clostridium kluyveri DSM 555]
 gi|219567750|dbj|BAH05734.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 151

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 79/132 (59%), Gaps = 7/132 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           ++T+ LG  L ++L  GD + L GDLG+GK++ A+ I + L   +   + SPTFT+V  Y
Sbjct: 9   EDTVKLGEKLGNLLNPGDVICLIGDLGTGKTYFAKGIAKGLEIKEP--ITSPTFTIVNEY 66

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHL---- 131
              + + HFD YR++  ++++ LGFDE I +  + IIEW      L+P+++I I++    
Sbjct: 67  RGRLKLHHFDVYRVNDIEDLLSLGFDEYIYSNAVNIIEWANYIDELIPEEHIYINIYKLP 126

Query: 132 SQGKTGRKATIS 143
            +   GRK TI 
Sbjct: 127 EENPNGRKITIE 138


>gi|323141674|ref|ZP_08076552.1| hydrolase, P-loop family [Phascolarctobacterium sp. YIT 12067]
 gi|322413830|gb|EFY04671.1| hydrolase, P-loop family [Phascolarctobacterium sp. YIT 12067]
          Length = 157

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 77/126 (61%), Gaps = 7/126 (5%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA-SI 80
           LG+H AS    GD   LSGDLG+GK+ L+R +    +  +A +V SPTF ++ +Y    +
Sbjct: 18  LGKHAAS----GDVFCLSGDLGAGKTLLSRGVA-VALGAEAEDVNSPTFAIMNVYQGREL 72

Query: 81  PVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRK 139
            + HFD YRL+  +E+ ++GF+E    + + +IEW E+ +  LP++Y+ I L     GR+
Sbjct: 73  EIRHFDLYRLNRPEELEDIGFEEYAGGDGVTLIEWAELFKDELPEEYLQITLLHDGEGRR 132

Query: 140 ATISAE 145
           A + A+
Sbjct: 133 AVLQAQ 138


>gi|85705749|ref|ZP_01036846.1| hypothetical protein ROS217_10627 [Roseovarius sp. 217]
 gi|85669739|gb|EAQ24603.1| hypothetical protein ROS217_10627 [Roseovarius sp. 217]
          Length = 161

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 73/128 (57%), Gaps = 2/128 (1%)

Query: 6   KHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEV 65
            H  +IP+ +   T  L + LA  LR GD + LSG +G+GK+  AR +I+ L+     +V
Sbjct: 3   DHHVLIPLASPDATCTLAQGLAPRLRPGDTVLLSGGVGAGKTHFARCLIQSLLITPE-DV 61

Query: 66  LSPTFTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPK 124
            SPT+TLVQ Y   +  + H D YRLS   E+VELG  E  ++ IC+IEWP+    L P 
Sbjct: 62  PSPTYTLVQTYPGRTADIWHADLYRLSDAIELVELGLTEAFSDAICLIEWPDRLGDLTPI 121

Query: 125 KYIDIHLS 132
             + +H  
Sbjct: 122 DALWLHFD 129


>gi|297587302|ref|ZP_06945947.1| ATP/GTP hydrolase [Finegoldia magna ATCC 53516]
 gi|297575283|gb|EFH94002.1| ATP/GTP hydrolase [Finegoldia magna ATCC 53516]
          Length = 154

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 79/144 (54%), Gaps = 8/144 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           K+T   G+  A  L+  D ++L GDLG+GK+ L +SI +    +++  V SPTF+LV  Y
Sbjct: 9   KDTEKFGQLFAKALKKQDVISLIGDLGAGKTTLTKSIAKSFGIEES--VTSPTFSLVNTY 66

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQ-G 134
              + + H D YRL    E+  L  DE+L  E I IIEW    +S +P+  I+I++ + G
Sbjct: 67  YGDVELNHIDLYRLEDEMEIESLDIDELLYPEGITIIEWASQAQSYMPRNLIEIYIEKTG 126

Query: 135 KTGRKATISA----ERWIISHINQ 154
              RK  I      E+ II  +N+
Sbjct: 127 DVSRKIRIDGNNKREKEIIEELNE 150


>gi|296536782|ref|ZP_06898836.1| P-loop hydrolase/phosphotransferase [Roseomonas cervicalis ATCC
           49957]
 gi|296262891|gb|EFH09462.1| P-loop hydrolase/phosphotransferase [Roseomonas cervicalis ATCC
           49957]
          Length = 153

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 68/117 (58%), Gaps = 4/117 (3%)

Query: 31  RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYR 89
           R GD L L G LG+GKS   R+ +R    +  LEV SP+FTLVQ Y+    P AH+D YR
Sbjct: 27  RPGDALLLEGPLGAGKSAFCRAFLRAAAGNPGLEVPSPSFTLVQGYELPQGPAAHYDLYR 86

Query: 90  LSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTG--RKATISA 144
           LS   E+ ELG++E   E I ++EWP+    L P+  + I L     G  R+A++S 
Sbjct: 87  LSGPDELEELGWEEA-REGIVLVEWPDRLGWLAPQDALRITLRPDAAGEARQASLSG 142


>gi|88704500|ref|ZP_01102214.1| conserved hypothetical protein [Congregibacter litoralis KT71]
 gi|88701551|gb|EAQ98656.1| conserved hypothetical protein [Congregibacter litoralis KT71]
          Length = 165

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 72/136 (52%), Gaps = 4/136 (2%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + +  E+  +  G  LA ++  G  L L G+LG+GK+ L R I R L H  A  V SPT+
Sbjct: 11  VALSTEEAVVAFGADLARVMSPGTTLYLHGELGAGKTTLTRGIARGLGHRGA--VKSPTY 68

Query: 71  TLVQLY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYID 128
           TLV+ Y D   P+ HFD YRL   +E+  LG  D      + ++EWPE G   LP+  ++
Sbjct: 69  TLVEPYLDLPTPLYHFDLYRLGDPEELEYLGIRDYFDGGAVVVVEWPERGGEFLPQPDME 128

Query: 129 IHLSQGKTGRKATISA 144
           I L     GR   + A
Sbjct: 129 IRLMVDGAGRDLQLVA 144


>gi|197287173|ref|YP_002153045.1| ATP/GTP hydrolase [Proteus mirabilis HI4320]
 gi|194684660|emb|CAR46595.1| putative ATP/GTP hydrolase [Proteus mirabilis HI4320]
          Length = 155

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 77/134 (57%), Gaps = 5/134 (3%)

Query: 10  VIPIPNEKNTICLGRHLA-SILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           V+ + +E  T+ LG  +A +    G  + L GDLG+GK+  +R  ++ L H     V SP
Sbjct: 5   VVTLEDEAATVKLGHSVAMATNNQGLIIYLFGDLGAGKTTFSRGFLQALGHQG--HVKSP 62

Query: 69  TFTLVQLYDASI-PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKY 126
           T+TLV+ Y  +  PV HFD YRL+S +E+  +G  D    + +C+IEWP  G   +P   
Sbjct: 63  TYTLVEPYMLTPRPVYHFDLYRLASAEELEFMGIRDYFAQDPLCLIEWPSQGEGFIPNAD 122

Query: 127 IDIHLSQGKTGRKA 140
           +++HLS    GRKA
Sbjct: 123 LELHLSYENEGRKA 136


>gi|110635904|ref|YP_676112.1| hypothetical protein Meso_3578 [Mesorhizobium sp. BNC1]
 gi|110286888|gb|ABG64947.1| protein of unknown function UPF0079 [Chelativorans sp. BNC1]
          Length = 498

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 63/132 (47%), Positives = 78/132 (59%), Gaps = 1/132 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  +  LG  LA  LR GD + L GDLG+GKS LAR+ IR +  D  LEV SPTFTL
Sbjct: 8   LPDEAASARLGEDLALALRQGDVVALHGDLGAGKSTLARAAIRAIAGDRQLEVPSPTFTL 67

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           VQ Y   IPV HFD YRLS  +E+ ELG  E + + I ++EWPE          I I L 
Sbjct: 68  VQSYALRIPVHHFDLYRLSHPEELEELGLSEAMADGIVLVEWPERAPDAFAGA-IKITLR 126

Query: 133 QGKTGRKATISA 144
           +   GR+  I A
Sbjct: 127 EHGEGREVEIEA 138


>gi|289623752|ref|ZP_06456706.1| hypothetical protein PsyrpaN_01189 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289648631|ref|ZP_06479974.1| hypothetical protein Psyrpa2_12883 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330865890|gb|EGH00599.1| hypothetical protein PSYAE_01280 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 156

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 76/140 (54%), Gaps = 9/140 (6%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E+  +  G  LA++      + L GDLG+GK+ L+R +IR   H  A++  SPTFTLV+
Sbjct: 10  GEEAMMSFGARLATVTEGVGVIFLDGDLGAGKTTLSRGMIRGFGHAGAVK--SPTFTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+  ++ V HFD YRL   +E+  +G  D    + +C+IEWP+ G   LPK  + I + 
Sbjct: 68  PYEIGAVRVFHFDLYRLVDPEELEYMGVRDYFDGDALCLIEWPQRGAGFLPKPDLTITIG 127

Query: 133 QGKTGRKATIS-----AERW 147
               GR   +S      ERW
Sbjct: 128 PHGEGRSVILSPLGSRGERW 147


>gi|150015359|ref|YP_001307613.1| hypothetical protein Cbei_0469 [Clostridium beijerinckii NCIMB
           8052]
 gi|149901824|gb|ABR32657.1| protein of unknown function UPF0079 [Clostridium beijerinckii NCIMB
           8052]
          Length = 153

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 81/138 (58%), Gaps = 8/138 (5%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           I N  +T  LG +L  +L  GD + L+GDLG GK+ + + I + L  +D   + SPTFT+
Sbjct: 5   IYNVDDTAKLGINLGKLLNAGDIICLTGDLGVGKTHITKGIAKGLGIND--NITSPTFTI 62

Query: 73  VQLYDAS-IPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKK--YID 128
           V  YD+  + + HFD YR+S   E+  +GFD+ I ++ + IIEW      +LP    +ID
Sbjct: 63  VNEYDSGRLKLNHFDVYRVSDPDEIYAIGFDDYIFSDAVSIIEWANYIEEILPNDLLHID 122

Query: 129 IH--LSQGKTGRKATISA 144
           I    S+G+  RK T++A
Sbjct: 123 IKKDYSKGEDYRKITLNA 140


>gi|117617591|ref|YP_855463.1| hypothetical protein AHA_0920 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117558998|gb|ABK35946.1| conserved hypothetical protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 157

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 53/152 (34%), Positives = 81/152 (53%), Gaps = 4/152 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++ +P+E  T+ LG  LA   +    + L G LG+GK+ L R  ++ L H+   +V SPT
Sbjct: 6   MMTLPDEAATVALGGRLAHACQQATTVFLHGSLGAGKTTLTRGWVQGLGHEG--KVKSPT 63

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y+ A   + HFD YRL+  +E+  +G  +      +C++EWPE G   LP   +
Sbjct: 64  YTLVEPYELADWQLYHFDLYRLADPEELEFMGIRDYFGANTLCLVEWPEKGEGWLPAPDL 123

Query: 128 DIHLSQGKTGRKATISAERWIISHINQMNRST 159
           DI LS     R+  I A   I   I +   ST
Sbjct: 124 DITLSYANEQREVLIEARTAIGEAILERLSST 155


>gi|262393029|ref|YP_003284883.1| ATPase YjeE [Vibrio sp. Ex25]
 gi|262336623|gb|ACY50418.1| ATPase YjeE [Vibrio sp. Ex25]
          Length = 154

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 75/134 (55%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG  LA +      + L GDLG+GK+  +R  +R L H     V SPT+TL
Sbjct: 8   LKDEHETVALGTALAHLCSQQTTIYLHGDLGAGKTTFSRGFVRALGHQG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      V HFD YRL+  +E+  +G  D   ++ IC++EWPE G  LLP+  +D++
Sbjct: 66  VEPYQLDQWQVYHFDLYRLADPEELEFMGIRDYFTDDAICLVEWPEKGHGLLPQPDLDVN 125

Query: 131 LSQGKTGRKATISA 144
           +      R A ++A
Sbjct: 126 IRYQGEQRVAELTA 139


>gi|71733822|ref|YP_272863.1| hypothetical protein PSPPH_0561 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71554375|gb|AAZ33586.1| conserved hypothetical protein TIGR00150 [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 149

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 76/140 (54%), Gaps = 9/140 (6%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E+  +  G  LA++      + L GDLG+GK+ L+R +IR   H  A++  SPTFTLV+
Sbjct: 3   GEEAMMNFGARLAAVTEGVGVIFLDGDLGAGKTTLSRGMIRGFGHAGAVK--SPTFTLVE 60

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+  +I V HFD YRL   +E+  +G  D    + +C+IEWP+ G   LPK  + I + 
Sbjct: 61  PYEIGAIRVFHFDLYRLVDPEELEYMGVRDYFDGDALCLIEWPQRGAGFLPKPDLTITIG 120

Query: 133 QGKTGRKATIS-----AERW 147
               GR   +S      ERW
Sbjct: 121 PHGEGRSVILSPLGSRGERW 140


>gi|317049760|ref|YP_004117408.1| hypothetical protein Pat9b_3562 [Pantoea sp. At-9b]
 gi|316951377|gb|ADU70852.1| protein of unknown function UPF0079 [Pantoea sp. At-9b]
          Length = 158

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIPLPDEAATLDLGAQLARECHSALVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  AS  + HFD YRL+  +E+  +G  D    + IC++EWP+ G  +LP+  +
Sbjct: 63  YTLVEPYTLASRTLYHFDLYRLADPEELEFMGIRDYFSGDAICLVEWPQQGAGVLPEPDL 122

Query: 128 DIHLSQGKTGRKATISA 144
            + L      R+A + A
Sbjct: 123 ALTLRYVDNAREAELQA 139


>gi|313888062|ref|ZP_07821740.1| hydrolase, P-loop family [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312846017|gb|EFR33400.1| hydrolase, P-loop family [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 152

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 75/135 (55%), Gaps = 3/135 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I + N K T   G  L   L+ GD + L+GDLG+GK+ L +SI + L  DD   V SPT
Sbjct: 1   MISLNNLKETEKFGIFLGENLKPGDVVCLNGDLGAGKTTLTKSIAKGLGIDDY--VTSPT 58

Query: 70  FTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYID 128
           FT+V  Y     + H D YRL    +V  LGFDE   ++ + I+EW E  R  LP++Y++
Sbjct: 59  FTIVNEYYGKTDLYHIDTYRLDDKIDVDYLGFDEYFYSDGVTIVEWAEKIRDALPEEYME 118

Query: 129 IHLSQGKTGRKATIS 143
           I++      R   I+
Sbjct: 119 INIKSHDDKRDLEIN 133


>gi|156972478|ref|YP_001443385.1| hypothetical protein VIBHAR_00098 [Vibrio harveyi ATCC BAA-1116]
 gi|269961398|ref|ZP_06175762.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|156524072|gb|ABU69158.1| hypothetical protein VIBHAR_00098 [Vibrio harveyi ATCC BAA-1116]
 gi|269833775|gb|EEZ87870.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 154

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 75/134 (55%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG  LA +      + L GDLG+GK+  +R  +R L H     V SPT+TL
Sbjct: 8   LKDEHETVALGTALAQLCSQQTTIYLHGDLGAGKTTFSRGFVRALGHQG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      V HFD YRL+  +E+  +G  D   ++ IC++EWPE G+ +LP+  +D+ 
Sbjct: 66  VEPYQLDKWQVYHFDLYRLADPEELEFMGIRDYFTDDAICLVEWPEKGQGMLPQPDLDVD 125

Query: 131 LSQGKTGRKATISA 144
           +      R A ++A
Sbjct: 126 IRYQGEQRVAELTA 139


>gi|114762250|ref|ZP_01441718.1| hypothetical protein 1100011001331_R2601_14965 [Pelagibaca
           bermudensis HTCC2601]
 gi|114545274|gb|EAU48277.1| hypothetical protein R2601_14965 [Roseovarius sp. HTCC2601]
          Length = 157

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 76/143 (53%), Gaps = 6/143 (4%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ + + + T  L   LA+ L  GD L LSG +G+GK+  AR +I  L  D   +V SPT
Sbjct: 7   VLTLTSPEATCALASQLATRLSPGDVLLLSGGIGAGKTHFARCLIHAL-QDPPEDVPSPT 65

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYID 128
           FTLVQ+YD A+  + H D YRLS   +  ELG  +     IC++EWP+    L P   + 
Sbjct: 66  FTLVQVYDTAAGELWHADLYRLSDPDQCEELGLADAFETAICLVEWPDRLEDLAPADALS 125

Query: 129 IHLSQG--KTGRKATI--SAERW 147
           +    G  +  R  T+  S  RW
Sbjct: 126 LSFDAGAAEDSRALTLDWSDPRW 148


>gi|225076751|ref|ZP_03719950.1| hypothetical protein NEIFLAOT_01802 [Neisseria flavescens
           NRL30031/H210]
 gi|224951919|gb|EEG33128.1| hypothetical protein NEIFLAOT_01802 [Neisseria flavescens
           NRL30031/H210]
          Length = 156

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 56/149 (37%), Positives = 78/149 (52%), Gaps = 12/149 (8%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E+ T+ LG   +  L     + L G LG+GK+ L R I+R L H  A  V SPT+T+
Sbjct: 11  LPDEEATLKLGEEWSKQLSAPLTIYLEGGLGAGKTTLTRGILRGLGHTGA--VKSPTYTI 68

Query: 73  VQLY--DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDI 129
           V+ Y  D  I + HFD YR +  +E  + G DE+   + +C+IEWP+ G    P   I I
Sbjct: 69  VESYPLDTFI-LHHFDLYRFTMPEEWEDAGLDELFAPDSVCLIEWPQQGGEFTPPADITI 127

Query: 130 HLSQGKTGRKATISAERWIISHINQMNRS 158
            L     GR  T SA      H NQ  +S
Sbjct: 128 TLMYTDKGRTCTFSA------HTNQGRKS 150


>gi|330886595|gb|EGH20256.1| hypothetical protein PSYMO_01660 [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330984564|gb|EGH82667.1| hypothetical protein PLA107_06036 [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 156

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 76/140 (54%), Gaps = 9/140 (6%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E+  +  G  LA++      + L GDLG+GK+ L+R +IR   H  A++  SPTFTLV+
Sbjct: 10  GEEAMMNFGARLATVTEGVGVIFLDGDLGAGKTTLSRGMIRGFGHAGAVK--SPTFTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+  +I V HFD YRL   +E+  +G  D    + +C+IEWP+ G   LPK  + I + 
Sbjct: 68  PYEIGAIRVFHFDLYRLVDPEELEYMGVRDYFDGDALCLIEWPQRGAGFLPKPDLTITIG 127

Query: 133 QGKTGRKATIS-----AERW 147
               GR   +S      ERW
Sbjct: 128 PHGEGRSVILSPLGSRGERW 147


>gi|259907174|ref|YP_002647530.1| putative ATPase [Erwinia pyrifoliae Ep1/96]
 gi|224962796|emb|CAX54253.1| conserved uncharacterized protein YjeE [Erwinia pyrifoliae Ep1/96]
 gi|283476982|emb|CAY72873.1| UPF0079 ATP-binding protein yjeE [Erwinia pyrifoliae DSM 12163]
          Length = 158

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 79/139 (56%), Gaps = 8/139 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI +P+E  T+ LG  LA        L L G LG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIALPDEAATLELGASLARTCEGAATLYLYGSLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYDASIP---VAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKK 125
           +TLV+ Y   +P   V HFD YRLS  +E+  +G  D   ++ +C++EWP+ G  +LP+ 
Sbjct: 63  YTLVEPY--VLPDRRVYHFDLYRLSDPEELEFMGIRDYFGSDSVCLVEWPQQGAGVLPEP 120

Query: 126 YIDIHLSQGKTGRKATISA 144
            +++HLS     R+A + A
Sbjct: 121 DLELHLSYQGHAREALLRA 139


>gi|256003503|ref|ZP_05428493.1| protein of unknown function UPF0079 [Clostridium thermocellum DSM
           2360]
 gi|281418333|ref|ZP_06249353.1| protein of unknown function UPF0079 [Clostridium thermocellum JW20]
 gi|255992527|gb|EEU02619.1| protein of unknown function UPF0079 [Clostridium thermocellum DSM
           2360]
 gi|281409735|gb|EFB39993.1| protein of unknown function UPF0079 [Clostridium thermocellum JW20]
 gi|316941429|gb|ADU75463.1| Uncharacterized protein family UPF0079, ATPase [Clostridium
           thermocellum DSM 1313]
          Length = 161

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 78/121 (64%), Gaps = 4/121 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           ++++TI  G+ L  +L+ GD + ++GDLG+GK+ L   I   L  D+   + SPTFT+V 
Sbjct: 8   SQEDTIEFGKKLGVLLKKGDIVCITGDLGTGKTVLTNGIASALGIDEY--ITSPTFTIVN 65

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+   I + HFD YR+S+ +E+ E+GF+E L  + I +IEW ++ +S+LP + I I + 
Sbjct: 66  EYEKGDISLYHFDVYRISAPEEMFEIGFEEYLYGDGIVVIEWADLIKSILPDENIWITIE 125

Query: 133 Q 133
           +
Sbjct: 126 K 126


>gi|114777076|ref|ZP_01452096.1| hypothetical protein SPV1_06929 [Mariprofundus ferrooxydans PV-1]
 gi|114552597|gb|EAU55057.1| hypothetical protein SPV1_06929 [Mariprofundus ferrooxydans PV-1]
          Length = 140

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 69/119 (57%), Gaps = 3/119 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E +T  +    A  L+ GD + L G+LG+GKS  +R+++R L   DA  + SPTF ++Q
Sbjct: 7   QESDTAAVAGRFAESLKPGDVVALHGELGAGKSVFSRAVMRALGVTDA-ALPSPTFAIIQ 65

Query: 75  LYDAS-IPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHL 131
            YD S   +AH D+YRL   +E+  LG  D      IC+IEWPE  R LLP+  + + L
Sbjct: 66  EYDGSHCRIAHMDWYRLDDAEEIDLLGVRDYFRPPWICLIEWPERARGLLPETAVTVEL 124


>gi|237749025|ref|ZP_04579505.1| TriP hydrolase domain-containing protein [Oxalobacter formigenes
           OXCC13]
 gi|229380387|gb|EEO30478.1| TriP hydrolase domain-containing protein [Oxalobacter formigenes
           OXCC13]
          Length = 161

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 76/138 (55%), Gaps = 8/138 (5%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E +T  LG+ LA +L  G  + L GDLGSGK+ L R++++   H    +V SPT+TL
Sbjct: 8   LNDESDTCELGKSLARVLESGLKIYLHGDLGSGKTTLTRALLKEAGHTG--KVKSPTYTL 65

Query: 73  VQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKY 126
           V+ Y       ++ + HFD YR+S  +E +E GF +  NE  +C IEW E   S LP   
Sbjct: 66  VEPYVIELNGHTVDLLHFDLYRMSCPEEFLEAGFRDHFNEETVCFIEWAEKAESALPAAD 125

Query: 127 IDIHLSQGKTGRKATISA 144
           ID+       GR   + +
Sbjct: 126 IDVSFEISGDGRTVELRS 143


>gi|196231668|ref|ZP_03130525.1| protein of unknown function UPF0079 [Chthoniobacter flavus
           Ellin428]
 gi|196224140|gb|EDY18653.1| protein of unknown function UPF0079 [Chthoniobacter flavus
           Ellin428]
          Length = 138

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 63/108 (58%), Gaps = 4/108 (3%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY- 76
            TI  GR  A+ LR GD L L GDLG+GK+   + ++  L       V SPTFTL+  Y 
Sbjct: 11  ETIAHGRAHAAALRRGDVLALCGDLGAGKTHFVKGLVAAL--GATAGVTSPTFTLIHEYL 68

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLP 123
              +P+ HFDFYRL    E +++G DE LN + +C+IEW +    LLP
Sbjct: 69  GGRLPLYHFDFYRLEDEDEALKIGLDEYLNGDGVCVIEWGDKFPGLLP 116


>gi|26991576|ref|NP_747001.1| hypothetical protein PP_4898 [Pseudomonas putida KT2440]
 gi|148549976|ref|YP_001270078.1| hypothetical protein Pput_4774 [Pseudomonas putida F1]
 gi|24986664|gb|AAN70465.1|AE016688_4 conserved hypothetical protein TIGR00150 [Pseudomonas putida
           KT2440]
 gi|148514034|gb|ABQ80894.1| protein of unknown function UPF0079 [Pseudomonas putida F1]
 gi|313500877|gb|ADR62243.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 157

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 79/145 (54%), Gaps = 9/145 (6%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ T+  G  LA +      + L GDLG+GK+ L+R +IR L H  A  V SPTFT+
Sbjct: 8   LADEEATVKFGAALAEVTGGRGVIFLEGDLGAGKTTLSRGLIRGLGHTGA--VKSPTFTV 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+   +   HFD YRL   +E+  +G  D    + +C+ EWP+ G  +LPK  + I 
Sbjct: 66  VEPYEIGEVRAFHFDLYRLVDPEELEFMGIRDYFEGDPLCLFEWPQKGAGVLPKPDLTIT 125

Query: 131 LSQGKTGRKATIS-----AERWIIS 150
           +S   +GR   +S      E W ++
Sbjct: 126 ISPQASGRSLNLSPQGARGEAWCVA 150


>gi|331092576|ref|ZP_08341396.1| hypothetical protein HMPREF9477_02039 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330400626|gb|EGG80236.1| hypothetical protein HMPREF9477_02039 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 142

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 80/143 (55%), Gaps = 9/143 (6%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I   N K T  LG  +    + GD  TL GDLG GK+   + + + L  ++ +   SPT
Sbjct: 2   IIETNNAKETFELGVQIGREAKAGDVYTLVGDLGVGKTVFTQGLAKGLEIEEPIS--SPT 59

Query: 70  FTLVQLY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKK-- 125
           FT+VQ+Y +  +P  HFD YR+   +E+ E+G+ D I  + +C+IEW  +   +LP+K  
Sbjct: 60  FTIVQVYEEGRLPFYHFDVYRIGDVEEMDEIGYEDYIYGQGVCLIEWSNLIEEILPEKRR 119

Query: 126 --YIDIHLSQGKTGRKATISAER 146
              I+  L +G   RK TI AER
Sbjct: 120 EITIEKDLEKGFDYRKITI-AER 141


>gi|303234236|ref|ZP_07320882.1| conserved hypothetical protein [Finegoldia magna BVS033A4]
 gi|302494777|gb|EFL54537.1| conserved hypothetical protein [Finegoldia magna BVS033A4]
          Length = 154

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 81/145 (55%), Gaps = 10/145 (6%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIR-FLMHDDALEVLSPTFTLVQL 75
           K+T   G+  A  L+  D ++L GDLG+GK+ L +SI + F + ++   V SPTF+LV  
Sbjct: 9   KDTEKFGQIFARTLKKQDVISLIGDLGAGKTTLTKSIAKSFGIEEN---VTSPTFSLVNT 65

Query: 76  YDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQ- 133
           Y  +I + H D YRL    E+  L  DE+L  E I IIEW    +S +P+  I+I++ + 
Sbjct: 66  YYGNIQLNHIDLYRLEDEMEIESLDIDELLYPEGITIIEWASQAQSYMPRNLIEIYIEKT 125

Query: 134 GKTGRKATISA----ERWIISHINQ 154
           G   RK  I      E+ II  +N+
Sbjct: 126 GDISRKIRIDGNNKREKEIIEELNE 150


>gi|302379612|ref|ZP_07268097.1| conserved hypothetical protein [Finegoldia magna ACS-171-V-Col3]
 gi|302312519|gb|EFK94515.1| conserved hypothetical protein [Finegoldia magna ACS-171-V-Col3]
          Length = 154

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 81/145 (55%), Gaps = 10/145 (6%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIR-FLMHDDALEVLSPTFTLVQL 75
           K+T   G+  A  L+  D ++L GDLG+GK+ L +SI + F + ++   V SPTF+LV  
Sbjct: 9   KDTERFGQIFARTLKKQDVISLIGDLGAGKTTLTKSIAKSFGIEEN---VTSPTFSLVNT 65

Query: 76  YDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQ- 133
           Y  +I + H D YRL    E+  L  DE+L  E I IIEW    +S +P+  I+I++ + 
Sbjct: 66  YYGNIQLNHIDLYRLEDEMEIESLDIDELLYPEGITIIEWASQAQSYMPRNLIEIYIEKT 125

Query: 134 GKTGRKATISA----ERWIISHINQ 154
           G   RK  I      E+ II  +N+
Sbjct: 126 GDVSRKIRIDGNNKREKEIIEELNE 150


>gi|257482415|ref|ZP_05636456.1| hypothetical protein PsyrptA_04053 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|320321888|gb|EFW77984.1| hypothetical protein PsgB076_23864 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|331009760|gb|EGH89816.1| hypothetical protein PSYTB_08711 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 156

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 76/140 (54%), Gaps = 9/140 (6%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E+  +  G  LA++      + L GDLG+GK+ L+R +IR   H  A++  SPTFTLV+
Sbjct: 10  GEEAMMNFGARLAAVTEGVGVIFLDGDLGAGKTTLSRGMIRGFGHAGAVK--SPTFTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+  ++ V HFD YRL   +E+  +G  D    + +C+IEWP+ G   LPK  + I + 
Sbjct: 68  PYEIGAVRVFHFDLYRLVDPEELEYMGVRDYFDGDALCLIEWPQRGAGFLPKPDLTITIG 127

Query: 133 QGKTGRKATIS-----AERW 147
               GR   +S      ERW
Sbjct: 128 PHGEGRSVILSPLGSRGERW 147


>gi|147677076|ref|YP_001211291.1| ATPase or kinase [Pelotomaculum thermopropionicum SI]
 gi|146273173|dbj|BAF58922.1| predicted ATPase or kinase [Pelotomaculum thermopropionicum SI]
          Length = 159

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 76/131 (58%), Gaps = 3/131 (2%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           + VI   + + T  +G  LA++LR GD + L+GDLG+GK+ LA+ + R L  +    V S
Sbjct: 1   MPVIKTFSPEETAGVGEKLAALLRPGDVICLNGDLGAGKTRLAQGVARGLGIEGP--VTS 58

Query: 68  PTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKY 126
           PTFTL+  Y   + + H D YRL S  E+ +LG  E    E + ++EW +  + LLP + 
Sbjct: 59  PTFTLINEYQGGLTLYHIDVYRLDSPAEMEDLGCAEYFYGEGVTLVEWADKVKDLLPGER 118

Query: 127 IDIHLSQGKTG 137
           +DI++ +   G
Sbjct: 119 LDIYIKRSPEG 129


>gi|163847551|ref|YP_001635595.1| hypothetical protein Caur_1991 [Chloroflexus aurantiacus J-10-fl]
 gi|222525401|ref|YP_002569872.1| hypothetical protein Chy400_2146 [Chloroflexus sp. Y-400-fl]
 gi|163668840|gb|ABY35206.1| protein of unknown function UPF0079 [Chloroflexus aurantiacus
           J-10-fl]
 gi|222449280|gb|ACM53546.1| protein of unknown function UPF0079 [Chloroflexus sp. Y-400-fl]
          Length = 194

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 70/118 (59%), Gaps = 8/118 (6%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-- 79
           +G  L  +LR GD + LSG LG+GK+ L + I R L +D    V SPTF L+  Y A   
Sbjct: 49  IGARLGHLLRAGDLVLLSGQLGAGKTHLIKGIARGLGYDGL--VTSPTFVLINEYRADAA 106

Query: 80  ---IPVAHFDFYRLSSHQEVVELGFDEI-LNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
              +P+ H D YR+    E++ +G DE+ L+E IC+IEWPE   + +P +++ I LS 
Sbjct: 107 HGRLPIYHVDLYRVRDVTELITIGLDELWLSEGICLIEWPERAATAMPAEHLHIVLSH 164


>gi|56459440|ref|YP_154721.1| ATPase or kinase [Idiomarina loihiensis L2TR]
 gi|56178450|gb|AAV81172.1| Predicted ATPase or kinase [Idiomarina loihiensis L2TR]
          Length = 152

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 75/134 (55%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + NE+ T+ L +  + +L+    + L G+LG+GK+   R +I+ + H  A  V SPT+TL
Sbjct: 9   LANEEETLALAKKFSQVLQAPLVVYLEGELGAGKTAFCRGVIQAMGHSGA--VKSPTYTL 66

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YRL+  +E+  +G  +  +E  +  IEWP+ G   LP   I+I 
Sbjct: 67  VEPYQLQGWRIHHFDLYRLADPEELEYMGIRDYFSEDTLNFIEWPDKGYGWLPGADIEIR 126

Query: 131 LSQGKTGRKATISA 144
           +    TGRK T SA
Sbjct: 127 IEYAGTGRKLTFSA 140


>gi|94500526|ref|ZP_01307057.1| hypothetical protein RED65_15688 [Oceanobacter sp. RED65]
 gi|94427316|gb|EAT12295.1| hypothetical protein RED65_15688 [Oceanobacter sp. RED65]
          Length = 153

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 49/120 (40%), Positives = 73/120 (60%), Gaps = 4/120 (3%)

Query: 27  ASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASI-PVAHF 85
           A  L+ G  + L GDLG GK+  +R II+ + H+    V SPT+TLV+ Y+ S   V HF
Sbjct: 23  AKKLKSGLVIHLQGDLGMGKTTWSRGIIQGMGHEG--RVKSPTYTLVEPYELSTRKVYHF 80

Query: 86  DFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           D YRL+  +E+  +G  D   ++ +C+IEWPE G  +LP+  I++ L+Q + GR  T  A
Sbjct: 81  DLYRLADPEELEFMGVRDYFTDDTLCLIEWPEKGAGVLPEADIEVQLTQWQDGRCMTCKA 140


>gi|330501619|ref|YP_004378488.1| hypothetical protein MDS_0705 [Pseudomonas mendocina NK-01]
 gi|328915905|gb|AEB56736.1| hypothetical protein MDS_0705 [Pseudomonas mendocina NK-01]
          Length = 155

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 72/126 (57%), Gaps = 4/126 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E   + LG  +A +      + L GDLG+GK+ L+R I+R L H  A  V SPTFTLV+
Sbjct: 10  DEAAMLALGASIAKVSGGVGTIYLHGDLGAGKTTLSRGILRGLGHAGA--VKSPTFTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+   +   HFD YRL   +E+  LG  D      +C+IEWP+ G  +LPK  +DI +S
Sbjct: 68  PYEIGDVHAFHFDLYRLVDPEELEFLGIRDYFEGNALCLIEWPQRGEGVLPKPDLDITIS 127

Query: 133 QGKTGR 138
              +GR
Sbjct: 128 PQASGR 133


>gi|145300258|ref|YP_001143099.1| hypothetical protein ASA_3373 [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853030|gb|ABO91351.1| conserved hypothetical protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 157

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 80/152 (52%), Gaps = 4/152 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++ +P+E  T+ LG  LA        + L G LG+GK+ L R  ++ L H    +V SPT
Sbjct: 6   MMTLPDEAATVALGGRLAHACLQATTVFLHGSLGAGKTTLTRGWVQGLGHQG--KVKSPT 63

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y+ A   V HFD YRL+  +E+  +G  D      +C++EWPE G   LP   +
Sbjct: 64  YTLVEPYELADWQVYHFDLYRLADPEELEFMGIRDYFAANTLCLVEWPEKGEGWLPAPDL 123

Query: 128 DIHLSQGKTGRKATISAERWIISHINQMNRST 159
           DI L+     R+A I A   I   I +   ST
Sbjct: 124 DITLTYVNEQREALIEARTAIGEAILERLSST 155


>gi|254448169|ref|ZP_05061632.1| conserved hypothetical protein TIGR00150 [gamma proteobacterium
           HTCC5015]
 gi|198262295|gb|EDY86577.1| conserved hypothetical protein TIGR00150 [gamma proteobacterium
           HTCC5015]
          Length = 153

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (55%), Gaps = 9/135 (6%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E   I  G+ LA ++     + L GDLG+GK+ L+R+ IR L H+ A  V SPT+TLV+
Sbjct: 10  DEAAMIAWGQRLARVVSSPAVVYLRGDLGAGKTTLSRAWIRALGHEGA--VKSPTYTLVE 67

Query: 75  LYD------ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
            Y+          + HFD YRL   +E+  +G  + L+E  IC+ EWPE G  +LP+   
Sbjct: 68  PYEFGESGQGGFSLYHFDLYRLGDPEELEAIGLRDYLSESAICLFEWPERGEGILPEADW 127

Query: 128 DIHLSQGKTGRKATI 142
           +I +     GR  +I
Sbjct: 128 EIVIEPQDVGRGLSI 142


>gi|310765335|gb|ADP10285.1| putative ATPase [Erwinia sp. Ejp617]
          Length = 158

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 79/139 (56%), Gaps = 8/139 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI +P+E  T+ LG  LA        L L G LG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIALPDEAATLELGASLARTCEGAATLYLYGSLGAGKTTFSRGFLQALGHHG--NVKSPT 62

Query: 70  FTLVQLYDASIP---VAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKK 125
           +TLV+ Y   +P   V HFD YRLS  +E+  +G  D   ++ +C++EWP+ G  +LP+ 
Sbjct: 63  YTLVEPY--MLPDRRVYHFDLYRLSDPEELEFMGIRDYFGSDSVCLVEWPQQGAGVLPEP 120

Query: 126 YIDIHLSQGKTGRKATISA 144
            +++HLS     R+A + A
Sbjct: 121 DLELHLSYQGHAREALLRA 139


>gi|197334748|ref|YP_002157123.1| hypothetical protein VFMJ11_2440 [Vibrio fischeri MJ11]
 gi|197316238|gb|ACH65685.1| conserved hypothetical protein [Vibrio fischeri MJ11]
          Length = 154

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 72/134 (53%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +  E +T+  GR L+        + L GDLG+GK+  +R  IR L H  A  V SPT+TL
Sbjct: 8   LATEDDTVEFGRQLSQACTQQTTIFLHGDLGAGKTTFSRGFIRSLGH--AGNVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+     V HFD YRL+  +E+  +G  D   ++ IC++EWPE G  LLP   +DI 
Sbjct: 66  VEPYELDKWQVYHFDLYRLADPEELEFMGIRDYFTDDAICLVEWPEKGEGLLPAPDLDID 125

Query: 131 LSQGKTGRKATISA 144
           +      R   I+ 
Sbjct: 126 IRYEGEARHVVITG 139


>gi|254498705|ref|ZP_05111421.1| ATPase or kinase [Legionella drancourtii LLAP12]
 gi|254352033|gb|EET10852.1| ATPase or kinase [Legionella drancourtii LLAP12]
          Length = 156

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 53/133 (39%), Positives = 74/133 (55%), Gaps = 4/133 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +PNE+ +      LAS L     +T  GDLG+GK+ + R+++R L    A++  SPTF+L
Sbjct: 9   LPNEQASEAFATCLASCLTPPLIITFCGDLGAGKTTIIRAMLRHLGIRSAIK--SPTFSL 66

Query: 73  VQLYDA-SIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y   ++PV HFD YR+    E+  LGF D   NE IC IEW E     LPK  I   
Sbjct: 67  VESYVCQNMPVHHFDLYRIQHEDELEYLGFRDYFTNESICCIEWAEKAGKALPKVDIRFK 126

Query: 131 LSQGKTGRKATIS 143
           L+    GR+  I+
Sbjct: 127 LNMKGAGREMQIT 139


>gi|330960093|gb|EGH60353.1| hypothetical protein PMA4326_16166 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 156

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 74/140 (52%), Gaps = 9/140 (6%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E+  +  G  LA +      + L GDLG+GK+ L+R +IR   H  A  V SPTFTLV+
Sbjct: 10  GEEAMMHFGARLAEVTEGKGVIFLDGDLGAGKTTLSRGMIRGFGHAGA--VKSPTFTLVE 67

Query: 75  LYDA-SIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+  ++ V HFD YRL   +E+  +G  D    E +C+IEWP+ G   LPK  + I + 
Sbjct: 68  PYEIDAVRVFHFDLYRLVDPEELEFMGVRDYFDGEALCLIEWPQRGAGFLPKPDLTITIG 127

Query: 133 QGKTGRKATIS-----AERW 147
               GR   +S      ERW
Sbjct: 128 PHGEGRSVVLSPLGSRGERW 147


>gi|125974280|ref|YP_001038190.1| hypothetical protein Cthe_1776 [Clostridium thermocellum ATCC
           27405]
 gi|125714505|gb|ABN52997.1| protein of unknown function UPF0079 [Clostridium thermocellum ATCC
           27405]
          Length = 161

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 77/121 (63%), Gaps = 4/121 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           ++++TI  G+ L  +L+ GD + ++GDLG+GK+ L   I   L  D+   + SPTFT+V 
Sbjct: 8   SQEDTIEFGKKLGVLLKKGDIVCITGDLGTGKTVLTNGIASALGIDEY--ITSPTFTIVN 65

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+   I + HFD YR+S  +E+ E+GF+E L  + I +IEW ++ +S+LP + I I + 
Sbjct: 66  EYEKGDISLYHFDVYRISDPEEMFEIGFEEYLYGDGIVVIEWADLIKSILPDENIWITIE 125

Query: 133 Q 133
           +
Sbjct: 126 K 126


>gi|258516848|ref|YP_003193070.1| hypothetical protein Dtox_3739 [Desulfotomaculum acetoxidans DSM
           771]
 gi|257780553|gb|ACV64447.1| protein of unknown function UPF0079 [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 159

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 68/115 (59%), Gaps = 3/115 (2%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           T  +G+ L  +L  GD L L+G LG+GK+  AR + R L  ++   V SPTFTL+  Y  
Sbjct: 12  TEAVGKSLGKLLIAGDVLCLNGGLGAGKTCFARGVARGLGIEEP--VTSPTFTLINEYIG 69

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
             P  HFD YRL   +E+ +LG++E    + + ++EW E+   LLP + +DI LS
Sbjct: 70  REPFYHFDVYRLGGPEEMNDLGYEEYFYGQGVALVEWGELVNELLPPERLDIWLS 124


>gi|163802741|ref|ZP_02196631.1| putative nucleotide-binding protein [Vibrio sp. AND4]
 gi|159173448|gb|EDP58270.1| putative nucleotide-binding protein [Vibrio sp. AND4]
          Length = 154

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 75/134 (55%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG  LA +      + L GDLG+GK+  +R  +R L H     V SPT+TL
Sbjct: 8   LKDEYETVALGTALAQLCSQQTTIYLHGDLGAGKTTFSRGFVRALGHQG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      V HFD YRL+  +E+  +G  D   ++ IC++EWPE G+ +LP+  +D+ 
Sbjct: 66  VEPYQLDKWHVYHFDLYRLADPEELEFMGIRDYFTDDAICLVEWPEKGQGMLPQPDLDVD 125

Query: 131 LSQGKTGRKATISA 144
           +      R A ++A
Sbjct: 126 IRYQGEQRVAELTA 139


>gi|237798275|ref|ZP_04586736.1| hypothetical protein POR16_05474 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021127|gb|EGI01184.1| hypothetical protein POR16_05474 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 156

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 73/142 (51%), Gaps = 9/142 (6%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +  E   +  G  LA +      + L GDLG+GK+ L+R +IR   H  A  V SPTFTL
Sbjct: 8   VVGEDAMMQFGARLAGVTEGTGVIFLDGDLGAGKTTLSRGMIRGFGHQGA--VKSPTFTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+   I V HFD YRL   +E+  +G  D    + +C+IEWP+ G   LPK  + I 
Sbjct: 66  VEPYEIGQIRVFHFDLYRLVDPEELEFMGVRDYFDGDALCLIEWPQRGAGFLPKPDLTIT 125

Query: 131 LSQGKTGRKATIS-----AERW 147
           +     GR   +S      ERW
Sbjct: 126 IGAHGEGRSVILSPLGSRGERW 147


>gi|189425587|ref|YP_001952764.1| hypothetical protein Glov_2530 [Geobacter lovleyi SZ]
 gi|189421846|gb|ACD96244.1| protein of unknown function UPF0079 [Geobacter lovleyi SZ]
          Length = 176

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 67/121 (55%), Gaps = 1/121 (0%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+   + + T  +G  L  +L  GD +TLSG+LG GK+   R ++  L       V SPT
Sbjct: 9   VVETGSPEQTEAVGTSLGRLLEPGDVVTLSGELGGGKTCFVRGVVASLAPAGKELVASPT 68

Query: 70  FTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYID 128
           F ++  Y    PV H+D YRL    + VELG +E +  + +C+IEWPE   ++LP   ++
Sbjct: 69  FAILNEYPGQPPVLHYDCYRLRGSDDAVELGIEEQLCGDTVCLIEWPERIAAVLPDDRLE 128

Query: 129 I 129
           +
Sbjct: 129 V 129


>gi|322418649|ref|YP_004197872.1| hypothetical protein GM18_1121 [Geobacter sp. M18]
 gi|320125036|gb|ADW12596.1| Uncharacterized protein family UPF0079, ATPase [Geobacter sp. M18]
          Length = 154

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 72/139 (51%), Gaps = 2/139 (1%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           ++ +   + + T+ LG  L  +L  GD + L G+LG+GK+  A+ I   L  D    V S
Sbjct: 1   MSCVQTNSAEETVQLGARLGRLLEPGDFVALVGELGAGKTQFAKGIALGLEVDPETPVTS 60

Query: 68  PTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKY 126
           PT+T++ +Y   IP+ HFD YRL   ++V  LGF+E    +  C++EW E     LP   
Sbjct: 61  PTYTILNIYQGRIPLYHFDLYRLEGAEDVDALGFEEYFSGDGACVVEWAERLEGDLPADL 120

Query: 127 IDIHLSQ-GKTGRKATISA 144
           + + L   G  GR     A
Sbjct: 121 LTVTLGHAGVEGRTVCFEA 139


>gi|320331007|gb|EFW86981.1| hypothetical protein PsgRace4_06573 [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 156

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 76/140 (54%), Gaps = 9/140 (6%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E+  +  G  LA++      + L GDLG+GK+ L+R +IR   H  A++  SPTFTLV+
Sbjct: 10  GEEAMMNFGARLAAVTEGVGVIFLDGDLGAGKTTLSRGMIRGFGHAGAVK--SPTFTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+  ++ V HFD YRL   +E+  +G  D    + +C+IEWP+ G   LPK  + I + 
Sbjct: 68  PYEIGAVRVFHFDLYRLVDPEELEYMGGRDYFDGDALCLIEWPQRGAGFLPKPDLTITIG 127

Query: 133 QGKTGRKATIS-----AERW 147
               GR   +S      ERW
Sbjct: 128 PHGEGRSVILSPLGSRGERW 147


>gi|83950796|ref|ZP_00959529.1| hypothetical protein ISM_06840 [Roseovarius nubinhibens ISM]
 gi|83838695|gb|EAP77991.1| hypothetical protein ISM_06840 [Roseovarius nubinhibens ISM]
          Length = 158

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/125 (41%), Positives = 71/125 (56%), Gaps = 6/125 (4%)

Query: 30  LRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFY 88
           LR GD L LSG +G+GK+  AR++I   + D   ++ SPTFTLVQ YD A+  + H D Y
Sbjct: 27  LRPGDTLLLSGPIGAGKTHFARALITARL-DAPEDIPSPTFTLVQTYDTAAGEIWHADLY 85

Query: 89  RLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQ--GKTGRKATI--SA 144
           RLS   E+VELG  +     IC++EWP+    L P   + I  S    +  R AT+  S 
Sbjct: 86  RLSDSSELVELGLTDAFETAICLVEWPDRLGPLAPAHALRIEFSPEGSEDARIATLGWSG 145

Query: 145 ERWII 149
            RW +
Sbjct: 146 PRWAL 150


>gi|320105045|ref|YP_004180636.1| hypothetical protein Isop_3530 [Isosphaera pallida ATCC 43644]
 gi|319752327|gb|ADV64087.1| Uncharacterized protein family UPF0079, ATPase [Isosphaera pallida
           ATCC 43644]
          Length = 187

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 74/123 (60%), Gaps = 3/123 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E+ T  LGR LA++ R G  + L+G LG+GK+ L +++   L  D ++ V SPTF+L+ 
Sbjct: 24  DEEATRALGRTLAAVARPGLTIALNGPLGAGKTTLVKALAEALGADPSV-VSSPTFSLIH 82

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNER--ICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+A+IP+AHFD YRL     +   G D+ L +   +C++EW +     LP+   ++ L 
Sbjct: 83  EYEAAIPLAHFDAYRLEDGAALEAAGGDDYLGDARWLCLVEWADKVADRLPETRWELRLE 142

Query: 133 QGK 135
            G+
Sbjct: 143 PGR 145


>gi|255526015|ref|ZP_05392939.1| protein of unknown function UPF0079 [Clostridium carboxidivorans
           P7]
 gi|296184763|ref|ZP_06853174.1| ATPase, YjeE family [Clostridium carboxidivorans P7]
 gi|255510275|gb|EET86591.1| protein of unknown function UPF0079 [Clostridium carboxidivorans
           P7]
 gi|296050545|gb|EFG89968.1| ATPase, YjeE family [Clostridium carboxidivorans P7]
          Length = 151

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 82/142 (57%), Gaps = 9/142 (6%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + N ++TI LG  L ++L+ GD + L+G++G+GK+   + I + L   D   + SPTFT+
Sbjct: 5   VDNVESTINLGNKLGNMLKPGDIICLNGEMGTGKTHFTKGIAKALGITDP--ITSPTFTI 62

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHL 131
           V  Y+  + + HFD YR++   E+  +GFDE I ++ + I+EW      L+P ++I + +
Sbjct: 63  VNEYEGRLKLYHFDVYRVNDPDEIEAIGFDEYIFSDAVSIVEWSNYIEELIPTEHISVKI 122

Query: 132 ----SQGKTGRKATIS--AERW 147
                +G   RK +I    ER+
Sbjct: 123 EKIPEKGIDFRKISIEYYGERY 144


>gi|225027515|ref|ZP_03716707.1| hypothetical protein EUBHAL_01771 [Eubacterium hallii DSM 3353]
 gi|224955154|gb|EEG36363.1| hypothetical protein EUBHAL_01771 [Eubacterium hallii DSM 3353]
          Length = 143

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 65/119 (54%), Gaps = 4/119 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  LG+        G    L GDLG GK+   +     L   +   V SPTFT++Q+Y
Sbjct: 9   EETFALGKQCGEKAAAGQVYCLYGDLGVGKTVFTKGFAAGLGIKEP--VSSPTFTILQVY 66

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
           D   +P  HFD YR+S  +E+ E+GF+E I  E +C IEW  +   LLP +Y +IH+ +
Sbjct: 67  DEGRLPFYHFDVYRISDPEEMYEIGFEEYIEGEGVCFIEWANLIEELLPAQYTEIHIDK 125


>gi|254464888|ref|ZP_05078299.1| uncharacterised P-loop hydrolase UPF0079 [Rhodobacterales bacterium
           Y4I]
 gi|206685796|gb|EDZ46278.1| uncharacterised P-loop hydrolase UPF0079 [Rhodobacterales bacterium
           Y4I]
          Length = 140

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (56%), Gaps = 11/134 (8%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           +   +A  LR GDCL L G +G+GK+  AR +I+ LM +   +V SPTFTLVQ YD  +P
Sbjct: 1   MAAQIAGALRPGDCLLLEGVIGAGKTHFARHLIQSLM-EVPEDVPSPTFTLVQTYD--VP 57

Query: 82  VA---HFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS---QGK 135
                H D YRLSS  E+ ELG  E  +  IC++EWP+    L P   + + L+   + +
Sbjct: 58  AGELWHTDLYRLSSLDELEELGLTEAFDSAICLVEWPDRLAELTPAHALHLTLALDPEHE 117

Query: 136 TGRKATI--SAERW 147
             R  T+  S E+W
Sbjct: 118 DRRHLTLRWSDEKW 131


>gi|226942898|ref|YP_002797971.1| ATPase, with role in cell wall biosynthesis [Azotobacter vinelandii
           DJ]
 gi|226717825|gb|ACO76996.1| ATPase, with role in cell wall biosynthesis [Azotobacter vinelandii
           DJ]
          Length = 156

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 76/143 (53%), Gaps = 9/143 (6%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E   + LG  L ++      + L GDLG+GK+ L+R I+R L H  A  V SPTFTLV+
Sbjct: 11  DEAAQLALGERLGALTGGRGTIFLHGDLGAGKTTLSRGILRGLGHAGA--VKSPTFTLVE 68

Query: 75  LYDASIPVA-HFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y      A HFD YRL+  +E+  LG  D    + +C++EWP+ G   LPK  +DI ++
Sbjct: 69  PYRIGERQAYHFDLYRLADPEELEFLGIRDYFEGDALCLVEWPQRGSGFLPKPDLDITIT 128

Query: 133 QGKTGRKATIS-----AERWIIS 150
               GR   +S      E W  S
Sbjct: 129 PQAGGRTLRLSPHGARGEAWCAS 151


>gi|169824916|ref|YP_001692527.1| hypothetical protein FMG_1219 [Finegoldia magna ATCC 29328]
 gi|167831721|dbj|BAG08637.1| conserved hypothetical protein [Finegoldia magna ATCC 29328]
          Length = 168

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 81/145 (55%), Gaps = 10/145 (6%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIR-FLMHDDALEVLSPTFTLVQL 75
           K+T   G+  A  L+  D ++L GDLG+GK+ L +SI + F + ++   V SPTF+LV  
Sbjct: 23  KDTEKFGQIFARTLKKQDVISLIGDLGAGKTTLTKSIAKSFGIEEN---VTSPTFSLVNT 79

Query: 76  YDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQ- 133
           Y  +I + H D YRL    E+  L  DE+L  E I IIEW    +S +P+  I+I++ + 
Sbjct: 80  YYGNIQLNHIDLYRLEDEMEIESLDIDELLYPEGITIIEWASQAQSYMPRNLIEIYIEKT 139

Query: 134 GKTGRKATISA----ERWIISHINQ 154
           G   RK  I      E+ II  +N+
Sbjct: 140 GDVSRKIRIDGNNKREKEIIEELNE 164


>gi|312882820|ref|ZP_07742553.1| hypothetical protein VIBC2010_11471 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309369512|gb|EFP97031.1| hypothetical protein VIBC2010_11471 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 154

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 75/136 (55%), Gaps = 4/136 (2%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
             + +EK TI LG  LA I      + L GDLG+GK+  +R  I  L H     V SPT+
Sbjct: 6   FALKDEKATISLGAQLAKICFKQTTIYLYGDLGAGKTTFSRGFITALGHIGT--VKSPTY 63

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYID 128
           TLV+ Y+     V HFD YRLS  +E+  +G  D   ++ IC++EWP+ G+ +LP+  I 
Sbjct: 64  TLVEPYELEQWHVFHFDLYRLSDAEELEFMGIRDYFSSDAICLVEWPQRGQGILPEADIT 123

Query: 129 IHLSQGKTGRKATISA 144
           + L    T R A + A
Sbjct: 124 LDLRYDGTARVAELVA 139


>gi|168185957|ref|ZP_02620592.1| conserved hypothetical protein [Clostridium botulinum C str.
           Eklund]
 gi|169296032|gb|EDS78165.1| conserved hypothetical protein [Clostridium botulinum C str.
           Eklund]
          Length = 152

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 79/135 (58%), Gaps = 7/135 (5%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + N  +T+ +G  + ++   GD + L GDLG+GK+ + + I + L  D+   + SPTF +
Sbjct: 5   VNNVDSTVNIGYQIGALANSGDIICLIGDLGTGKTHITKGIAKGLGIDE--HITSPTFNI 62

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHL 131
           V  Y+ ++ + HFD YR++   E+  +GFDE I  + + IIEW      L+P++Y++I +
Sbjct: 63  VNEYEGNLKLYHFDVYRVNDPDEIEAIGFDEYIFGDGVSIIEWANYIEELIPEEYLNITI 122

Query: 132 SQ----GKTGRKATI 142
            +    G+  RK T+
Sbjct: 123 EKMPELGENFRKITL 137


>gi|323491078|ref|ZP_08096269.1| ATPase YjeE [Vibrio brasiliensis LMG 20546]
 gi|323314658|gb|EGA67731.1| ATPase YjeE [Vibrio brasiliensis LMG 20546]
          Length = 154

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 73/134 (54%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ TI LG  LA +      + L GDLG+GK+  +R  +R L H     V SPT+TL
Sbjct: 8   LKDEQATIQLGTALAHLCSQQTTIYLHGDLGAGKTTFSRGFVRALGHQG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      V HFD YRL+  +E+  +G  D    + IC++EWPE G+ LLP   +DI 
Sbjct: 66  VEPYQLDQWQVYHFDLYRLADPEELEFMGIRDYFTPDAICLVEWPEKGQGLLPDADLDID 125

Query: 131 LSQGKTGRKATISA 144
           L      R   ++A
Sbjct: 126 LRYDGEARVVQLTA 139


>gi|28872060|ref|NP_794679.1| hypothetical protein PSPTO_4946 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213967920|ref|ZP_03396066.1| conserved hypothetical protein TIGR00150 [Pseudomonas syringae pv.
           tomato T1]
 gi|28855313|gb|AAO58374.1| conserved protein of unknown function [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927263|gb|EEB60812.1| conserved hypothetical protein TIGR00150 [Pseudomonas syringae pv.
           tomato T1]
          Length = 142

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 73/135 (54%), Gaps = 9/135 (6%)

Query: 20  ICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-A 78
           +  G  LA +      + L GDLG+GK+ L+R +IR   H  A  V SPTFTLV+ Y+  
Sbjct: 1   MSFGARLAQVTEGAGVIFLDGDLGAGKTTLSRGMIRGFGHAGA--VKSPTFTLVEPYEIG 58

Query: 79  SIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTG 137
           +I V HFD YRL   +E+  +G  D   ++ +C+IEWP+ G   LPK  + I +     G
Sbjct: 59  AIRVFHFDLYRLVDPEELEYMGARDYFDDDALCLIEWPQRGAGFLPKPDLTITIGPHGEG 118

Query: 138 RKATIS-----AERW 147
           R   +S      ERW
Sbjct: 119 RSVILSPLGSRGERW 133


>gi|85710760|ref|ZP_01041821.1| Predicted ATPase or kinase [Idiomarina baltica OS145]
 gi|85695164|gb|EAQ33101.1| Predicted ATPase or kinase [Idiomarina baltica OS145]
          Length = 153

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 79/142 (55%), Gaps = 4/142 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T    + LA + +    + L+G LG+GK+ L+R  I+ L H  A  V SPT+TL
Sbjct: 9   LADEAATQTWAKRLAQLAKAPLVIYLNGPLGAGKTALSRGFIQALGHAGA--VKSPTYTL 66

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ YD   I V HFD YRL+  +E+  +G  +  ++R + +IEWPE G   LPK  I I+
Sbjct: 67  VEPYDLGDIAVYHFDLYRLADPEELEFMGIRDYFSQRSMSLIEWPERGEGWLPKADIVIN 126

Query: 131 LSQGKTGRKATISAERWIISHI 152
           ++    GR+    A   I  HI
Sbjct: 127 VAYENEGRQLECIARTPIGEHI 148


>gi|118590596|ref|ZP_01547998.1| hypothetical protein SIAM614_03436 [Stappia aggregata IAM 12614]
 gi|118437059|gb|EAV43698.1| hypothetical protein SIAM614_03436 [Stappia aggregata IAM 12614]
          Length = 508

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 56/124 (45%), Positives = 76/124 (61%), Gaps = 1/124 (0%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I I +E+ T  L   +A +L+ GD + LSGDLG+GKS   R++IR    D  LEV SPTF
Sbjct: 16  IDIADEQGTRRLANDIAMVLKPGDVICLSGDLGAGKSTFTRALIRAFAGDPDLEVPSPTF 75

Query: 71  TLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
           TLVQ Y+     ++HFD YRL   +E+ ELG D++L     +IEWPE    LLP   + I
Sbjct: 76  TLVQTYEFDRFDLSHFDLYRLEEPEELEELGLDDLLETGAALIEWPEKADGLLPGNALWI 135

Query: 130 HLSQ 133
            ++Q
Sbjct: 136 QITQ 139


>gi|257457503|ref|ZP_05622671.1| conserved hypothetical protein [Treponema vincentii ATCC 35580]
 gi|257445126|gb|EEV20201.1| conserved hypothetical protein [Treponema vincentii ATCC 35580]
          Length = 151

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 75/131 (57%), Gaps = 4/131 (3%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
            TI  GR L  +L  GD L L G L +GK+ L + I + L  D +  V SPTFT++  Y 
Sbjct: 10  ETINFGRALGRLLHAGDVLALQGTLAAGKTQLTKGIAQGL--DISEAVTSPTFTIISEYY 67

Query: 78  ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQGKT 136
             +P+ H D YRL+S ++ ++LG +++L  + +CIIEW E   S LP + I IH+ + + 
Sbjct: 68  GRLPLYHVDVYRLNSPEDFLDLGVEDMLYGQGVCIIEWSEKVLSELPARTILIHI-KAEE 126

Query: 137 GRKATISAERW 147
               TI+   W
Sbjct: 127 DSSRTITITNW 137


>gi|289672576|ref|ZP_06493466.1| hypothetical protein PsyrpsF_04985 [Pseudomonas syringae pv.
           syringae FF5]
 gi|330899888|gb|EGH31307.1| hypothetical protein PSYJA_20918 [Pseudomonas syringae pv. japonica
           str. M301072PT]
 gi|330939862|gb|EGH43094.1| hypothetical protein PSYPI_12119 [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330978954|gb|EGH78013.1| hypothetical protein PSYAP_15234 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 156

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 75/140 (53%), Gaps = 9/140 (6%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E+  +  G  LA +      + L GDLG+GK+ L+R +IR   H  A++  SPTFTLV+
Sbjct: 10  GEEAMMDFGARLAKVTEGLGVIFLDGDLGAGKTTLSRGLIRGFGHVGAVK--SPTFTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+  +I V HFD YRL   +E+  +G  D    + +C+IEWP+ G   LPK  + I + 
Sbjct: 68  PYEIGAIKVFHFDLYRLVDPEELEYMGVRDYFDGDALCLIEWPQRGAGFLPKPDLTITIG 127

Query: 133 QGKTGRKATIS-----AERW 147
               GR   +S      ERW
Sbjct: 128 PHGEGRSVILSPLGSRGERW 147


>gi|156740723|ref|YP_001430852.1| hypothetical protein Rcas_0713 [Roseiflexus castenholzii DSM 13941]
 gi|156232051|gb|ABU56834.1| protein of unknown function UPF0079 [Roseiflexus castenholzii DSM
           13941]
          Length = 187

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 71/122 (58%), Gaps = 8/122 (6%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
            TI +G+ L  +L+ GD + L GDLG+GK+ L + I++ L   D +   SP+F L+  Y 
Sbjct: 38  QTIRIGQRLGELLQHGDVVALRGDLGAGKTHLIKGIVQGLGSTDVVN--SPSFVLINQYR 95

Query: 78  A-----SIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHL 131
           A      +P+ H D YR+    E+  +G +E L+ + +C+IEW E   +LLP   +D+HL
Sbjct: 96  AGAQRGGMPIYHADLYRIERPAELYGVGLEEALDGDGVCLIEWAERAEALLPDDRLDVHL 155

Query: 132 SQ 133
           S 
Sbjct: 156 SH 157


>gi|325290785|ref|YP_004266966.1| Uncharacterized protein family UPF0079, ATPase [Syntrophobotulus
           glycolicus DSM 8271]
 gi|324966186|gb|ADY56965.1| Uncharacterized protein family UPF0079, ATPase [Syntrophobotulus
           glycolicus DSM 8271]
          Length = 153

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 78/139 (56%), Gaps = 9/139 (6%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T   G  L S+   G+ L L+G+LG+GK+ LA+ + + L   +  +V SPTFT++Q Y
Sbjct: 11  EQTFAFGSKLGSLFSGGEVLCLNGELGAGKTVLAKGLAKALAVKE--QVTSPTFTMIQEY 68

Query: 77  DASI---PV--AHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
              I   PV   H D YRL + +E   +G  +   E  IC++EWPE+   +LP++ IDI 
Sbjct: 69  QGQIKGQPVRLVHMDLYRLRNAEEAEIIGVPDYFREDCICLLEWPEVIEDILPEEKIDIS 128

Query: 131 -LSQGKTGRKATISAERWI 148
            L  G+  R+  I A+  I
Sbjct: 129 ILGSGEEEREILIRADEQI 147


>gi|163745133|ref|ZP_02152493.1| hypothetical protein OIHEL45_06080 [Oceanibulbus indolifex HEL-45]
 gi|161381951|gb|EDQ06360.1| hypothetical protein OIHEL45_06080 [Oceanibulbus indolifex HEL-45]
          Length = 157

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 74/126 (58%), Gaps = 3/126 (2%)

Query: 23  GRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA-SIP 81
            + LA  L  GD L LSGD+G+GK+  AR++I F + +   ++ SPTFTLVQ YD  S  
Sbjct: 20  AQQLARRLTPGDVLLLSGDVGAGKTHFARALI-FELLEFPEDIPSPTFTLVQTYDGQSGA 78

Query: 82  VAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKAT 141
           + H D YRL+S  E+ ELG  E   + IC++EWP+    L P   + I+L+ G       
Sbjct: 79  IWHADLYRLTSTYEIEELGLVEAFLDAICLVEWPDRLGPLAPAGALHINLTPGPEEDSRA 138

Query: 142 ISAERW 147
           ++A +W
Sbjct: 139 LTA-KW 143


>gi|149199081|ref|ZP_01876121.1| putative nucleotide-binding protein [Lentisphaera araneosa
           HTCC2155]
 gi|149137870|gb|EDM26283.1| putative nucleotide-binding protein [Lentisphaera araneosa
           HTCC2155]
          Length = 140

 Score = 85.9 bits (211), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 78/130 (60%), Gaps = 7/130 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E+ T  +    A  +   + +TL GDLG+GKS  AR+ ++ L    A  + SPTF+LV 
Sbjct: 5   SEQETATIAADFAKRISAPNVITLCGDLGAGKSCFARAFLQSLGVKGA--ITSPTFSLVN 62

Query: 75  LY--DASIPVAHFDFYRLSSHQEVVELGFDEILNE--RICIIEWPEIGRSLLPKKYIDIH 130
           LY  ++ + +AH D YRL   +E  + G +EIL++   I ++EWPE    +LPK  + I+
Sbjct: 63  LYQSESGVQLAHMDLYRLEDDEEAYQAGIEEILHDPNTISLVEWPERLSWMLPKDALAIN 122

Query: 131 LS-QGKTGRK 139
           +S QG+T RK
Sbjct: 123 ISHQGETERK 132


>gi|148658437|ref|YP_001278642.1| hypothetical protein RoseRS_4357 [Roseiflexus sp. RS-1]
 gi|148570547|gb|ABQ92692.1| protein of unknown function UPF0079 [Roseiflexus sp. RS-1]
          Length = 189

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 72/122 (59%), Gaps = 8/122 (6%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
            TI +G+ L  +L+ GD + L GDLG+GK+ L + I+  L   D   V SP+F L+  Y 
Sbjct: 40  QTIRVGQRLGELLQRGDVVALRGDLGTGKTHLVKGIVLGLGSTDT--VNSPSFVLINQYR 97

Query: 78  AS-----IPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHL 131
           AS     +P+ H D YR+    E+  +G +E+L+ + +C+IEW +    LLP + +D+HL
Sbjct: 98  ASAQRGDLPIYHADLYRIERPAELQGVGLEELLDGDGVCLIEWADHAEPLLPDERLDVHL 157

Query: 132 SQ 133
           S 
Sbjct: 158 SH 159


>gi|85708407|ref|ZP_01039473.1| predicted ATPase [Erythrobacter sp. NAP1]
 gi|85689941|gb|EAQ29944.1| predicted ATPase [Erythrobacter sp. NAP1]
          Length = 151

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 60/98 (61%), Gaps = 5/98 (5%)

Query: 21  CLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS- 79
             G  +A+ L+ GD + L G LG+GK+ LAR+II  L ++   EV SPTFT+++ YD   
Sbjct: 17  AFGARIAAKLKSGDVIALEGGLGAGKTTLARAIIAALGYEG--EVPSPTFTIIETYDPPA 74

Query: 80  --IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWP 115
             +P+AH DFYRL    EV E+G D+     + I EWP
Sbjct: 75  VRLPIAHADFYRLEDPSEVEEIGLDDYREGAVLIAEWP 112


>gi|325271239|ref|ZP_08137784.1| hypothetical protein G1E_00551 [Pseudomonas sp. TJI-51]
 gi|324103642|gb|EGC00944.1| hypothetical protein G1E_00551 [Pseudomonas sp. TJI-51]
          Length = 157

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 78/145 (53%), Gaps = 9/145 (6%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+  G  +A +      + L GDLG+GK+ L+R +IR L H  A  V SPTFT+
Sbjct: 8   LADEAATVDFGAKMAEVTGGRGVIFLEGDLGAGKTTLSRGLIRGLGHTGA--VKSPTFTV 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+  ++   HFD YRL   +E+  +G  D    + +C+ EWP+ G  +LPK  + I 
Sbjct: 66  VEPYEIGAVRAFHFDLYRLVDPEELEFMGIRDYFEGDPLCLFEWPQKGAGVLPKPDLTIT 125

Query: 131 LSQGKTGRKATIS-----AERWIIS 150
           +S    GR   +S      E W ++
Sbjct: 126 ISPQAGGRSLNLSPQGARGEAWCVA 150


>gi|83859065|ref|ZP_00952586.1| hypothetical protein OA2633_11710 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852512|gb|EAP90365.1| hypothetical protein OA2633_11710 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 153

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 71/132 (53%), Gaps = 4/132 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ +P+      LG  LA  L++GD + L G LG+GK+ LAR +I  L      +  SPT
Sbjct: 5   VLSLPDPAANAALGARLARELKVGDAVLLEGGLGAGKTTLARGVIEALTG--IADAPSPT 62

Query: 70  FTLVQLYDA--SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYI 127
           +TLVQ Y+    + + H D YRL   +E+ ELG DE L+    +IEWP+      P   +
Sbjct: 63  YTLVQHYETKDGLVLLHADLYRLEDPEELDELGVDEALDHGAALIEWPDRMGGWRPADRL 122

Query: 128 DIHLSQGKTGRK 139
           +I L   + G +
Sbjct: 123 EITLEDTEAGGR 134


>gi|146295282|ref|YP_001179053.1| hypothetical protein Csac_0214 [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145408858|gb|ABP65862.1| protein of unknown function UPF0079 [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 155

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 69/117 (58%), Gaps = 5/117 (4%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
            TI +G  +   L  G  +TL GDLGSGK+ L R I R    DD   + SPTFT+  +Y+
Sbjct: 11  ETISIGYKIGKNLFKGAIVTLQGDLGSGKTALVRGIARAFSIDD---ISSPTFTIFHIYE 67

Query: 78  ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
             +PV HFD YR+    E+ ++G++E   N+ + +IEW +  + L PK+Y+ I + +
Sbjct: 68  GKLPVYHFDIYRI-EEDELEDIGYEEYFYNDGVTLIEWADKLKRLYPKEYLKIVIEK 123


>gi|328948259|ref|YP_004365596.1| hypothetical protein Tresu_1393 [Treponema succinifaciens DSM 2489]
 gi|328448583|gb|AEB14299.1| Uncharacterized protein family UPF0079, ATPase [Treponema
           succinifaciens DSM 2489]
          Length = 148

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 74/131 (56%), Gaps = 5/131 (3%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           TI LG  + S+L+ GD L ++G L +GK+ + + I + L   D   + SPTF LV  Y+ 
Sbjct: 11  TISLGEKIGSLLKPGDILAMTGTLAAGKTTITKGIAKSLGVKD--NITSPTFCLVSEYEG 68

Query: 79  -SIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQGKT 136
             +P+ H D YRL   ++ V LG +++L    +CIIEW E  +  LP+K I + ++  + 
Sbjct: 69  EKMPLYHMDVYRLEGEEDFVNLGVEDMLYGNGVCIIEWSEKVKKELPQKSILVEITPQED 128

Query: 137 GRKATISAERW 147
           G +  I  E W
Sbjct: 129 GSRK-IKIENW 138


>gi|83590983|ref|YP_430992.1| hypothetical protein Moth_2160 [Moorella thermoacetica ATCC 39073]
 gi|83573897|gb|ABC20449.1| Protein of unknown function UPF0079 [Moorella thermoacetica ATCC
           39073]
          Length = 155

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/127 (38%), Positives = 69/127 (54%), Gaps = 3/127 (2%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           T  LG  LA IL  GD L L+G+LG+GK+ L + + + L       V SPTFTL+Q Y  
Sbjct: 11  TRKLGEELAGILNPGDILILNGELGAGKTTLTQGLAQGL--GVTTPVTSPTFTLIQEYRG 68

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQGKTG 137
             P+ H D YRL   + +++LG +E    E I ++EW       LP  +++I L     G
Sbjct: 69  RYPLYHIDLYRLEDPEAMLDLGLEEYFGGEGITVVEWGGRLDPYLPPAFLEIKLEYAPEG 128

Query: 138 RKATISA 144
           R+A I A
Sbjct: 129 RRAIIKA 135


>gi|188535089|ref|YP_001908886.1| putative ATPase [Erwinia tasmaniensis Et1/99]
 gi|188030131|emb|CAO98017.1| Conserved hypothetical protein YjeE [Erwinia tasmaniensis Et1/99]
          Length = 158

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 78/139 (56%), Gaps = 8/139 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI +P+E  T+ LG  LA        L L G LG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VIALPDEAATLELGASLARACEGAATLYLYGSLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYDASIP---VAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKK 125
           +TLV+ Y   +P   V HFD YRLS  +E+  +G  D    + +C++EWP+ G  +LP+ 
Sbjct: 63  YTLVEPY--VLPDRRVYHFDLYRLSDPEELEFMGIRDYFGPDSLCLVEWPQQGTGVLPEP 120

Query: 126 YIDIHLSQGKTGRKATISA 144
            +++HLS     R+A + A
Sbjct: 121 DLELHLSYQGHAREALLRA 139


>gi|170723847|ref|YP_001751535.1| hypothetical protein PputW619_4689 [Pseudomonas putida W619]
 gi|169761850|gb|ACA75166.1| protein of unknown function UPF0079 [Pseudomonas putida W619]
          Length = 157

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (55%), Gaps = 4/135 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ T+  G  LA +      + L GDLG+GK+ L+R +IR L H  A  V SPTFT+
Sbjct: 8   LADEEATVKFGASLAEVTGGRGIIFLEGDLGAGKTTLSRGLIRGLGHTGA--VKSPTFTV 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+   +   HFD YRL   +E+  +G  D    + +C+ EWPE G  +LPK  + I 
Sbjct: 66  VEPYEIGDVRAFHFDLYRLVDPEELEFMGIRDYFEGDPLCLFEWPEKGAGVLPKPDLTIT 125

Query: 131 LSQGKTGRKATISAE 145
           +S    GR   +S +
Sbjct: 126 ISPQAGGRSLILSPQ 140


>gi|59712934|ref|YP_205710.1| ATPase with strong ADP affinity [Vibrio fischeri ES114]
 gi|59481035|gb|AAW86822.1| ATPase with strong ADP affinity [Vibrio fischeri ES114]
          Length = 154

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +  E +T+  GR L+        + L GDLG+GK+  +R  IR L H     V SPT+TL
Sbjct: 8   LATEDDTVEFGRQLSQACTQQTTIFLHGDLGAGKTTFSRGFIRSLGH--TGNVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+     V HFD YRL+  +E+  +G  D   ++ IC++EWPE G  LLP   +DI 
Sbjct: 66  VEPYELDQWQVYHFDLYRLADPEELEFMGIRDYFTDDAICLVEWPEKGEGLLPAPDLDID 125

Query: 131 LSQGKTGRKATISA 144
           +      R   I+ 
Sbjct: 126 IRYDGEARHVVITG 139


>gi|308188273|ref|YP_003932404.1| UPF0079 ATP-binding protein yjeE [Pantoea vagans C9-1]
 gi|308058783|gb|ADO10955.1| UPF0079 ATP-binding protein yjeE [Pantoea vagans C9-1]
          Length = 158

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 10/152 (6%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI +P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VISLPDEAATLNLGAQLARACGSAAVIYLYGDLGAGKTTFSRGFLQALGHKG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y      + HFD YRL+  +E+  +G  D    E IC++EWP+ G   LP+  +
Sbjct: 63  YTLVEPYSLDDRTLYHFDLYRLADPEELEFMGIRDYFSGEAICLVEWPQQGAGFLPQPDL 122

Query: 128 DIHLSQGKTGRKATISA-----ERWIISHINQ 154
            + L      R+A ++A     ++W + H+ Q
Sbjct: 123 TLTLRYVGEAREAELTAQSASGQQW-LEHVGQ 153


>gi|167626765|ref|YP_001677265.1| hypothetical protein Fphi_0546 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167596766|gb|ABZ86764.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 125

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 70/121 (57%), Gaps = 4/121 (3%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASI 80
             +  A  L+ G  + L GDLG+GK+   + +++ L +     V SPT+TLV+ Y+  + 
Sbjct: 4   FAQEYAKKLQAGQIIYLHGDLGAGKTTFVKGVLKSLGYKG--NVKSPTYTLVESYEFDNF 61

Query: 81  PVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLSQGKTGRK 139
            + HFD YRL+  +E+  +G  + LN+  IC +EWPE GR  LPK  ID+++     GR+
Sbjct: 62  NIYHFDLYRLADPEELEWIGIRDYLNDNSICFVEWPEKGRGFLPKNSIDVYIKYLPEGRQ 121

Query: 140 A 140
            
Sbjct: 122 V 122


>gi|146305666|ref|YP_001186131.1| hypothetical protein Pmen_0631 [Pseudomonas mendocina ymp]
 gi|145573867|gb|ABP83399.1| protein of unknown function UPF0079 [Pseudomonas mendocina ymp]
          Length = 155

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 72/126 (57%), Gaps = 4/126 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E   + LG  +A        + L GDLG+GK+ L+R ++R L H  A  V SPTFTLV+
Sbjct: 10  DEAAMLALGARIAQASGGVGVIYLHGDLGAGKTTLSRGMLRGLGHAGA--VKSPTFTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+  ++   HFD YRL   +E+  LG  D    + +C+IEWPE G  +LPK  +DI +S
Sbjct: 68  PYEIGALRAFHFDLYRLVDPEELEFLGIRDYFEGDALCLIEWPERGAGVLPKPDLDITIS 127

Query: 133 QGKTGR 138
               GR
Sbjct: 128 PQAGGR 133


>gi|323706060|ref|ZP_08117630.1| hypothetical protein family UPF0079, ATPase [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323534674|gb|EGB24455.1| hypothetical protein family UPF0079, ATPase [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 152

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 73/125 (58%), Gaps = 3/125 (2%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           +G  L  +L  G  + +SGDLG GK+ L + I + +   D   V SPTF +V  +   IP
Sbjct: 16  IGFKLGGLLTRGSIVLISGDLGVGKTVLTKGIAKGMGIYDY--VTSPTFMIVNEHMGEIP 73

Query: 82  VAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKA 140
           + HFD YR+  + E+ ++G++E   ++ +C+IEWPE    L+P++ I IH+S G +  + 
Sbjct: 74  LYHFDVYRIDDYMELYDIGYEEYFYSDGVCVIEWPEKIMPLIPEENIFIHISMGDSFDER 133

Query: 141 TISAE 145
            I  E
Sbjct: 134 IIEIE 138


>gi|302189793|ref|ZP_07266466.1| hypothetical protein Psyrps6_25754 [Pseudomonas syringae pv.
           syringae 642]
          Length = 156

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 75/140 (53%), Gaps = 9/140 (6%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E+  +  G  LA +      + L GDLG+GK+ L+R +IR   H  A++  SPTFTLV+
Sbjct: 10  GEEAMMDFGARLARVTEGLGVIFLDGDLGAGKTTLSRGLIRGFGHVGAVK--SPTFTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+  +I V HFD YRL   +E+  +G  D    + +C+IEWP+ G   LPK  + I + 
Sbjct: 68  PYEIGAIKVFHFDLYRLVDPEELEYMGVRDYFDGDALCLIEWPQRGAGFLPKPDLTITIG 127

Query: 133 QGKTGRKATIS-----AERW 147
               GR   +S      ERW
Sbjct: 128 PHGEGRSVILSPLGSRGERW 147


>gi|291619094|ref|YP_003521836.1| YjeE [Pantoea ananatis LMG 20103]
 gi|291154124|gb|ADD78708.1| YjeE [Pantoea ananatis LMG 20103]
 gi|327395426|dbj|BAK12848.1| hypothetical UPF0079 protein YjeE [Pantoea ananatis AJ13355]
          Length = 158

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 77/146 (52%), Gaps = 9/146 (6%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI +PNE  T+ LG  LA        + L GDLG+GK+  +R  ++   H     V SPT
Sbjct: 5   VISLPNEAATLELGAQLAQACGNAAVIYLYGDLGAGKTTFSRGFLQASGHPG--NVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y      V HFD YRL+  +E+  +G  D   N+ +C++EWP+ G  +LP   +
Sbjct: 63  YTLVEPYVLEGRSVYHFDLYRLADPEELEFMGIRDYFTNDAVCLVEWPQQGAGILPPPDV 122

Query: 128 DIHLSQGKTGRKATISA-----ERWI 148
            + L      R+A + A     +RW+
Sbjct: 123 ALTLRYVDEARQAELVAHSAQGQRWV 148


>gi|28212028|ref|NP_782972.1| ATP/GTP hydrolase [Clostridium tetani E88]
 gi|28204471|gb|AAO36909.1| ATP/GTP hydrolase [Clostridium tetani E88]
          Length = 163

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 75/131 (57%), Gaps = 9/131 (6%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFL-MHDDALEVLSPTFTLVQLYD 77
           TI +G  +  +   GD + L GDLG+GK+ L + I + L +H+    + SPTF +V  Y+
Sbjct: 22  TISIGEQIGKLAHAGDIICLEGDLGTGKTHLTKGIAKGLGIHN---TITSPTFNIVNEYE 78

Query: 78  ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQGK- 135
             +   HFD YR++   E+  +GFDE I ++ + +IEW    + L+P++Y++I + +   
Sbjct: 79  GRLKFYHFDVYRVNDPDEIYAIGFDEYIFSDAVTVIEWSNYIKELIPEEYMNILVEKNSK 138

Query: 136 ---TGRKATIS 143
                RK TI+
Sbjct: 139 NDFNSRKITIT 149


>gi|18311146|ref|NP_563080.1| hypothetical protein CPE2164 [Clostridium perfringens str. 13]
 gi|18145829|dbj|BAB81870.1| conserved hypothetical protein [Clostridium perfringens str. 13]
          Length = 154

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 78/132 (59%), Gaps = 8/132 (6%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           T+ +GR L S++  GD L L+GDLG+GK+ +++ I   L  D+   + SPTF +V  Y +
Sbjct: 11  TMHIGRQLGSLVNKGDILCLTGDLGTGKTHISKGIAEGLGIDE--HITSPTFNIVNEYHS 68

Query: 79  S-IPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQ--- 133
             + + HFD YR++   E+  +GFDE I  + + +IEW      L+P++YI I + +   
Sbjct: 69  GRLTLYHFDVYRVNDPDEIEAIGFDEYIFGDGVSLIEWANYIEELIPEEYIHIKIEKLPD 128

Query: 134 -GKTGRKATISA 144
            G+  RK TI+ 
Sbjct: 129 MGENFRKITING 140


>gi|118443294|ref|YP_878972.1| hypothetical protein NT01CX_0502 [Clostridium novyi NT]
 gi|118133750|gb|ABK60794.1| Uncharacterised P-loop hydrolase UPF0079 [Clostridium novyi NT]
          Length = 152

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 79/136 (58%), Gaps = 7/136 (5%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + N  +T+ +G  +  +   GD + L GDLG+GK+ + + I + L  D+   + SPTF +
Sbjct: 5   VNNVDSTVDIGYQIGKLANSGDIICLIGDLGTGKTHITKGIAKGLGIDE--HITSPTFNI 62

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHL 131
           V  Y+ ++ + HFD YR++   E+  +GFDE I  + + IIEW      L+P++Y+++ +
Sbjct: 63  VNEYEGNLKLYHFDVYRVNDPDEIEAIGFDEYIFGDGVSIIEWANYIEELIPEEYLNVTI 122

Query: 132 SQ----GKTGRKATIS 143
            +    G+  RK T++
Sbjct: 123 EKMPELGENFRKITLT 138


>gi|119468158|ref|ZP_01611284.1| hypothetical protein ATW7_14741 [Alteromonadales bacterium TW-7]
 gi|119448151|gb|EAW29415.1| hypothetical protein ATW7_14741 [Alteromonadales bacterium TW-7]
          Length = 155

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 76/137 (55%), Gaps = 9/137 (6%)

Query: 5   EKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALE 64
           E HL      +E  T+ +G+ +A+++  G  + L GDLG+GK+   R +++   H    +
Sbjct: 6   ESHLN-----DELATVAMGKQVAAVIEQGAVIYLHGDLGAGKTTFTRGVVQGFGHTG--K 58

Query: 65  VLSPTFTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLL 122
           V SPT+TLV+ Y+     V HFD YRL   +E+  +G  +  + + IC++EWPE G   +
Sbjct: 59  VKSPTYTLVEPYELDRANVYHFDLYRLGDPEELEFMGIRDYFSPQAICVVEWPEKGGEFI 118

Query: 123 PKKYIDIHLSQGKTGRK 139
           P   +DI LS     RK
Sbjct: 119 PVPDLDITLSYVGDERK 135


>gi|261254061|ref|ZP_05946634.1| ATPase YjeE [Vibrio orientalis CIP 102891]
 gi|260937452|gb|EEX93441.1| ATPase YjeE [Vibrio orientalis CIP 102891]
          Length = 154

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ TI LG  LA++      + L GDLG+GK+  +R  +R L H     V SPT+TL
Sbjct: 8   LKDEQATIQLGTALANLCSQQTTIYLHGDLGAGKTTFSRGFVRALGHQG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      V HFD YRL+  +E+  +G  D    + IC++EWPE G  LLP+  +DI 
Sbjct: 66  VEPYQLDQWQVYHFDLYRLADPEELEFMGIRDYFTPDAICLVEWPEKGHGLLPEPDLDID 125

Query: 131 LSQGKTGRKATISA 144
           L      R   ++A
Sbjct: 126 LRYQGEERVVELTA 139


>gi|153856048|ref|ZP_01996951.1| hypothetical protein DORLON_02979 [Dorea longicatena DSM 13814]
 gi|149751738|gb|EDM61669.1| hypothetical protein DORLON_02979 [Dorea longicatena DSM 13814]
          Length = 168

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 76/142 (53%), Gaps = 8/142 (5%)

Query: 7   HLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
            L +I   +EK T  LG  L      G   TL GDLG GK+   + + + L  D+   V 
Sbjct: 26  ELMIIETNSEKETWDLGFSLGEKACAGQVYTLVGDLGVGKTIFTKGLAKGLGIDEP--VS 83

Query: 67  SPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPK 124
           SPTFT+VQ+YD   +P  HFD YR+   +E+ E+G+ D I  E + +IEW  +   +LP+
Sbjct: 84  SPTFTIVQIYDEGRLPFYHFDVYRIGDVEEMDEIGYEDYIYGEGVSLIEWANLIEEILPE 143

Query: 125 KYIDIH----LSQGKTGRKATI 142
            Y +I     L +G   R+ TI
Sbjct: 144 HYTEIKIEKDLEKGFDYRRITI 165


>gi|298484918|ref|ZP_07003017.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298160605|gb|EFI01627.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
          Length = 143

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 73/133 (54%), Gaps = 9/133 (6%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASI 80
            G  LA++      + L GDLG+GK+ L+R +IR   H  A++  SPTFTLV+ Y+  +I
Sbjct: 4   FGARLAAVTEGVGVIFLDGDLGAGKTTLSRGMIRGFGHAGAVK--SPTFTLVEPYEIGAI 61

Query: 81  PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRK 139
            V HFD YRL   +E+  +G  D    + +C+IEWP+ G   LPK  + I +     GR 
Sbjct: 62  RVFHFDLYRLVDPEELEYMGVRDYFDGDALCLIEWPQRGAGFLPKPDLTITIGPHGEGRS 121

Query: 140 ATIS-----AERW 147
             +S      ERW
Sbjct: 122 VILSPLGSRGERW 134


>gi|291522084|emb|CBK80377.1| conserved hypothetical nucleotide-binding protein [Coprococcus
           catus GD/7]
          Length = 145

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 71/135 (52%), Gaps = 8/135 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  +G  +    + GD L L GDLG GK+   +     L   +   V SPTFT+VQ Y
Sbjct: 9   EETYKIGEQMGREAKAGDVLCLLGDLGVGKTVFTQGFAAGLGITEP--VSSPTFTIVQTY 66

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKY----IDIH 130
           D   +P  HFD YR+   +E+ E+GFDE I  E +C+IEW  +   +LP  Y    I+  
Sbjct: 67  DEGRMPFYHFDVYRIGDVEEMEEIGFDEYIFGEGVCLIEWANLIEEILPPHYQTVRIEKV 126

Query: 131 LSQGKTGRKATISAE 145
           L +G   R  TI AE
Sbjct: 127 LEKGFDYRMITIEAE 141


>gi|56698680|ref|YP_169057.1| hypothetical protein SPO3869 [Ruegeria pomeroyi DSS-3]
 gi|56680417|gb|AAV97083.1| conserved hypothetical protein TIGR00150 [Ruegeria pomeroyi DSS-3]
          Length = 157

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/119 (42%), Positives = 70/119 (58%), Gaps = 4/119 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N   T  L   L + L  GDCL LSG++GSGK+  AR +I+ L+   A ++ SPTFTLVQ
Sbjct: 12  NPDETAHLAVRLGAALAPGDCLLLSGEIGSGKTHFARHLIQSLL-PVAEDIPSPTFTLVQ 70

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           +YD A   + H D YRL+   E+ ELG  E  ++ I ++EWP+    L P     +HLS
Sbjct: 71  VYDSARGEIWHSDLYRLTGLDEIEELGLSEAFSDAITLVEWPDRLGPLTPDHA--LHLS 127


>gi|148981053|ref|ZP_01816273.1| putative nucleotide-binding protein [Vibrionales bacterium SWAT-3]
 gi|145961029|gb|EDK26352.1| putative nucleotide-binding protein [Vibrionales bacterium SWAT-3]
          Length = 154

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 76/134 (56%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ TI LG  L+++      + L GDLG+GK+  +R  ++ L H     V SPT+TL
Sbjct: 8   LKDEQATIQLGTELSNLCSQQTTIYLHGDLGAGKTTFSRGFVKALGHQG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y  A   V HFD YRL+  +E+  +G  D    + IC++EWPE G  LLP+  +DI 
Sbjct: 66  VEPYQLADWQVYHFDLYRLADPEELEFMGIRDYFTPDAICLVEWPEKGYGLLPEADMDID 125

Query: 131 LSQGKTGRKATISA 144
           +      R  +++A
Sbjct: 126 IRYQDDHRIVSLTA 139


>gi|253681033|ref|ZP_04861836.1| ATPase, YjeE family [Clostridium botulinum D str. 1873]
 gi|253562882|gb|EES92328.1| ATPase, YjeE family [Clostridium botulinum D str. 1873]
          Length = 152

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 75/131 (57%), Gaps = 9/131 (6%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFL-MHDDALEVLSPTFTLVQLYD 77
           T+ +G  +  ++  GD + L GDLG+GK+ + + I + L +HD    + SPTF +V  Y 
Sbjct: 11  TVDIGLQIGKLVNRGDIICLIGDLGTGKTHITKGIAKGLEIHD---HITSPTFNIVNEYK 67

Query: 78  ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQ--- 133
             + + HFD YR++   E+  +GFDE I  + + I+EW      L+PK+Y+ + +++   
Sbjct: 68  GRLKLYHFDVYRVNDPDEIEAIGFDEYIFGDGVSIVEWANYIEELIPKEYLKVEITKLPE 127

Query: 134 -GKTGRKATIS 143
            G T RK  I+
Sbjct: 128 LGDTFRKINIT 138


>gi|240081169|ref|ZP_04725712.1| hypothetical protein NgonF_07643 [Neisseria gonorrhoeae FA19]
 gi|240113383|ref|ZP_04727873.1| hypothetical protein NgonM_07397 [Neisseria gonorrhoeae MS11]
 gi|240116271|ref|ZP_04730333.1| hypothetical protein NgonPID1_08552 [Neisseria gonorrhoeae PID18]
 gi|240118557|ref|ZP_04732619.1| hypothetical protein NgonPID_08869 [Neisseria gonorrhoeae PID1]
 gi|240124101|ref|ZP_04737057.1| hypothetical protein NgonP_09210 [Neisseria gonorrhoeae PID332]
 gi|254494284|ref|ZP_05107455.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268597279|ref|ZP_06131446.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268599456|ref|ZP_06133623.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268601936|ref|ZP_06136103.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268604266|ref|ZP_06138433.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268682725|ref|ZP_06149587.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|293398522|ref|ZP_06642700.1| conserved hypothetical protein [Neisseria gonorrhoeae F62]
 gi|226513324|gb|EEH62669.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268551067|gb|EEZ46086.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268583587|gb|EEZ48263.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268586067|gb|EEZ50743.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268588397|gb|EEZ53073.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268623009|gb|EEZ55409.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|291610993|gb|EFF40090.1| conserved hypothetical protein [Neisseria gonorrhoeae F62]
          Length = 153

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 73/139 (52%), Gaps = 8/139 (5%)

Query: 12  PIP----NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           P+P    +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V S
Sbjct: 6   PVPRFLADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKS 63

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKK 125
           PT+ +V+ Y      + HFD YR S  +E  + G DE+     +C+IEWP+ G    P  
Sbjct: 64  PTYAIVESYPLERFALHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPA 123

Query: 126 YIDIHLSQGKTGRKATISA 144
            I   L+ G  GRK  ++A
Sbjct: 124 DITATLTHGGGGRKCLLTA 142


>gi|158321491|ref|YP_001513998.1| hypothetical protein Clos_2470 [Alkaliphilus oremlandii OhILAs]
 gi|158141690|gb|ABW20002.1| protein of unknown function UPF0079 [Alkaliphilus oremlandii
           OhILAs]
          Length = 152

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 70/118 (59%), Gaps = 3/118 (2%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +  I I N++    L + L  ++  GD L ++GDLG+GK+   ++    L  ++   V S
Sbjct: 1   MICIDILNQEELENLAKRLGKLVGAGDILCMTGDLGAGKTTFTQAFASGLEVEEY--VTS 58

Query: 68  PTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPK 124
           PTFTL+Q YD  +P+ HFD YR++   E+ ++G++E    E +C+IEW  +   +LPK
Sbjct: 59  PTFTLIQEYDGRLPLYHFDVYRINHVSEMEDIGYEEYFYGEGVCVIEWASLIEEVLPK 116


>gi|167035939|ref|YP_001671170.1| hypothetical protein PputGB1_4950 [Pseudomonas putida GB-1]
 gi|166862427|gb|ABZ00835.1| protein of unknown function UPF0079 [Pseudomonas putida GB-1]
          Length = 157

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 77/145 (53%), Gaps = 9/145 (6%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+  G  +A +      + L GDLG+GK+ L+R +IR L H  A  V SPTFT+
Sbjct: 8   LADEAATVDFGAKMAEVTGGRGVIFLEGDLGAGKTTLSRGLIRGLGHTGA--VKSPTFTV 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+   +   HFD YRL   +E+  +G  D    + +C+ EWP+ G  +LPK  + I 
Sbjct: 66  VEPYEIGEVRAFHFDLYRLVDPEELEFMGIRDYFEGDPLCLFEWPQKGAGVLPKPDLTIT 125

Query: 131 LSQGKTGRKATIS-----AERWIIS 150
           +S    GR   +S      E W ++
Sbjct: 126 ISPQAGGRSLILSPQGARGEAWCVA 150


>gi|291546947|emb|CBL20055.1| conserved hypothetical nucleotide-binding protein [Ruminococcus sp.
           SR1/5]
          Length = 146

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 77/140 (55%), Gaps = 8/140 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI   + + T  +GR +    + G   TL+GDLG GK+   + +   L   +   V SPT
Sbjct: 2   VIETHDPEETFEVGRTIGMNAKPGQIYTLTGDLGVGKTVFTQGVAAGLGITEP--VNSPT 59

Query: 70  FTLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYI 127
           FT++Q Y D  +P  HFD YR+   +E+ E+G+D+    + IC+IEW E+   +LP+K I
Sbjct: 60  FTIIQEYEDGRLPFYHFDVYRIGDLEEMEEIGYDDYFFGQGICLIEWAELIEEILPEKRI 119

Query: 128 DI----HLSQGKTGRKATIS 143
           ++     L +G   RK TI 
Sbjct: 120 EVTIEKDLEKGFEYRKITIE 139


>gi|88608388|ref|YP_506576.1| hypothetical protein NSE_0700 [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600557|gb|ABD46025.1| conserved hypothetical protein TIGR00150 [Neorickettsia sennetsu
           str. Miyayama]
          Length = 139

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 71/127 (55%), Gaps = 1/127 (0%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA-SI 80
           + + + S+L     + L GDLG+GK+ L+  IIR L     L V SPT+++V +Y + + 
Sbjct: 13  VAKMIVSMLEGKRTILLYGDLGAGKTHLSAEIIRCLFAKMDLIVQSPTYSIVNIYRSDAC 72

Query: 81  PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKA 140
            +AH D YR+ S +E+ ELG  EIL    C+IEWPE+ ++     Y  +H++    G + 
Sbjct: 73  DIAHLDLYRVKSTEELYELGLQEILENYFCLIEWPEVMKNFSLNAYGILHITITMVGDEK 132

Query: 141 TISAERW 147
            I    W
Sbjct: 133 RILRLDW 139


>gi|104783876|ref|YP_610374.1| hypothetical protein PSEEN4947 [Pseudomonas entomophila L48]
 gi|95112863|emb|CAK17591.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 157

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 72/133 (54%), Gaps = 4/133 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  T+  G  LA +      + L GDLG+GK+ L+R +IR L H     V SPTFT+V+
Sbjct: 10  DEPATVAFGTKLAEVTGGRGVIFLEGDLGAGKTTLSRGLIRGLGHTGP--VKSPTFTVVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+   I   HFD YRL   +E+  +G  D    + +C+ EWP+ G  +LPK  + I +S
Sbjct: 68  PYEIGDIRAFHFDLYRLVDPEELEFMGIRDYFEGDPLCLFEWPDKGAGVLPKPDLTITIS 127

Query: 133 QGKTGRKATISAE 145
               GR   +S +
Sbjct: 128 PQAGGRSLNLSPQ 140


>gi|315127885|ref|YP_004069888.1| hypothetical protein PSM_A2824 [Pseudoalteromonas sp. SM9913]
 gi|315016399|gb|ADT69737.1| hypothetical protein PSM_A2824 [Pseudoalteromonas sp. SM9913]
          Length = 155

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 79/145 (54%), Gaps = 5/145 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  T+ +G  LA+I+  G  + L GDLG+GK+   R I++   H    +V SPT+TLV+
Sbjct: 11  DENATVAMGNKLAAIIEQGAVIYLHGDLGAGKTTFTRGIVQGFGHTG--KVKSPTYTLVE 68

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+     V HFD YRL   +E+  +G  +  +E   CI+EWPE G   +P   ++  LS
Sbjct: 69  PYELVRGNVYHFDLYRLGDPEELEFMGIRDYFSETATCIVEWPEKGGEFIPVPDLNATLS 128

Query: 133 QGKTGRKATI-SAERWIISHINQMN 156
                RK  I SA    ++ + ++N
Sbjct: 129 YVGDERKIVINSASERGVAIVEKLN 153


>gi|288940951|ref|YP_003443191.1| hypothetical protein Alvin_1220 [Allochromatium vinosum DSM 180]
 gi|288896323|gb|ADC62159.1| protein of unknown function UPF0079 [Allochromatium vinosum DSM
           180]
          Length = 168

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 74/136 (54%), Gaps = 4/136 (2%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I +   ++ +  G  LAS L+    + L GDLG+GK+ L R I+R L H  A  V SPT+
Sbjct: 7   IELDTPESQMAFGARLASALKPPCVIFLEGDLGTGKTTLTRGILRGLGHSGA--VRSPTY 64

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYID 128
           TLV+ Y      + HFD YRL   +E+  LG  ++L    I I+EWP  G  LLPK  + 
Sbjct: 65  TLVEPYALTGFELYHFDLYRLGDPEELDYLGLRDLLGSASIWIVEWPARGAGLLPKPDLC 124

Query: 129 IHLSQGKTGRKATISA 144
           I L     GR+ T+ A
Sbjct: 125 IRLVHLDMGRRLTLMA 140


>gi|296121080|ref|YP_003628858.1| hypothetical protein Plim_0814 [Planctomyces limnophilus DSM 3776]
 gi|296013420|gb|ADG66659.1| protein of unknown function UPF0079 [Planctomyces limnophilus DSM
           3776]
          Length = 161

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 80/156 (51%), Gaps = 17/156 (10%)

Query: 5   EKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFL--MHDDA 62
           E+ L V  + NE  T+  GR L    +    + LSG LG+GK+ L R I+  L  + DD 
Sbjct: 3   EEELKVF-LENELETLKAGRFLGMSCQQPLIVLLSGQLGAGKTTLTRGIVEGLGGVIDD- 60

Query: 63  LEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSL 121
             V SPTFTL+  Y A + V H D YRL +  E  ELG DE+L +E + +IEWPE+    
Sbjct: 61  --VSSPTFTLIHEYQARLSVYHLDTYRLKTSAEFFELGVDELLESEAVVLIEWPELVSEY 118

Query: 122 LPKKYIDI----------HLSQGKTGRKATISAERW 147
           LP   ++I           L+   TG  +    ERW
Sbjct: 119 LPADRLEIEIVHQPENTRELTAKATGPTSCPVLERW 154


>gi|84393190|ref|ZP_00991954.1| putative nucleotide-binding protein [Vibrio splendidus 12B01]
 gi|86148238|ref|ZP_01066535.1| putative nucleotide-binding protein [Vibrio sp. MED222]
 gi|84376242|gb|EAP93126.1| putative nucleotide-binding protein [Vibrio splendidus 12B01]
 gi|85834008|gb|EAQ52169.1| putative nucleotide-binding protein [Vibrio sp. MED222]
          Length = 154

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 76/134 (56%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ TI LG  L+++      + L GDLG+GK+  +R  ++ L H     V SPT+TL
Sbjct: 8   LKDEQATIQLGTELSNLCSQQTTIYLHGDLGAGKTTFSRGFVKALGHQG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y  A   V HFD YRL+  +E+  +G  D    + IC++EWPE G  +LP+  +DI 
Sbjct: 66  VEPYQLADWQVYHFDLYRLADPEELEFMGIRDYFTPDAICLVEWPEKGYGMLPEADLDID 125

Query: 131 LSQGKTGRKATISA 144
           +      R  +++A
Sbjct: 126 IRYQDDHRIVSLTA 139


>gi|197303578|ref|ZP_03168616.1| hypothetical protein RUMLAC_02304 [Ruminococcus lactaris ATCC
           29176]
 gi|197297312|gb|EDY31874.1| hypothetical protein RUMLAC_02304 [Ruminococcus lactaris ATCC
           29176]
          Length = 146

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 76/136 (55%), Gaps = 8/136 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  +G+ L      G  +TL+GDLG GK+   + + + L  ++   V SPTFT+VQ+Y
Sbjct: 9   EETFQVGKSLGEKAYPGQVITLTGDLGVGKTVFTQGLAKGLGIEEP--VNSPTFTIVQVY 66

Query: 77  DAS-IPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDI----H 130
           +   +P  HFD YR+   +E+ E+GFDE +  E + +IEW  +   +LP+  ++I     
Sbjct: 67  EGGRLPFYHFDVYRIGDVEEMDEVGFDEYVSGEGVSLIEWANLIEEILPENRVNITIEKD 126

Query: 131 LSQGKTGRKATISAER 146
           L QG   R+ TI   R
Sbjct: 127 LEQGFDFRRITIEERR 142


>gi|153803479|ref|ZP_01958065.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|124120980|gb|EAY39723.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
          Length = 136

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 68/123 (55%), Gaps = 4/123 (3%)

Query: 24  RHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASI-PV 82
           R LA I      L L GDLG+GK+  +R  IR L H     V SPT+TLV+ Y   +  V
Sbjct: 1   RALALICSQQTTLYLHGDLGAGKTTFSRGFIRALGHQG--NVKSPTYTLVEPYQLGMWQV 58

Query: 83  AHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKAT 141
            HFD YRL+  +E+  +G  D    + IC++EWPE G  LLP   +DI L      R AT
Sbjct: 59  YHFDLYRLADPEELEFMGIRDYFSADAICLVEWPEKGHGLLPNADLDIDLRYDGEQRVAT 118

Query: 142 ISA 144
           ++A
Sbjct: 119 LTA 121


>gi|218708319|ref|YP_002415940.1| hypothetical protein VS_0266 [Vibrio splendidus LGP32]
 gi|218321338|emb|CAV17288.1| hypothetical protein VS_0266 [Vibrio splendidus LGP32]
          Length = 182

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 76/134 (56%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ TI LG  L+++      + L GDLG+GK+  +R  ++ L H     V SPT+TL
Sbjct: 36  LKDEQATIQLGTELSNLCSQQTTIYLHGDLGAGKTTFSRGFVKALGHQG--NVKSPTYTL 93

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y  A   V HFD YRL+  +E+  +G  D    + IC++EWPE G  +LP+  +DI 
Sbjct: 94  VEPYQLADWQVYHFDLYRLADPEELEFMGIRDYFTPDAICLVEWPEKGYGMLPEADLDID 153

Query: 131 LSQGKTGRKATISA 144
           +      R  +++A
Sbjct: 154 IRYQDDHRIVSLTA 167


>gi|302390425|ref|YP_003826246.1| protein of unknown function UPF0079 [Thermosediminibacter oceani
           DSM 16646]
 gi|302201053|gb|ADL08623.1| protein of unknown function UPF0079 [Thermosediminibacter oceani
           DSM 16646]
          Length = 155

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           LG  L  +L  GDC+ L GDLG+GK+   R I R L   D   V SPTFT++  Y   IP
Sbjct: 19  LGEALGKLLSPGDCVALKGDLGAGKTAFTRGIARGLGSIDY--VTSPTFTIINEYGGDIP 76

Query: 82  VAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLP 123
           +AH D YRL    E+ ++GF + L   + ++EW +    +LP
Sbjct: 77  LAHMDVYRLLDAVELEDIGFRDYLKSHVVVMEWADKVTDILP 118


>gi|317402328|gb|EFV82904.1| hypothetical protein HMPREF0005_00130 [Achromobacter xylosoxidans
           C54]
          Length = 198

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 87/163 (53%), Gaps = 15/163 (9%)

Query: 13  IPNEKNTICLGRHLASILR------LGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
           +P+E  T  L R LA ++        G C+ L GDLG+GK+  +R+++R       ++  
Sbjct: 31  LPDEAATEALARQLAPLVSGRETGLAGACIHLQGDLGAGKTAFSRALLRECGITGRIK-- 88

Query: 67  SPTFTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPK 124
           SP++ L++ Y  S +   H DFYR S  +E ++ GF ++L E  + +IEWPE    LLP 
Sbjct: 89  SPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAGFRDLLREDAVVLIEWPERAEGLLPP 148

Query: 125 KYIDIHLSQGKTGRKATISA-----ERWIISHINQMNRSTSQQ 162
             + I L+    GR  T++A     + W+ + +   + + SQ+
Sbjct: 149 PDLQISLAYAGQGRDVTLTAHTARGQTWLNAIVPPPDTAPSQR 191


>gi|70734066|ref|YP_257706.1| hypothetical protein PFL_0562 [Pseudomonas fluorescens Pf-5]
 gi|68348365|gb|AAY95971.1| conserved hypothetical protein TIGR00150 [Pseudomonas fluorescens
           Pf-5]
          Length = 156

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 72/128 (56%), Gaps = 4/128 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E   +  G  +A + +    + L GDLG+GK+ L+R IIR L H  A  V SPTFTL
Sbjct: 8   LADEPAMVEFGARIAQVTQGVGVIFLEGDLGAGKTTLSRGIIRGLGHAGA--VKSPTFTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+  S+   HFD YRL   +E+  LG  D    + +C++EWP+ G   LPK  + I 
Sbjct: 66  VEPYEIGSVRAFHFDLYRLVDPEELEFLGIRDYFEGDALCLLEWPQRGAGFLPKPDLTIT 125

Query: 131 LSQGKTGR 138
           ++    GR
Sbjct: 126 ITPHNNGR 133


>gi|298370217|ref|ZP_06981533.1| nucleotide-binding protein [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298281677|gb|EFI23166.1| nucleotide-binding protein [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 156

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 74/134 (55%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E+ T+ LG   A  L     + L G LG+GK+   R ++R L +  A  V SPT+T+
Sbjct: 11  LPDEEATLQLGADWAGTLAAPLTVYLQGSLGAGKTTFTRGLLRGLGYAGA--VKSPTYTI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR +S +E  + G DE+  ++ +C+IEWP+ G    P   I + 
Sbjct: 69  VESYILPQFALHHFDLYRFASPEEWEDAGLDELFASDCVCLIEWPQQGGGFTPPADITVS 128

Query: 131 LSQGKTGRKATISA 144
           L+    GR  T++A
Sbjct: 129 LNHTDGGRACTLTA 142


>gi|168205600|ref|ZP_02631605.1| conserved hypothetical protein TIGR00150 [Clostridium perfringens E
           str. JGS1987]
 gi|169344235|ref|ZP_02865217.1| conserved hypothetical protein TIGR00150 [Clostridium perfringens C
           str. JGS1495]
 gi|169297694|gb|EDS79794.1| conserved hypothetical protein TIGR00150 [Clostridium perfringens C
           str. JGS1495]
 gi|170662869|gb|EDT15552.1| conserved hypothetical protein TIGR00150 [Clostridium perfringens E
           str. JGS1987]
          Length = 154

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 78/132 (59%), Gaps = 8/132 (6%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           T+ +GR L S++  GD L L+GDLG+GK+ +++ I   L  D+   + SPTF +V  Y +
Sbjct: 11  TMHIGRQLGSLVNKGDILCLTGDLGTGKTHISKGIAEGLGIDE--HITSPTFNIVNEYHS 68

Query: 79  S-IPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQ--- 133
             + + HFD YR++   E+  +GFDE I  + + +IEW      L+P++YI I + +   
Sbjct: 69  GRLTLYHFDVYRVNDPDEIEAIGFDEYIFGDGVSLIEWANYIEELIPEEYIHIKIEKLPD 128

Query: 134 -GKTGRKATISA 144
            G+  RK +I+ 
Sbjct: 129 MGENFRKISING 140


>gi|114319730|ref|YP_741413.1| hypothetical protein Mlg_0569 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226124|gb|ABI55923.1| protein of unknown function UPF0079 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 167

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 75/134 (55%), Gaps = 5/134 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           +P+P+E+ T  LG  LA  +  G  + L G+LG+GK+ L R ++R L H  A  V SPT+
Sbjct: 9   LPLPDEEATRALGAALAETVPAG-LVCLYGELGAGKTTLVRGLLRHLGHAGA--VRSPTY 65

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYID 128
           TLV+ Y      V H D YRL   +E+  +G  ++L      ++EWPE G  +LP   + 
Sbjct: 66  TLVESYQPGGRRVHHLDLYRLGHPEELEFIGLRDLLQPTDTVLVEWPERGEGVLPSPVLS 125

Query: 129 IHLSQGKTGRKATI 142
           I LS   T R+A +
Sbjct: 126 ITLSHTGTSREARL 139


>gi|110800697|ref|YP_696843.1| hypothetical protein CPF_2422 [Clostridium perfringens ATCC 13124]
 gi|110803171|ref|YP_699439.1| hypothetical protein CPR_2132 [Clostridium perfringens SM101]
 gi|168210094|ref|ZP_02635719.1| conserved hypothetical protein TIGR00150 [Clostridium perfringens B
           str. ATCC 3626]
 gi|168215792|ref|ZP_02641417.1| conserved hypothetical protein TIGR00150 [Clostridium perfringens
           NCTC 8239]
 gi|182624060|ref|ZP_02951848.1| conserved hypothetical protein TIGR00150 [Clostridium perfringens D
           str. JGS1721]
 gi|110675344|gb|ABG84331.1| conserved hypothetical protein TIGR00150 [Clostridium perfringens
           ATCC 13124]
 gi|110683672|gb|ABG87042.1| conserved hypothetical protein TIGR00150 [Clostridium perfringens
           SM101]
 gi|170711790|gb|EDT23972.1| conserved hypothetical protein TIGR00150 [Clostridium perfringens B
           str. ATCC 3626]
 gi|177910953|gb|EDT73307.1| conserved hypothetical protein TIGR00150 [Clostridium perfringens D
           str. JGS1721]
 gi|182382298|gb|EDT79777.1| conserved hypothetical protein TIGR00150 [Clostridium perfringens
           NCTC 8239]
          Length = 154

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 78/132 (59%), Gaps = 8/132 (6%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           T+ +GR L S++  GD L L+GDLG+GK+ +++ I   L  D+   + SPTF +V  Y +
Sbjct: 11  TMHIGRQLGSLVNKGDILCLTGDLGTGKTHISKGIAEGLGIDE--HITSPTFNIVNEYHS 68

Query: 79  S-IPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQ--- 133
             + + HFD YR++   E+  +GFDE I  + + +IEW      L+P++YI I + +   
Sbjct: 69  GRLTLYHFDVYRVNDPDEIEAIGFDEYIFGDGVSLIEWANYIEELIPEEYIHIKIEKLPD 128

Query: 134 -GKTGRKATISA 144
            G+  RK +I+ 
Sbjct: 129 MGENFRKISING 140


>gi|268684865|ref|ZP_06151727.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268625149|gb|EEZ57549.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
          Length = 153

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR S  +E  + G DE+     +C+IEWP+ G    P   I   
Sbjct: 69  VESYPLERFALHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITAT 128

Query: 131 LSQGKTGRKATISA 144
           L+ G  GRK  ++A
Sbjct: 129 LTHGGGGRKCLLTA 142


>gi|59801839|ref|YP_208551.1| hypothetical protein NGO1501 [Neisseria gonorrhoeae FA 1090]
 gi|194099310|ref|YP_002002408.1| hypothetical protein NGK_1783 [Neisseria gonorrhoeae NCCP11945]
 gi|240014745|ref|ZP_04721658.1| hypothetical protein NgonD_08900 [Neisseria gonorrhoeae DGI18]
 gi|240017193|ref|ZP_04723733.1| hypothetical protein NgonFA_08508 [Neisseria gonorrhoeae FA6140]
 gi|240121268|ref|ZP_04734230.1| hypothetical protein NgonPI_05775 [Neisseria gonorrhoeae PID24-1]
 gi|260439915|ref|ZP_05793731.1| hypothetical protein NgonDG_02298 [Neisseria gonorrhoeae DGI2]
 gi|268595381|ref|ZP_06129548.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268687152|ref|ZP_06154014.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291043189|ref|ZP_06568912.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|59718734|gb|AAW90139.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|193934600|gb|ACF30424.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
 gi|268548770|gb|EEZ44188.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268627436|gb|EEZ59836.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291012795|gb|EFE04778.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|317164819|gb|ADV08360.1| hypothetical protein NGTW08_1398 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 153

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR S  +E  + G DE+     +C+IEWP+ G    P   I   
Sbjct: 69  VESYPLERFALHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITAT 128

Query: 131 LSQGKTGRKATISA 144
           L+ G  GRK  ++A
Sbjct: 129 LTHGGGGRKCLLTA 142


>gi|39996899|ref|NP_952850.1| hypothetical protein GSU1800 [Geobacter sulfurreducens PCA]
 gi|39983787|gb|AAR35177.1| conserved hypothetical protein TIGR00150 [Geobacter sulfurreducens
           PCA]
 gi|307634931|gb|ADI84635.2| ATPase/kinase TIGR00150 [Geobacter sulfurreducens KN400]
          Length = 161

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 63/115 (54%), Gaps = 1/115 (0%)

Query: 16  EKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQL 75
           E+ T  LG  L   L  G  + L+G+LGSGK+  AR + R L   + + + SPTFTL+  
Sbjct: 10  EEETERLGELLGRELSAGAFVALAGELGSGKTRFARGVARGLGVAETVPITSPTFTLLNE 69

Query: 76  YDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDI 129
           Y   IP+ HFD YRL    +   LGFDE      +C++EW E     LP + IDI
Sbjct: 70  YRGRIPLYHFDLYRLGGVDDAAALGFDEYFHGTGVCLVEWAERLGDDLPVERIDI 124


>gi|325982941|ref|YP_004295343.1| hypothetical protein NAL212_2360 [Nitrosomonas sp. AL212]
 gi|325532460|gb|ADZ27181.1| Uncharacterized protein family UPF0079, ATPase [Nitrosomonas sp.
           AL212]
          Length = 168

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 73/132 (55%), Gaps = 4/132 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + NE  T+  G  LA+ L  G  + L G+LG+GK+ L R I+  L +     V SPT+ L
Sbjct: 19  LANEAETLKFGEKLATCLHPGMTIHLLGNLGAGKTTLTRGILHGLGYSHI--VKSPTYNL 76

Query: 73  VQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V++Y  S + + HFDFYR + + E  E GF +  N   IC++EWPE   +LLP   +   
Sbjct: 77  VEIYKISGLYLYHFDFYRFNDYSEWEEAGFRDYFNSNSICLVEWPEKAGNLLPGADLRCF 136

Query: 131 LSQGKTGRKATI 142
           L+   +GR   I
Sbjct: 137 LNILDSGRNIEI 148


>gi|161830204|ref|YP_001596963.1| hypothetical protein COXBURSA331_A1228 [Coxiella burnetii RSA 331]
 gi|212212500|ref|YP_002303436.1| ATP/GTP hydrolase [Coxiella burnetii CbuG_Q212]
 gi|161762071|gb|ABX77713.1| conserved hypothetical protein TIGR00150 [Coxiella burnetii RSA
           331]
 gi|212010910|gb|ACJ18291.1| ATP/GTP hydrolase [Coxiella burnetii CbuG_Q212]
          Length = 148

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 74/135 (54%), Gaps = 4/135 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           IP EK  + LG+ LA   + G+ + L G+LG+GK+   R ++R   +   ++  SP++TL
Sbjct: 7   IPTEKAMLALGQRLADYCQAGEVIYLMGELGAGKTTFVRGLLRGFGYKGFVK--SPSYTL 64

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIH 130
           +++Y   ++ V H D YRLS   E  ++G  + L  + I +IEWPE    LLP   + IH
Sbjct: 65  IEVYSLETLEVVHVDLYRLSEANEYWDIGLTDYLKKDSILLIEWPEKAEKLLPPPSVSIH 124

Query: 131 LSQGKTGRKATISAE 145
                  R   I+++
Sbjct: 125 FDIQLNNRLVNITSD 139


>gi|326795800|ref|YP_004313620.1| hypothetical protein Marme_2552 [Marinomonas mediterranea MMB-1]
 gi|326546564|gb|ADZ91784.1| Uncharacterized protein family UPF0079, ATPase [Marinomonas
           mediterranea MMB-1]
          Length = 155

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 76/133 (57%), Gaps = 4/133 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           I  E+     G  LAS  + G  + L+G+LG GK+ L R ++R + +     V SPT+T+
Sbjct: 7   IYGEEAMELFGEQLASSFQEGGVVHLNGNLGMGKTTLVRGLLRGMGYIGP--VKSPTYTI 64

Query: 73  VQLYDASIP-VAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+  +  V HFD YR+ + +E+  +G  +   E  +C+IEW E+G  +LP+  + IH
Sbjct: 65  VEPYELEVADVFHFDLYRIGNAEELEYMGIRDYFKEGALCLIEWAEMGEGVLPEPDVVIH 124

Query: 131 LSQGKTGRKATIS 143
           L+  + GRK  + 
Sbjct: 125 LALLRQGRKVVVE 137


>gi|157150642|ref|YP_001449849.1| hypothetical protein SGO_0533 [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|157075436|gb|ABV10119.1| conserved hypothetical protein TIGR00150 [Streptococcus gordonii
           str. Challis substr. CH1]
          Length = 160

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 74/130 (56%), Gaps = 3/130 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE   I +G+ +  +L+  D L LSGDLG+GK+ L + I + L  D    + SPT+T+V+
Sbjct: 17  NENELIAIGQKIGRLLQARDVLILSGDLGAGKTTLTKGIAQGL--DIRQMIKSPTYTIVR 74

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  + + +IEW E+    LP+ Y+ I L + 
Sbjct: 75  EYEGRLPLYHLDVYRIGEDPDSIDLD-DFLYGDGVTVIEWGELLEDSLPQDYLKIQLVKE 133

Query: 135 KTGRKATISA 144
           + GR+    A
Sbjct: 134 EDGRRILFEA 143


>gi|269925168|ref|YP_003321791.1| protein of unknown function UPF0079 [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269788828|gb|ACZ40969.1| protein of unknown function UPF0079 [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 174

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 79/136 (58%), Gaps = 8/136 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N + T  LGR LA +++ GD + L G  G GK+   + +   L   +A  V+SP+F LV 
Sbjct: 14  NAEETKDLGRTLAQLVQPGDVIPLWGGFGVGKTTFTQGLAEGLGVREA--VVSPSFGLVN 71

Query: 75  LYDAS----IPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDI 129
           +Y ++    I + H D YR+SS QE    G DE I++E + ++EWPE+ + LLP + +D+
Sbjct: 72  IYHSTKRPEITLYHLDLYRISSRQEAEGFGADELIMDEGVALVEWPEVIKDLLPPEKLDV 131

Query: 130 HLSQ-GKTGRKATISA 144
           +     +  R+ T++A
Sbjct: 132 NFEWIDENNRRITLAA 147


>gi|304396959|ref|ZP_07378839.1| protein of unknown function UPF0079 [Pantoea sp. aB]
 gi|304355755|gb|EFM20122.1| protein of unknown function UPF0079 [Pantoea sp. aB]
          Length = 158

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 75/138 (54%), Gaps = 4/138 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI +P+E  T+ LG  LA        + L GDLG+GK+  +R  ++ L H     V SPT
Sbjct: 5   VISLPDEAATLDLGAQLARACGSAAVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPT 62

Query: 70  FTLVQLYDASI-PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  +   + HFD YRL+  +E+  +G  D    E IC++EWP+ G   LP   +
Sbjct: 63  YTLVEPYSLNNHTLYHFDLYRLADPEELEFMGIRDYFSGEAICLVEWPQQGAGFLPSPDL 122

Query: 128 DIHLSQGKTGRKATISAE 145
            + L      R+A ++A+
Sbjct: 123 TLTLRYVGEAREAELTAQ 140


>gi|240126282|ref|ZP_04739168.1| hypothetical protein NgonSK_08747 [Neisseria gonorrhoeae SK-92-679]
          Length = 177

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 70/132 (53%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +V+
Sbjct: 37  DEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAIVE 94

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLS 132
            Y      + HFD YR S  +E  + G DE+     +C+IEWP+ G    P   I   L+
Sbjct: 95  SYPLERFALHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITATLT 154

Query: 133 QGKTGRKATISA 144
            G  GRK  ++A
Sbjct: 155 HGGGGRKCLLTA 166


>gi|149184289|ref|ZP_01862607.1| hypothetical protein ED21_26263 [Erythrobacter sp. SD-21]
 gi|148831609|gb|EDL50042.1| hypothetical protein ED21_26263 [Erythrobacter sp. SD-21]
          Length = 149

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 62/105 (59%), Gaps = 3/105 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+       G+ +A+ L+ GD + LSG LG+GK+ LAR+II  + H    EV SPTFT+
Sbjct: 5   LPDLAAMEAFGQRIAARLQPGDVVALSGGLGAGKTTLARAIIAAMGHTG--EVPSPTFTI 62

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           ++ YD   +P+ H DFYRL    E  E+G D+       I EWP+
Sbjct: 63  IETYDHLRLPLVHADFYRLEDPSETQEIGLDDYREGAALIAEWPD 107


>gi|320353722|ref|YP_004195061.1| hypothetical protein Despr_1618 [Desulfobulbus propionicus DSM
           2032]
 gi|320122224|gb|ADW17770.1| Uncharacterized protein family UPF0079, ATPase [Desulfobulbus
           propionicus DSM 2032]
          Length = 172

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 78/142 (54%), Gaps = 2/142 (1%)

Query: 4   SEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDAL 63
           +  H  V+  P+ ++   L   LA++L  GD L L G+LG+GK+ L + + + L  D++ 
Sbjct: 12  ARDHALVVFCPSVESLAPLAEILATMLHAGDVLLLHGELGAGKTTLTQWLAQALGVDESQ 71

Query: 64  EVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELG-FDEILNERICIIEWPEIGRSLL 122
            V SP+F L+  Y   +P+ H D YRL    +V   G  D    + +CI+EWP+   +L 
Sbjct: 72  YVASPSFALMHEYQGRLPIFHMDLYRLRDEDDVEAAGLLDCFERQGLCIVEWPDRLGTLT 131

Query: 123 PKKYIDIHLSQGKTG-RKATIS 143
           P + +DI L    +G R+ T++
Sbjct: 132 PDERLDILLQPADSGARRITLT 153


>gi|262282161|ref|ZP_06059930.1| conserved hypothetical protein [Streptococcus sp. 2_1_36FAA]
 gi|262262615|gb|EEY81312.1| conserved hypothetical protein [Streptococcus sp. 2_1_36FAA]
          Length = 148

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 74/130 (56%), Gaps = 3/130 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE   I +G+ +  +L+  D L LSGDLG+GK+ L + I + L  D    + SPT+T+V+
Sbjct: 5   NENELIAIGQKIGRLLQARDVLILSGDLGAGKTTLTKGIAQGL--DIRQMIKSPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  + + +IEW E+    LP+ Y+ I L + 
Sbjct: 63  EYEGRLPLYHLDVYRIGEDPDSIDLD-DFLYGDGVTVIEWGELLEDSLPQDYLKIQLVKE 121

Query: 135 KTGRKATISA 144
           + GR+    A
Sbjct: 122 EDGRRILFEA 131


>gi|239999568|ref|ZP_04719492.1| hypothetical protein Ngon3_08808 [Neisseria gonorrhoeae 35/02]
 gi|240128768|ref|ZP_04741429.1| hypothetical protein NgonS_09114 [Neisseria gonorrhoeae SK-93-1035]
          Length = 177

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 70/132 (53%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +V+
Sbjct: 37  DEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAIVE 94

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLS 132
            Y      + HFD YR S  +E  + G DE+     +C+IEWP+ G    P   I   L+
Sbjct: 95  SYPLERFALHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITATLT 154

Query: 133 QGKTGRKATISA 144
            G  GRK  ++A
Sbjct: 155 HGGGGRKCLLTA 166


>gi|291535710|emb|CBL08822.1| conserved hypothetical nucleotide-binding protein [Roseburia
           intestinalis M50/1]
          Length = 146

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 73/141 (51%), Gaps = 8/141 (5%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           TV    +   T  LG+ +    R GD  TL GDLG GK+   + I   L   +   V SP
Sbjct: 4   TVYETFSAAETHALGKKIGETARPGDVYTLVGDLGVGKTVFTQGIADGLGITEP--VSSP 61

Query: 69  TFTLVQLY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKY 126
           TFT+VQ+Y +  +P  HFD YR+   +E+ E+G+ D    E +C+IEW  +   +LP K 
Sbjct: 62  TFTIVQVYEEGRMPFYHFDVYRIGDIEEMDEIGYEDYFYGEGLCMIEWANLIEEILPDKR 121

Query: 127 IDI----HLSQGKTGRKATIS 143
            D+     L +G   RK TI 
Sbjct: 122 YDVTIEKDLEKGFDYRKITIK 142


>gi|77359234|ref|YP_338809.1| hypothetical protein PSHAa0267 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874145|emb|CAI85366.1| conserved protein of unknown function [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 158

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 81/147 (55%), Gaps = 7/147 (4%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD- 77
           T+ +G  +A+I+  G  + L GDLG+GK+   R I++   H    +V SPT+TLV+ Y+ 
Sbjct: 15  TVTMGNRIAAIIEQGAVIYLHGDLGAGKTTFTRGIVQGFGHTG--KVKSPTYTLVEPYEL 72

Query: 78  ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKT 136
               V HFD YRL   +E+  +G  D    + IC++EWPE G   +P   ++I LS    
Sbjct: 73  ERANVYHFDLYRLGDPEELEYMGIRDYFSAQAICVVEWPEKGGEFIPVPDLNITLSYVGD 132

Query: 137 GRKATI--SAERWIISHINQMNRSTSQ 161
            R   I  ++ER  +  I ++N  TS+
Sbjct: 133 ERNIVINSASERGSVI-IEKLNNLTSE 158


>gi|291540986|emb|CBL14097.1| conserved hypothetical nucleotide-binding protein [Roseburia
           intestinalis XB6B4]
          Length = 146

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 73/141 (51%), Gaps = 8/141 (5%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           TV    +   T  LG+ +    R GD  TL GDLG GK+   + I   L   +   V SP
Sbjct: 4   TVYETFSAAETHALGKKIGETARPGDVYTLVGDLGVGKTVFTQGIADGLGITEP--VSSP 61

Query: 69  TFTLVQLY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKY 126
           TFT+VQ+Y +  +P  HFD YR+   +E+ E+G+ D    E +C+IEW  +   +LP K 
Sbjct: 62  TFTIVQVYEEGRMPFYHFDVYRIGDIEEMDEIGYEDYFYGEGLCMIEWANLIEEILPDKR 121

Query: 127 IDI----HLSQGKTGRKATIS 143
            D+     L +G   RK TI 
Sbjct: 122 YDVTIEKDLEKGFDYRKITIK 142


>gi|134093683|ref|YP_001098758.1| TriP hydrolase domain-containing protein [Herminiimonas
           arsenicoxydans]
 gi|133737586|emb|CAL60629.1| Conserved hypothetical protein, putative ATPase [Herminiimonas
           arsenicoxydans]
          Length = 161

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 75/130 (57%), Gaps = 8/130 (6%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E  TI LG  LA  L+ G  + L GDLG+GK+ L R+++  L H+    V SPT+TL +
Sbjct: 10  EEAGTIALGAALARALQPGLTIYLHGDLGAGKTALTRAMLHALGHEG--HVKSPTYTLAE 67

Query: 75  LY-----DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYID 128
            Y       ++ V HFD YR++S +E ++ GF E  N + IC+IEWPE   ++LP   + 
Sbjct: 68  PYVITLAGQTVNVIHFDLYRMASAEEFLDAGFREYFNHQTICVIEWPEKAEAVLPPPDLS 127

Query: 129 IHLSQGKTGR 138
           I L+    GR
Sbjct: 128 ISLAVAGEGR 137


>gi|153813333|ref|ZP_01966001.1| hypothetical protein RUMOBE_03750 [Ruminococcus obeum ATCC 29174]
 gi|149830623|gb|EDM85714.1| hypothetical protein RUMOBE_03750 [Ruminococcus obeum ATCC 29174]
          Length = 141

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 71/134 (52%), Gaps = 8/134 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  LG  +    + G   TL+GDLG GK+   + +   L   +   V SPTFT+VQ+Y
Sbjct: 9   EETYALGEKIGKAAQPGQIYTLTGDLGVGKTVFTQGVAAGLGITEP--VSSPTFTIVQVY 66

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDI----H 130
           +   +P  HFD YR+   +E+ E+G+D+      IC+IEW E+   +LP   I I     
Sbjct: 67  EEGRLPFYHFDVYRIGDIEEMEEIGYDDYFFGNGICLIEWAELIEEILPDNVISITIEKD 126

Query: 131 LSQGKTGRKATISA 144
           L+QG   RK T+  
Sbjct: 127 LTQGFDYRKITVDG 140


>gi|149927689|ref|ZP_01915941.1| hypothetical protein LMED105_15828 [Limnobacter sp. MED105]
 gi|149823515|gb|EDM82745.1| hypothetical protein LMED105_15828 [Limnobacter sp. MED105]
          Length = 161

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 75/140 (53%), Gaps = 10/140 (7%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P++  T  +G  LA + +    + LSG LG+GK+ L R+ +R L    A  V SP++ L
Sbjct: 8   LPDDAATHSVGEKLAKLAQAPLRIYLSGPLGAGKTALVRAFLRALGVQGA--VKSPSYAL 65

Query: 73  VQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+ S   V HFDFYR     E  E GF +   E  IC++EWPE    LLP   ++IH
Sbjct: 66  VEPYNFSNYSVYHFDFYRFFDQNEWEESGFRDYFEETAICLVEWPEKAGGLLPPADLEIH 125

Query: 131 LSQGK------TGRKATISA 144
           LS  +      TGR   + A
Sbjct: 126 LSYHQLPSHETTGRGIEVKA 145


>gi|291551086|emb|CBL27348.1| conserved hypothetical nucleotide-binding protein [Ruminococcus
           torques L2-14]
          Length = 141

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 80/142 (56%), Gaps = 8/142 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI   + + T  +G+ L      G  LTL+GDLG GK+   + +   L  ++   V SPT
Sbjct: 2   VIETRSPEETFAVGKSLGEKAFPGQVLTLTGDLGVGKTVFTQGLAEGLGIEEP--VNSPT 59

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYI 127
           FT+VQ+Y+   +P  HFD YR+   +E+ E+GF+E ++ E + +IEW  +   +LP++  
Sbjct: 60  FTIVQVYEEGRLPFYHFDVYRIGDIEEMDEVGFEEYVMGEGVSLIEWANLIEEILPERRT 119

Query: 128 DI----HLSQGKTGRKATISAE 145
           +I     L+QG   R+ TI  +
Sbjct: 120 NILIEKDLTQGFDYRRITIEEQ 141


>gi|150388638|ref|YP_001318687.1| hypothetical protein Amet_0803 [Alkaliphilus metalliredigens QYMF]
 gi|149948500|gb|ABR47028.1| protein of unknown function UPF0079 [Alkaliphilus metalliredigens
           QYMF]
          Length = 152

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 67/113 (59%), Gaps = 3/113 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           I + K    LG  + ++LR G  L L GDLG+GK+ L +++ R L   D   V SPTFT+
Sbjct: 6   IKSLKEMEALGEKMGAVLRPGKILCLKGDLGAGKTTLTQALARGLEVTDY--VTSPTFTI 63

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPK 124
           +  Y+  +P+ HFD YR++   E+ ++G+ D    E +C+IEW  +   +LP+
Sbjct: 64  IHQYEGRLPLYHFDVYRINHFTEMEDIGYEDYFYGEGVCVIEWATLIEEILPE 116


>gi|332798496|ref|YP_004459995.1| hypothetical protein TepRe1_0490 [Tepidanaerobacter sp. Re1]
 gi|332696231|gb|AEE90688.1| Uncharacterized protein family UPF0079, ATPase [Tepidanaerobacter
           sp. Re1]
          Length = 151

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 65/114 (57%), Gaps = 2/114 (1%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V    N + T  LG  L  +L  GD L L+GDLG+GK+   R I + L  D    V SPT
Sbjct: 4   VFETKNVEQTEKLGVSLGKLLSKGDFLALTGDLGAGKTAFTRGISKGLGIDHP--VTSPT 61

Query: 70  FTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLP 123
           FT++  Y   + +AH D YRL + +E+  +GFD+ L + I ++EW +  + +LP
Sbjct: 62  FTIINEYHGPVALAHMDAYRLKTLEELENIGFDDYLEDFIIVMEWADKVKEMLP 115


>gi|168213733|ref|ZP_02639358.1| conserved hypothetical protein TIGR00150 [Clostridium perfringens
           CPE str. F4969]
 gi|170714791|gb|EDT26973.1| conserved hypothetical protein TIGR00150 [Clostridium perfringens
           CPE str. F4969]
          Length = 154

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 77/132 (58%), Gaps = 8/132 (6%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           T+ +GR L S++  GD L L+GDLG+GK+ +++ I   L  D+   + SPTF +V  Y +
Sbjct: 11  TMHIGRQLGSLVNKGDILCLTGDLGTGKTHISKGIAEGLGIDE--HITSPTFNIVNEYHS 68

Query: 79  S-IPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQ--- 133
             + + HFD YR++   E+  +GFDE I  + + +IEW      L+P++YI I + +   
Sbjct: 69  GRLTLYHFDVYRVNDPDEIEAIGFDEYIFGDGVSLIEWANYIEELIPEEYIHIKIEKLPD 128

Query: 134 -GKTGRKATISA 144
            G+  RK  I+ 
Sbjct: 129 MGENFRKIIING 140


>gi|294865297|ref|XP_002764377.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239863615|gb|EEQ97094.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 573

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 78/154 (50%), Gaps = 19/154 (12%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +PNE  TI LG+ +AS+LR G  + L G+LG+GK+ LAR+++R +     LEV SP++ +
Sbjct: 64  LPNEDATIKLGQQIASVLRPGLTVLLKGNLGAGKTCLARALMRHITQKTTLEVPSPSYLI 123

Query: 73  VQLY---------DASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE-IGRSLL 122
              Y         +    V H D YRL+S +      FD    E I IIEWPE +G ++ 
Sbjct: 124 SFTYIVEDEYGLLEKGSKVHHLDPYRLASGKVAALFDFDTAFREDITIIEWPERLGSNVT 183

Query: 123 PKKYIDI-----HLSQGKTGRKATIS----AERW 147
           P     +      +     GR  T+S    AE W
Sbjct: 184 PPSSSSLVVYFSGVGPQAVGRHVTLSCSGQAEYW 217


>gi|312958648|ref|ZP_07773168.1| hypothetical protein TIGR00150 [Pseudomonas fluorescens WH6]
 gi|311287191|gb|EFQ65752.1| hypothetical protein TIGR00150 [Pseudomonas fluorescens WH6]
          Length = 156

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 79/148 (53%), Gaps = 9/148 (6%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++ + +E   +  G  LA   +    + L GDLG+GK+ L+R IIR L H  A  V SPT
Sbjct: 5   ILFLADEDTMVAFGHRLAWATQGRGLIFLEGDLGAGKTTLSRGIIRGLGHAGA--VKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           FTLV+ Y+   +   HFD YRL   +E+  +G  D   ++ +C+IEWP  G   LPK  +
Sbjct: 63  FTLVEPYEIGDLRAFHFDLYRLVDPEELEFMGIRDYFEDDTLCLIEWPNKGTGFLPKPDL 122

Query: 128 DIHLSQGKTGRKATI-----SAERWIIS 150
            I ++  + GR+  +       E W ++
Sbjct: 123 TITITPHEHGRQLKLLPQSSRGETWCVA 150


>gi|187477241|ref|YP_785265.1| hypothetical protein BAV0732 [Bordetella avium 197N]
 gi|115421827|emb|CAJ48345.1| conserved hypothetical protein [Bordetella avium 197N]
          Length = 177

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 79/139 (56%), Gaps = 9/139 (6%)

Query: 13  IPNEKNTICLGRHLASIL-----RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +P+E  T  L   LA ++     + G  + L GDLG+GK+   R+++R         + S
Sbjct: 12  LPDESATDALAGQLAPLVNGTAGQAGGRVHLRGDLGAGKTAFTRALLR--ASGIKGRIKS 69

Query: 68  PTFTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKK 125
           PT+ L++ Y  S +   HFDFYRLS  +E ++ GF ++L ++ + +IEWPE     LP  
Sbjct: 70  PTYALLESYKVSNLYFYHFDFYRLSDTREWLDAGFRDLLRDDAVVLIEWPERAGQFLPVP 129

Query: 126 YIDIHLSQGKTGRKATISA 144
            +DI+L+    GR AT++A
Sbjct: 130 DLDINLAHADQGRDATLTA 148


>gi|241761920|ref|ZP_04760005.1| protein of unknown function UPF0079 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373600|gb|EER63172.1| protein of unknown function UPF0079 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 157

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (63%), Gaps = 5/97 (5%)

Query: 23  GRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD---AS 79
           GR+L   L+ GD +TLSGDLG+GK+ LAR I+  L   +  EV SP+F L+  Y+    S
Sbjct: 18  GRYLGRSLQTGDIITLSGDLGAGKTSLARGILSELGFQE--EVPSPSFALMIDYEPPEVS 75

Query: 80  IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           +PVAH D YRL + +++ ELG DE       ++EWPE
Sbjct: 76  LPVAHVDLYRLDNPEDIQELGLDEFAFYGALLVEWPE 112


>gi|330836897|ref|YP_004411538.1| hypothetical protein Spico_0932 [Spirochaeta coccoides DSM 17374]
 gi|329748800|gb|AEC02156.1| Uncharacterized protein family UPF0079, ATPase [Spirochaeta
           coccoides DSM 17374]
          Length = 139

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 69/118 (58%), Gaps = 3/118 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           + + T  +G  L   LR G  ++L G+LG+GK+ +A+ I R L   +A  ++SPTFTL+Q
Sbjct: 7   DAQETEAIGMQLGQHLRAGSVVSLRGNLGAGKTVIAKGIARSLGITEA--IVSPTFTLIQ 64

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL 131
            Y+ ++P+ H D YR+    E    G DE+L    + ++EW EI + +LP   I + +
Sbjct: 65  EYEGTLPLYHMDLYRIGDSGEFEMFGGDEMLYGTGVTLVEWSEIIQDMLPDDTIYVSI 122


>gi|238021778|ref|ZP_04602204.1| hypothetical protein GCWU000324_01681 [Kingella oralis ATCC 51147]
 gi|237866392|gb|EEP67434.1| hypothetical protein GCWU000324_01681 [Kingella oralis ATCC 51147]
          Length = 151

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 72/135 (53%), Gaps = 7/135 (5%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G   AS+ R    + L G+LG+GK+   R ++R L H  A  V SPT+ +
Sbjct: 7   LPDEAATLAFGERTASLFRPPVVIHLQGNLGAGKTTFTRGLLRGLGHTGA--VKSPTYAI 64

Query: 73  VQLYDASIP---VAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDI 129
           V+ Y  ++P   V HFD YR +S +E ++ G D+++   I +IEW   G    P     I
Sbjct: 65  VESY--ALPQTTVHHFDLYRFTSPEEWLDAGLDDLIPNSIVLIEWAGQGGEYAPAPDYII 122

Query: 130 HLSQGKTGRKATISA 144
            L     GR+ T+ A
Sbjct: 123 QLEPRDNGRQCTLQA 137


>gi|257785042|ref|YP_003180259.1| hypothetical protein Apar_1243 [Atopobium parvulum DSM 20469]
 gi|257473549|gb|ACV51668.1| protein of unknown function UPF0079 [Atopobium parvulum DSM 20469]
          Length = 184

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 84/145 (57%), Gaps = 5/145 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + TI LG+ L  +L+ GD L L+GDLG+GK+ L + I   +   D  +V SPTFT+  +Y
Sbjct: 35  EQTIALGQILGKLLQAGDVLVLTGDLGAGKTQLTKGIAAGMGVTD--DVTSPTFTIEMVY 92

Query: 77  DA-SIPVAHFDFYRLSSHQEVVELG-FDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
           +  +IP+ HFD YRLS   ++ + G +D + ++   IIEW E     + ++ +D+++S+ 
Sbjct: 93  EGTTIPLYHFDLYRLSDPDQLEDTGLYDALESDGPTIIEWGEQFAEQIGERTLDVYVSRL 152

Query: 135 KTGRKATISAE-RWIISHINQMNRS 158
                A+  AE R  I  I+Q  R 
Sbjct: 153 SEEELASDDAEPRREIRFISQNARG 177


>gi|229829539|ref|ZP_04455608.1| hypothetical protein GCWU000342_01635 [Shuttleworthia satelles DSM
           14600]
 gi|229791528|gb|EEP27642.1| hypothetical protein GCWU000342_01635 [Shuttleworthia satelles DSM
           14600]
          Length = 143

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 69/121 (57%), Gaps = 4/121 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E+ T  +GR LA     GD  TL GDLG GK+ L +   R L   D   V SPTFT+VQ
Sbjct: 7   SEEETREIGRMLAERAIPGDVFTLVGDLGVGKTVLTKGFARGLGIQD--HVNSPTFTIVQ 64

Query: 75  LYDAS-IPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+   +P  HFD YR++   E+  +GFD+ I    +C+IEW  +   +LP +  +I ++
Sbjct: 65  EYEGGRLPFYHFDVYRIADPDELQMIGFDDYIFGRGVCLIEWANLIEEVLPDRRTEIRIA 124

Query: 133 Q 133
           +
Sbjct: 125 K 125


>gi|171915038|ref|ZP_02930508.1| hypothetical protein VspiD_27715 [Verrucomicrobium spinosum DSM
           4136]
          Length = 142

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 70/117 (59%), Gaps = 4/117 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I + + + T+  GR LA  L+ GD + L G LG+GK+   + I+  L       V SPT
Sbjct: 1   MIELASVEETLHWGRELACTLKPGDVVALVGTLGAGKTHATKGIVAGL--GSLANVSSPT 58

Query: 70  FTLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPK 124
           FTLV  Y D  +P  HFDFYRL S +EV+ +G+D+IL  + + I+EW +    LLP+
Sbjct: 59  FTLVHEYNDGRLPAFHFDFYRLDSAEEVLGVGWDDILAADGVVIVEWADRFPELLPE 115


>gi|308808133|ref|XP_003081377.1| COG0802: Predicted ATPase or kinase (ISS) [Ostreococcus tauri]
 gi|116059839|emb|CAL55546.1| COG0802: Predicted ATPase or kinase (ISS) [Ostreococcus tauri]
          Length = 279

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 74/131 (56%), Gaps = 4/131 (3%)

Query: 4   SEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDAL 63
           SE    V    +E  T  L R LA   R GD + L G +GSGKS LAR+ +R  + D   
Sbjct: 30  SEAAERVFASTSESATAKLARALARTARNGDVICLRGRVGSGKSALARAFVRARLGDARA 89

Query: 64  EVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVEL-GFDEILNERICIIEWPE-IGRS 120
           +V SPT+ + Q Y+ A+  V H+D YRL+   EV+ +    E  N  I ++EW E +GR 
Sbjct: 90  DVPSPTYLVQQRYETATGEVHHYDLYRLTGEGEVLAMCDLRESANGAISVVEWSERLGR- 148

Query: 121 LLPKKYIDIHL 131
           L P++ +++H+
Sbjct: 149 LTPEERLEVHV 159


>gi|297538680|ref|YP_003674449.1| hypothetical protein M301_1492 [Methylotenera sp. 301]
 gi|297258027|gb|ADI29872.1| protein of unknown function UPF0079 [Methylotenera sp. 301]
          Length = 166

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 77/143 (53%), Gaps = 13/143 (9%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+  G  LA  ++    + L GDLG+GK+ L R ++  L H    +V SPT+TL
Sbjct: 9   LADEAATLAFGVALAKAIQPNLTIYLHGDLGAGKTTLVRGLLHALGH--VGKVKSPTYTL 66

Query: 73  VQLYD------ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKK 125
           V+ YD      +S+ + HFD YR +  +E    GF +  N   +C+IEWPE   ++LP  
Sbjct: 67  VEPYDIKYNVTSSLMLYHFDLYRFNDEEEWESAGFRDYFNANSVCVIEWPEKAENVLPTP 126

Query: 126 YIDIHLS---QGKT-GRKATISA 144
            I+I  S    GK  GR   +SA
Sbjct: 127 DINITFSIKNVGKNLGRSVNLSA 149


>gi|291517974|emb|CBK73195.1| conserved hypothetical nucleotide-binding protein [Butyrivibrio
           fibrisolvens 16/4]
          Length = 143

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 72/133 (54%), Gaps = 8/133 (6%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  LGR L+     G   TL GDLG GK+   +     L  D+A  + SPTFT+VQ+Y
Sbjct: 11  EETDALGRKLSESATPGQVFTLIGDLGVGKTVFTQGFATGLQIDEA--ICSPTFTIVQVY 68

Query: 77  DAS-IPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKY----IDIH 130
           D   +P  HFD YR+   +E+ E+G+ D I  + + +IEW  +   +LP+ Y    I+  
Sbjct: 69  DTGRLPFYHFDVYRIGDVEEMDEIGYEDYIYGDGVSLIEWANLIEDILPEHYTQITIEKD 128

Query: 131 LSQGKTGRKATIS 143
           L +G   RK T+ 
Sbjct: 129 LEKGFDYRKITVE 141


>gi|103485657|ref|YP_615218.1| hypothetical protein Sala_0161 [Sphingopyxis alaskensis RB2256]
 gi|98975734|gb|ABF51885.1| protein of unknown function UPF0079 [Sphingopyxis alaskensis
           RB2256]
          Length = 164

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 64/105 (60%), Gaps = 5/105 (4%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N      +G  +  +L  GD + LSGDLG+GK+ LAR++++      A E  SPTF +VQ
Sbjct: 23  NLDEADAIGAAIGGVLAPGDVVLLSGDLGAGKTTLARAMLK--ARGLAGEAPSPTFAIVQ 80

Query: 75  LY---DASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
            Y   +  +P+AH D YR+   ++++ELG D+ L++   +IEWP+
Sbjct: 81  PYAPPEVDLPIAHVDLYRIEEPRDLIELGLDDYLSDGALLIEWPD 125


>gi|89094652|ref|ZP_01167589.1| hypothetical protein MED92_00465 [Oceanospirillum sp. MED92]
 gi|89081122|gb|EAR60357.1| hypothetical protein MED92_00465 [Oceanospirillum sp. MED92]
          Length = 158

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 78/137 (56%), Gaps = 4/137 (2%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + +P+E+  +  G+ +A        + L GDLG GK+ L+R I+R   H  +  V SPT+
Sbjct: 7   VVLPDEEAMVAFGQVIADASDAHGVIFLLGDLGMGKTTLSRGILRGCGHQGS--VKSPTY 64

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYID 128
           TLV+ Y      V HFD YRLS  +E+  LG  +  +E+ +C++EWP+ GR +LP+  + 
Sbjct: 65  TLVEPYAIGDKQVYHFDLYRLSDPEELEFLGIRDYFDEQALCLVEWPDKGRGILPQADLL 124

Query: 129 IHLSQGKTGRKATISAE 145
           + +     GRK   +A+
Sbjct: 125 LSIELEGQGRKLHWTAQ 141


>gi|260752460|ref|YP_003225353.1| hypothetical protein Za10_0217 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258551823|gb|ACV74769.1| protein of unknown function UPF0079 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 174

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (63%), Gaps = 5/97 (5%)

Query: 23  GRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD---AS 79
           GR+L   L+ GD +TLSGDLG+GK+ LAR I+  L   +  EV SP+F L+  Y+    S
Sbjct: 35  GRYLGRSLQTGDIITLSGDLGAGKTSLARGILSELGFQE--EVPSPSFALMIDYEPPEVS 92

Query: 80  IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           +PVAH D YRL + +++ ELG DE       ++EWPE
Sbjct: 93  LPVAHVDLYRLDNPEDIQELGLDEFAFYGALLVEWPE 129


>gi|330721021|gb|EGG99178.1| ATPase YjeE2C predicted to have essential role in cell wall
           biosynthesis [gamma proteobacterium IMCC2047]
          Length = 152

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 74/136 (54%), Gaps = 4/136 (2%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I + +E+  +  G  LA++L  G  + L GDLG GK+ L R I+  L H     V SPT+
Sbjct: 7   IELADEQAQLEFGARLATLLLPGLTIFLHGDLGVGKTTLCRGILNGLGHQG--NVKSPTY 64

Query: 71  TLVQLYDASIPVA-HFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYID 128
           TLV+ Y+     A HFD YRL    E+  +G  D   +E IC++EWPE G  +LP+  +D
Sbjct: 65  TLVEPYELPGQTAYHFDLYRLGEPTELEYMGCRDYFDDESICLVEWPERGEGVLPQPDLD 124

Query: 129 IHLSQGKTGRKATISA 144
           + +     GR+    A
Sbjct: 125 LEILVDGRGRRLICRA 140


>gi|93006322|ref|YP_580759.1| hypothetical protein Pcryo_1496 [Psychrobacter cryohalolentis K5]
 gi|92394000|gb|ABE75275.1| protein of unknown function UPF0079 [Psychrobacter cryohalolentis
           K5]
          Length = 179

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/141 (39%), Positives = 81/141 (57%), Gaps = 11/141 (7%)

Query: 4   SEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDAL 63
           S K+L  + + +EK+T  L   LA++  +G  + L+GDLG+GK+ L R  ++ L H  A 
Sbjct: 13  SGKNLQTLTLHSEKDTQRLAEQLAALPLIG-SVWLAGDLGAGKTTLTRYWLQALGHKGA- 70

Query: 64  EVLSPTFTLVQLY-----DASI-PVAHFDFYRLSSHQEVVELGFDEILNE--RICIIEWP 115
            V SPT+TLV+ Y     D SI PV H D YRL   +E+  +GFDE L+E   + IIEW 
Sbjct: 71  -VKSPTYTLVEPYSITQNDGSIKPVYHADLYRLQDPEELSFIGFDEYLDEPNALVIIEWA 129

Query: 116 EIGRSLLPKKYIDIHLSQGKT 136
               S LP   + I ++Q  +
Sbjct: 130 SRADSYLPLPTMFIDMTQSNS 150


>gi|328675441|gb|AEB28116.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Francisella cf. novicida 3523]
          Length = 136

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 72/134 (53%), Gaps = 4/134 (2%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +  I + +E+    L +  A  L+ G  + L GDLG+GK+   + I+  L +     V S
Sbjct: 1   MKSILVNDEEQMYQLAKEYAQQLKPGQIIYLYGDLGAGKTTFVKGILNALGYTG--NVKS 58

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+     + HFD YRL+  +E+  +G  +  N++ IC IEWPE G+  LP  
Sbjct: 59  PTYTLVESYEFDKFDIYHFDLYRLADPEELEWIGARDYFNQKDICFIEWPEKGKGFLPLN 118

Query: 126 YIDIHLSQGKTGRK 139
              IH+     GR+
Sbjct: 119 TTKIHIKYLAQGRQ 132


>gi|56551997|ref|YP_162836.1| hypothetical protein ZMO1101 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56543571|gb|AAV89725.1| protein of unknown function UPF0079 [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 174

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (63%), Gaps = 5/97 (5%)

Query: 23  GRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD---AS 79
           GR+L   L+ GD +TLSGDLG+GK+ LAR I+  L   +  EV SP+F L+  Y+    S
Sbjct: 35  GRYLGRSLQTGDIITLSGDLGAGKTSLARGILSELGFQE--EVPSPSFALMIDYEPPEVS 92

Query: 80  IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           +PVAH D YRL + +++ ELG DE       ++EWPE
Sbjct: 93  LPVAHVDLYRLDNPEDIQELGLDEFAFYGALLVEWPE 129


>gi|51245808|ref|YP_065692.1| hypothetical protein DP1956 [Desulfotalea psychrophila LSv54]
 gi|50876845|emb|CAG36685.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 161

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (53%), Gaps = 1/121 (0%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           I +   T  LG  L  +   GD + L GDLG+GK+ L + I R L  D    V SP+F +
Sbjct: 7   ISSLAETEILGLFLGHVAEAGDVICLEGDLGAGKTTLTQYIARGLEVDPREYVTSPSFAI 66

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL 131
           +  Y   IP+ H D YRL    EV++LGF+E      + +IEWP     L+P++ + + +
Sbjct: 67  LHEYQGRIPLYHMDLYRLGGEDEVIDLGFEEYFYGGGLTVIEWPSRAYDLIPEQSLYLQI 126

Query: 132 S 132
           S
Sbjct: 127 S 127


>gi|153208452|ref|ZP_01946755.1| conserved hypothetical protein TIGR00150 [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165919136|ref|ZP_02219222.1| conserved hypothetical protein TIGR00150 [Coxiella burnetii RSA
           334]
 gi|212218532|ref|YP_002305319.1| ATP/GTP hydrolase [Coxiella burnetii CbuK_Q154]
 gi|120575998|gb|EAX32622.1| conserved hypothetical protein TIGR00150 [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165917148|gb|EDR35752.1| conserved hypothetical protein TIGR00150 [Coxiella burnetii RSA
           334]
 gi|212012794|gb|ACJ20174.1| ATP/GTP hydrolase [Coxiella burnetii CbuK_Q154]
          Length = 148

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 74/135 (54%), Gaps = 4/135 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           IP EK  + LG+ LA   + G+ + L G+LG+GK+   R ++R   +   ++  SP++TL
Sbjct: 7   IPTEKAMLALGQRLADYCQAGEVIYLMGELGAGKTTFVRGLLRGFGYKGFVK--SPSYTL 64

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIH 130
           +++Y   ++ V H D YRLS   E  ++G  + L  + I +IEWPE    LLP   + IH
Sbjct: 65  IEVYSLETLEVVHVDLYRLSEANEYWDIGLTDYLKKDSILLIEWPEKAEKLLPPPSVCIH 124

Query: 131 LSQGKTGRKATISAE 145
                  R   I+++
Sbjct: 125 FDIQLNNRLVNITSD 139


>gi|291165967|gb|EFE28014.1| ATP/GTP hydrolase [Filifactor alocis ATCC 35896]
          Length = 160

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 76/131 (58%), Gaps = 5/131 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFL-MHDDALEVLSPT 69
           I + NE  T   G  + S +     + L+GDLG+GK+ + + I + L + DD   + SPT
Sbjct: 12  ILLKNEDETKLFGEKIGSAITQKLLICLNGDLGAGKTCITKGIAKGLGIMDD---ITSPT 68

Query: 70  FTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYID 128
           F LV+ Y+  +P+ HFD YR+   +E+  +GFD+ L++  + IIEW +   S+LPK  ++
Sbjct: 69  FILVEEYEGRLPLYHFDVYRIDDTEELYFIGFDDYLSKNAVVIIEWSDKIESILPKDRLE 128

Query: 129 IHLSQGKTGRK 139
           I L   + G +
Sbjct: 129 IRLDYTEDGMR 139


>gi|330807227|ref|YP_004351689.1| hypothetical protein PSEBR_a537 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375335|gb|AEA66685.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 155

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 73/135 (54%), Gaps = 4/135 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+     G  +A I      + L GDLG+GK+ L+R IIR L H  +  V SPTFTL
Sbjct: 8   VADEQAMTQFGARIAQITAGHGLIFLEGDLGAGKTTLSRGIIRGLGHVGS--VKSPTFTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+   I   HFD YRL   +E+  LG  D   ++ +C+IEWP+ G   LPK  + I 
Sbjct: 66  VEPYEIGDIRAFHFDLYRLVDPEELEFLGIRDYFEDDALCLIEWPQKGAGFLPKPDLTIT 125

Query: 131 LSQGKTGRKATISAE 145
           +     GR   ++ +
Sbjct: 126 IGAQNGGRSLKLTPQ 140


>gi|85373837|ref|YP_457899.1| ATPase [Erythrobacter litoralis HTCC2594]
 gi|84786920|gb|ABC63102.1| predicted ATPase [Erythrobacter litoralis HTCC2594]
          Length = 145

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 66/108 (61%), Gaps = 3/108 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++ +P+       G  +A+ L +GD + LSG LG+GK+ L+R+I+  L +  A EV SPT
Sbjct: 2   IVRLPDLAAVEAFGARIAAKLGVGDVVALSGTLGAGKTTLSRAILHGLGY--AGEVPSPT 59

Query: 70  FTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
           FT+++ YD+   PV H DFYRL    E+ ELG ++     + + EWP+
Sbjct: 60  FTIIETYDSLDPPVVHADFYRLDDPSEIEELGLEDYREGAVLLAEWPD 107


>gi|329120231|ref|ZP_08248899.1| P-loop hydrolase/phosphotransferase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327462572|gb|EGF08895.1| P-loop hydrolase/phosphotransferase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 207

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 75/151 (49%), Gaps = 10/151 (6%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V P+P+E          +  L     L L GDLG+GK+  AR+++R L       V SPT
Sbjct: 53  VFPLPDEAAAAAFAAAFSDDLSAPLVLWLQGDLGAGKTTFARNLLRALGFTGT--VKSPT 110

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYI 127
           +T+ + Y      + HFD YR SS +E  + G DE+   + +C+IEWP+ G +  P   I
Sbjct: 111 YTIAESYPLPGFTLHHFDLYRFSSPEEWEDAGLDELAGADAVCLIEWPDKGGAYTPPPDI 170

Query: 128 DIHLSQGKTGRKATISAERWIISHINQMNRS 158
            + LS    GR+A +       SH N   +S
Sbjct: 171 TLTLSHQGAGRRAVLQ------SHTNHGRKS 195


>gi|154706560|ref|YP_001424553.1| ATP/GTP hydrolase [Coxiella burnetii Dugway 5J108-111]
 gi|154355846|gb|ABS77308.1| ATP/GTP hydrolase [Coxiella burnetii Dugway 5J108-111]
          Length = 148

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 74/135 (54%), Gaps = 4/135 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           IP EK  + LG+ LA   + G+ + L G+LG+GK+   R ++R   +   ++  SP++TL
Sbjct: 7   IPTEKAMLALGQRLADYCQAGEVIYLMGELGAGKTTFVRGLLRGFGYKGFVK--SPSYTL 64

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           +++Y   ++ V H D YRLS   E  ++G  D +  + I +IEWPE    LLP   + IH
Sbjct: 65  IEVYSLETLEVVHVDLYRLSEANEYWDIGLTDYLKKDSILLIEWPEKAEKLLPPPSVCIH 124

Query: 131 LSQGKTGRKATISAE 145
                  R   I+++
Sbjct: 125 FDIQLNNRLVNITSD 139


>gi|284048914|ref|YP_003399253.1| protein of unknown function UPF0079 [Acidaminococcus fermentans DSM
           20731]
 gi|283953135|gb|ADB47938.1| protein of unknown function UPF0079 [Acidaminococcus fermentans DSM
           20731]
          Length = 159

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 76/130 (58%), Gaps = 3/130 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  T  LGR L S+ R GD + L+GDLG+GK+ L  +     M     EV SPTF+L+ 
Sbjct: 9   DEAATEALGRKLGSLCRNGDVILLNGDLGTGKTCLV-TAASVAMGVPPQEVTSPTFSLMN 67

Query: 75  LYDA-SIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
           +Y   ++ V HFD YR++  +E+ ++GF E    + +  IEW E+    +P++ +++ L+
Sbjct: 68  VYHGKTLNVKHFDLYRINWPEELEDIGFSEYAGGDGVTFIEWAELFPDAMPEENLELKLT 127

Query: 133 QGKTGRKATI 142
           +   GRK  +
Sbjct: 128 REGEGRKVEL 137


>gi|118496886|ref|YP_897936.1| hypothetical protein FTN_0274 [Francisella tularensis subsp.
           novicida U112]
 gi|194324109|ref|ZP_03057883.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
 gi|208780335|ref|ZP_03247676.1| conserved hypothetical protein [Francisella novicida FTG]
 gi|118422792|gb|ABK89182.1| conserved protein of unknown function [Francisella novicida U112]
 gi|194321556|gb|EDX19040.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
 gi|208743703|gb|EDZ90006.1| conserved hypothetical protein [Francisella novicida FTG]
          Length = 136

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 72/134 (53%), Gaps = 4/134 (2%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +  I + +E+      +  A  L+ G  + L GDLG+GK+   + I++ L +     V S
Sbjct: 1   MKSILVNDEEQMYQFAKEYAQQLKPGQIIYLYGDLGAGKTTFVKGILKALGYTG--NVKS 58

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+     + HFD YRL+  +E+  +G  +  N++ IC IEWPE G+  LP  
Sbjct: 59  PTYTLVESYEFDKFDIYHFDLYRLADPEELEWIGARDYFNQKDICFIEWPEKGKGFLPLN 118

Query: 126 YIDIHLSQGKTGRK 139
              +H+     GR+
Sbjct: 119 TTKVHIKYLAQGRQ 132


>gi|240146576|ref|ZP_04745177.1| putative ATPase or kinase [Roseburia intestinalis L1-82]
 gi|257201307|gb|EEU99591.1| putative ATPase or kinase [Roseburia intestinalis L1-82]
          Length = 146

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 73/141 (51%), Gaps = 8/141 (5%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           TV    +   T  LG+ +    + GD  TL GDLG GK+   + I   L   +   V SP
Sbjct: 4   TVYETFSAAETHALGKKIGETAKPGDVYTLVGDLGVGKTVFTQGIADGLGITEP--VSSP 61

Query: 69  TFTLVQLY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKY 126
           TFT+VQ+Y +  +P  HFD YR+   +E+ E+G+ D    E +C+IEW  +   +LP K 
Sbjct: 62  TFTIVQVYEEGRMPFYHFDVYRIGDIEEMDEIGYEDYFYGEGLCMIEWANLIEEILPDKR 121

Query: 127 IDI----HLSQGKTGRKATIS 143
            D+     L +G   RK TI 
Sbjct: 122 YDVTIEKDLEKGFDYRKITIK 142


>gi|153820287|ref|ZP_01972954.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|126509169|gb|EAZ71763.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
          Length = 129

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 64/111 (57%), Gaps = 4/111 (3%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASI-PVAHFDFYRLSSHQ 94
           L L GDLG+GK+  +R  IR L H     V SPT+TLV+ Y   +  V HFD YRL+  +
Sbjct: 6   LYLHGDLGAGKTTFSRGFIRALGHQG--NVKSPTYTLVEPYQLGMWQVYHFDLYRLADPE 63

Query: 95  EVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           E+  +G  D    + IC++EWPE G  LLP   +DI L      R AT++A
Sbjct: 64  ELEFMGIRDYFSADAICLVEWPEKGHGLLPNADLDIDLRYDGDQRVATLTA 114


>gi|331086259|ref|ZP_08335339.1| hypothetical protein HMPREF0987_01642 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406025|gb|EGG85548.1| hypothetical protein HMPREF0987_01642 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 143

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 77/139 (55%), Gaps = 8/139 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI   + K T   G+ +  + + G+  TL GDLG GK+   + + R L  ++A+   SPT
Sbjct: 2   VIETRSPKETFEFGKKIGELAKAGEIYTLIGDLGVGKTVFTQGLARGLQIEEAIS--SPT 59

Query: 70  FTLVQLY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           FT+VQ+Y +  +P  HFD YR+   +E+ E+G+ D    + + +IEW  +   +LP++  
Sbjct: 60  FTIVQVYEEGRLPFYHFDVYRIGDVEEMEEIGYEDYFYGQGVSLIEWSNLIEEILPQRRT 119

Query: 128 DI----HLSQGKTGRKATI 142
           +I     L QG   R+ T+
Sbjct: 120 EITIEKDLDQGFDFRRITV 138


>gi|254511218|ref|ZP_05123285.1| uncharacterized P-loop hydrolase UPF0079 [Rhodobacteraceae
           bacterium KLH11]
 gi|221534929|gb|EEE37917.1| uncharacterized P-loop hydrolase UPF0079 [Rhodobacteraceae
           bacterium KLH11]
          Length = 156

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 69/117 (58%), Gaps = 2/117 (1%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  +   + S L+ GD + L G +GSGK+  AR++I+ ++     ++ SPTFTLVQ+Y
Sbjct: 13  EETAAIAARMGSRLQPGDTILLEGAIGSGKTHFARALIQSVLAVSE-DIPSPTFTLVQVY 71

Query: 77  DASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           D  +  V H D YRL S +E+ ELG  +     IC+IEWP+   SL P+  + I  +
Sbjct: 72  DTELGEVWHSDLYRLGSVEEIEELGLIDAFEASICLIEWPDKLGSLTPQPALLIRFT 128


>gi|154483100|ref|ZP_02025548.1| hypothetical protein EUBVEN_00801 [Eubacterium ventriosum ATCC
           27560]
 gi|149735908|gb|EDM51794.1| hypothetical protein EUBVEN_00801 [Eubacterium ventriosum ATCC
           27560]
          Length = 167

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 74/134 (55%), Gaps = 8/134 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           ++T  LG+ +    + G  + L+GDLG GK+   +   + L  ++   V SPTFT++Q+Y
Sbjct: 35  EDTFNLGKKIGQQAKPGQVICLNGDLGVGKTVFTQGFAKGLGIEET--VNSPTFTIIQVY 92

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKK----YIDIH 130
           D   IP+ HFD YR+   +E+ E+G+ D    E +C+IEW ++   L+P       I+  
Sbjct: 93  DEGRIPLYHFDVYRIGDPEEMYEIGYEDYFFGEGVCLIEWSKLIEELIPSDAATVLIEKD 152

Query: 131 LSQGKTGRKATISA 144
           L +G   RK T+  
Sbjct: 153 LEKGLDYRKVTVEG 166


>gi|107104047|ref|ZP_01367965.1| hypothetical protein PaerPA_01005120 [Pseudomonas aeruginosa PACS2]
          Length = 152

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 71/131 (54%), Gaps = 4/131 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++    E   + LG  +A +      + L GDLG+GK+ L+R I+R L H  A  V SPT
Sbjct: 2   ILSAEGEDAMLELGGRIARVSGGQGVIYLHGDLGAGKTTLSRGILRGLGH--AGSVKSPT 59

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           FTLV+ Y+   +   HFD YRL+  +E+   G  D      +C+IEWPE G  +LP   +
Sbjct: 60  FTLVEPYEIGELRAYHFDLYRLADAEELEFFGIRDYFDGSALCLIEWPERGAGVLPTADL 119

Query: 128 DIHLSQGKTGR 138
           DI ++    GR
Sbjct: 120 DITITAQAGGR 130


>gi|297569312|ref|YP_003690656.1| protein of unknown function UPF0079 [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925227|gb|ADH86037.1| protein of unknown function UPF0079 [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 151

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 67/122 (54%), Gaps = 2/122 (1%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+       GR L      GD + L G LG+GK+ L R+I   L       V SPTF L
Sbjct: 11  LPDLAALEAFGRELGRQAAAGDIICLYGPLGAGKTTLTRAIAAGLEVPPEQPVTSPTFAL 70

Query: 73  VQLYDASIPVAHFDFYRLSSHQ-EVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIH 130
           +  +   +P+ H D YRL   + E++ELG ++ L  + +C+IEWPE    LLP +++DI 
Sbjct: 71  IHEHQGRLPLFHLDLYRLGGDEDELLELGIEDYLYGDGVCVIEWPERLGGLLPARHLDIR 130

Query: 131 LS 132
           L+
Sbjct: 131 LA 132


>gi|116053097|ref|YP_793416.1| hypothetical protein PA14_65380 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296391788|ref|ZP_06881263.1| hypothetical protein PaerPAb_26704 [Pseudomonas aeruginosa PAb1]
 gi|313109949|ref|ZP_07795877.1| putative ATPase [Pseudomonas aeruginosa 39016]
 gi|115588318|gb|ABJ14333.1| putative ATPase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310882379|gb|EFQ40973.1| putative ATPase [Pseudomonas aeruginosa 39016]
          Length = 155

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 71/131 (54%), Gaps = 4/131 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++    E   + LG  +A +      + L GDLG+GK+ L+R I+R L H  A  V SPT
Sbjct: 5   ILSAEGEDAMLELGGRIARVSGGQGVIYLHGDLGAGKTTLSRGILRGLGH--AGSVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           FTLV+ Y+   +   HFD YRL+  +E+   G  D      +C+IEWPE G  +LP   +
Sbjct: 63  FTLVEPYEIGELRAYHFDLYRLADAEELEFFGIRDYFDGSALCLIEWPERGAGVLPTADL 122

Query: 128 DIHLSQGKTGR 138
           DI ++    GR
Sbjct: 123 DITITAQAGGR 133


>gi|325662477|ref|ZP_08151080.1| hypothetical protein HMPREF0490_01820 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471173|gb|EGC74398.1| hypothetical protein HMPREF0490_01820 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 143

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 77/139 (55%), Gaps = 8/139 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI   + K T   G+ +  + + G+  TL GDLG GK+   + + R L  ++A+   SPT
Sbjct: 2   VIETRSPKETFEFGKKIGELAKAGEIYTLIGDLGVGKTVFTQGLARGLQIEEAIS--SPT 59

Query: 70  FTLVQLY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           FT+VQ+Y +  +P  HFD YR+   +E+ E+G+ D    + + +IEW  +   +LP++  
Sbjct: 60  FTIVQVYEEGRLPFYHFDVYRIGDIEEMEEIGYEDYFYGQGVSLIEWSNLIEEILPQRRT 119

Query: 128 DI----HLSQGKTGRKATI 142
           +I     L QG   R+ T+
Sbjct: 120 EITIEKDLDQGFDFRRITV 138


>gi|77456747|ref|YP_346252.1| hypothetical protein Pfl01_0519 [Pseudomonas fluorescens Pf0-1]
 gi|77380750|gb|ABA72263.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 143

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 70/123 (56%), Gaps = 4/123 (3%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASI 80
            G  +A I +    + L G+LG GK+ L+R IIR L H  A  V SPTFTLV+ Y+   +
Sbjct: 4   FGARIARITQGHGLIFLEGNLGMGKTTLSRGIIRGLGHVGA--VKSPTFTLVEPYEIGDV 61

Query: 81  PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRK 139
              HFD YRL   +E+  LG  D   ++ +C+IEWP+ G   LPK  + I +S   +GR 
Sbjct: 62  RAFHFDLYRLVDPEELEFLGIRDYFEDDALCLIEWPDKGAGFLPKPDLTITISPQDSGRS 121

Query: 140 ATI 142
            TI
Sbjct: 122 LTI 124


>gi|323143736|ref|ZP_08078404.1| hydrolase, P-loop family [Succinatimonas hippei YIT 12066]
 gi|322416449|gb|EFY07115.1| hydrolase, P-loop family [Succinatimonas hippei YIT 12066]
          Length = 167

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 81/154 (52%), Gaps = 11/154 (7%)

Query: 13  IPNEKNTICLGRHLASIL-------RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEV 65
           + +E++T  LG  LA I+       +   C+ L GDLG+GK+ L+R  IR L +D    V
Sbjct: 10  VKDEEHTKKLGAVLARIMPAFSRRVKRAACVFLEGDLGAGKTTLSRGFIRALGYDGL--V 67

Query: 66  LSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLP 123
            SPT+TLV+ Y    + + HFD YRL   +E+  +G  D      +C++EWPE    LLP
Sbjct: 68  KSPTYTLVEPYQIEDLNIFHFDLYRLLDPEELEFMGVRDYFAKIGVCLVEWPEKACGLLP 127

Query: 124 KKYIDIHLSQGKTGRKATISAERWIISHINQMNR 157
           +  + + LS     R A I+ +      +N+  +
Sbjct: 128 EPDVTVTLSYADGTRNAVINVKALNKEELNEFEK 161


>gi|254797052|ref|YP_003081890.1| hypothetical protein NRI_0679 [Neorickettsia risticii str.
           Illinois]
 gi|254590299|gb|ACT69661.1| conserved hypothetical protein [Neorickettsia risticii str.
           Illinois]
          Length = 138

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 62/101 (61%), Gaps = 1/101 (0%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA-SI 80
           + + + SIL     + L GDLG+GK+ L+  IIR L     L V SPT+++V +Y + + 
Sbjct: 13  VAKMIVSILEGKRTILLYGDLGAGKTHLSAEIIRCLFAKMDLIVQSPTYSIVNIYRSDAC 72

Query: 81  PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSL 121
            VAH D YR+ S +E+ ELG  E+L    C+IEWPE+ ++ 
Sbjct: 73  DVAHLDLYRIKSTEELYELGLQEVLKNYFCLIEWPEVMKNF 113


>gi|71891865|ref|YP_277594.1| nucleoside triP hydrolase domain-containing protein [Candidatus
           Blochmannia pennsylvanicus str. BPEN]
 gi|71795971|gb|AAZ40722.1| putative enzyme with nucleoside triP hydrolase domain [Candidatus
           Blochmannia pennsylvanicus str. BPEN]
          Length = 162

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 72/122 (59%), Gaps = 4/122 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ + +E  T+ LG  LAS+   G  + L+G +GSGKS   +  +  L H+  +   SPT
Sbjct: 6   VLVLSDELKTLSLGATLASVCVQGCVIYLNGYVGSGKSVFCKGFLHALGHNGHIH--SPT 63

Query: 70  FTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           +TL++ Y      V HFDFYRL S +E+  +G  +  + R IC+IEWP+ G  +LPK+ I
Sbjct: 64  YTLIESYILKHWRVCHFDFYRLISSEELENMGIRDYFDGRTICLIEWPKQGMGILPKEDI 123

Query: 128 DI 129
            +
Sbjct: 124 SV 125


>gi|29654394|ref|NP_820086.1| hypothetical protein CBU_1087 [Coxiella burnetii RSA 493]
 gi|29541661|gb|AAO90600.1| ATP/GTP hydrolase [Coxiella burnetii RSA 493]
          Length = 148

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 73/135 (54%), Gaps = 4/135 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           IP EK  + LG+ L    + G+ + L G+LG+GK+   R ++R   +   ++  SP++TL
Sbjct: 7   IPTEKAMLALGQRLVDYCQAGEVIYLMGELGAGKTTFVRGLLRGFGYKGFVK--SPSYTL 64

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIH 130
           +++Y   ++ V H D YRLS   E  ++G  + L  + I +IEWPE    LLP   + IH
Sbjct: 65  IEVYSLETLEVVHVDLYRLSEANEYWDIGLTDYLKKDSILLIEWPEKAEKLLPPPSVSIH 124

Query: 131 LSQGKTGRKATISAE 145
                  R   I+++
Sbjct: 125 FDIQLNNRLVNITSD 139


>gi|125718703|ref|YP_001035836.1| hypothetical protein SSA_1911 [Streptococcus sanguinis SK36]
 gi|125498620|gb|ABN45286.1| Conserved uncharacterized protein [Streptococcus sanguinis SK36]
 gi|327472764|gb|EGF18191.1| ATP/GTP hydrolase [Streptococcus sanguinis SK408]
          Length = 146

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 74/131 (56%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L   L+ GD L L+GDLG+GK+   + +   L     ++  SPT+T+V+
Sbjct: 5   NEEELIQWGQRLGKSLQAGDVLVLTGDLGAGKTTFTKGLALGLGISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            YD  +P+ H D YR+  + + ++L  D +  E + +IEW E+    LP  Y+ ++L + 
Sbjct: 63  EYDGRLPLYHLDVYRIGDNPDSIDLD-DFLFGEGVTVIEWGELLGENLPDNYLKLNLLKK 121

Query: 135 KTGRKATISAE 145
           + GR+    A+
Sbjct: 122 EDGRELVFEAK 132


>gi|78223088|ref|YP_384835.1| hypothetical protein Gmet_1881 [Geobacter metallireducens GS-15]
 gi|78194343|gb|ABB32110.1| protein of unknown function UPF0079 [Geobacter metallireducens
           GS-15]
          Length = 160

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 64/111 (57%), Gaps = 2/111 (1%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + TI LG  L  +L  G  + L+G+LG+GK+   R +   L  D ++ + SPTFTL+  Y
Sbjct: 10  EETIRLGERLGRLLEPGSFIALTGELGAGKTQFVRGVASGLGIDSSVPITSPTFTLLNEY 69

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPE-IGRSLLPKK 125
              I + HFD YRL    +  ELGFDE  +   +C++EW E +G  +L ++
Sbjct: 70  QGRIRLYHFDLYRLGGVDDAAELGFDEYFDGNGVCLVEWAERLGSDILTER 120


>gi|291524002|emb|CBK89589.1| conserved hypothetical nucleotide-binding protein [Eubacterium
           rectale DSM 17629]
 gi|291528536|emb|CBK94122.1| conserved hypothetical nucleotide-binding protein [Eubacterium
           rectale M104/1]
          Length = 149

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 79/146 (54%), Gaps = 8/146 (5%)

Query: 4   SEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDAL 63
           SE ++TVI   +  +T  LG  L    + GD  TL GDLG GK+ L + I   L   + +
Sbjct: 3   SEGNITVIESFSADDTHALGVTLGQQAKPGDVCTLVGDLGVGKTVLTQGIAEGLGITEPI 62

Query: 64  EVLSPTFTLVQLY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSL 121
              SPTFT+VQ+Y +  +P  HFD YR+   +E+ E+G+ D    + + +IEW  +   +
Sbjct: 63  N--SPTFTIVQVYEEGRLPFYHFDVYRIGDIEEMDEIGYEDYFYGDGLTMIEWANLIEEI 120

Query: 122 LPKK----YIDIHLSQGKTGRKATIS 143
           LPKK     I+  L +G   RK TI 
Sbjct: 121 LPKKRKEITIEKDLEKGFDYRKITIK 146


>gi|15896093|ref|NP_349442.1| nucleotide-binding protein [Clostridium acetobutylicum ATCC 824]
 gi|15025882|gb|AAK80782.1|AE007781_5 Predicted nucleotide-binding protein, YjeE family [Clostridium
           acetobutylicum ATCC 824]
 gi|325510247|gb|ADZ21883.1| nucleotide-binding protein, YjeE family [Clostridium acetobutylicum
           EA 2018]
          Length = 152

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 74/130 (56%), Gaps = 7/130 (5%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           T  +G  L ++   GD + ++GDLG+GK+   + I + L  +D   + SPTF +V  Y  
Sbjct: 11  TFSIGEQLGALAMPGDIVCINGDLGAGKTHFTKGIAKGLNIEDY--ITSPTFNIVNEYTG 68

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIH----LSQ 133
            + + HFD YR++   E+  +GFDE I ++ + +IEW     S++P ++I+++    L  
Sbjct: 69  RLKLHHFDVYRVNDPDEIYAIGFDEYIFSDAVSVIEWSHYISSIIPDEHIEVNIKKLLDM 128

Query: 134 GKTGRKATIS 143
           G   RK TI+
Sbjct: 129 GPDYRKITIT 138


>gi|153816291|ref|ZP_01968959.1| hypothetical protein RUMTOR_02542 [Ruminococcus torques ATCC 27756]
 gi|145846344|gb|EDK23262.1| hypothetical protein RUMTOR_02542 [Ruminococcus torques ATCC 27756]
          Length = 142

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 76/133 (57%), Gaps = 8/133 (6%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T   GR L      G  +TL+GDLG GK+   + + + L  ++   V SPTFT+VQ+Y
Sbjct: 9   QETFSAGRQLGEKAFPGQVITLTGDLGVGKTVFTQGLAKGLGIEEP--VNSPTFTIVQVY 66

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDI----H 130
           D  S+P+ HFD YR+   +E+ E+GF+E ++ + + +IEW  +   +LP+   ++     
Sbjct: 67  DEGSLPLYHFDVYRIGDIEEMDEVGFEEYVMGDGVSLIEWANLIEEILPENRTEVIIEKD 126

Query: 131 LSQGKTGRKATIS 143
           L +G   RK  I+
Sbjct: 127 LEKGFDYRKIIIN 139


>gi|227498690|ref|ZP_03928834.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226904146|gb|EEH90064.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 153

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (55%), Gaps = 3/135 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I  P    T  LGR L ++L  GD + L GDLG+GK+ L   I   L  D   +V SPT
Sbjct: 2   IIACPTLNETKKLGRALGTVLGDGDVVLLDGDLGAGKTTLVTEIAETLGVDRR-DVSSPT 60

Query: 70  FTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYI 127
           F+L+ +Y    + + HFD YRL+S +E+ ++GF E +    +  IEW E+    +P+ ++
Sbjct: 61  FSLMNVYRGKKLTLQHFDLYRLTSSEELDDIGFYEYVGAPGVTFIEWAELFPCEMPEDHL 120

Query: 128 DIHLSQGKTGRKATI 142
            I L Q   GR A +
Sbjct: 121 SITLRQEGAGRVAEL 135


>gi|254489672|ref|ZP_05102868.1| conserved hypothetical protein TIGR00150 [Methylophaga thiooxidans
           DMS010]
 gi|224465081|gb|EEF81334.1| conserved hypothetical protein TIGR00150 [Methylophaga thiooxydans
           DMS010]
          Length = 151

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 75/136 (55%), Gaps = 5/136 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLT-LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFT 71
           + NE+ T+ LG+ LA       C+  L G+LG+GK+ L R  +R + H     V SPT+T
Sbjct: 5   LANEEATLALGKQLAEACPDSLCIIHLEGELGAGKTTLTRGFLRAMGHQG--NVKSPTYT 62

Query: 72  LVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDI 129
           LV+ Y   +  V HFD YRLS   E+  LG D+   +  IC++EW + G   LP+  + +
Sbjct: 63  LVEHYQLGNRAVFHFDLYRLSDAGELEFLGLDDYFRDNAICLLEWAQRGSEYLPEPDLLV 122

Query: 130 HLSQGKTGRKATISAE 145
            L+  +  R A I A+
Sbjct: 123 QLNYHEHARNAVIEAK 138


>gi|160893546|ref|ZP_02074330.1| hypothetical protein CLOL250_01100 [Clostridium sp. L2-50]
 gi|156864531|gb|EDO57962.1| hypothetical protein CLOL250_01100 [Clostridium sp. L2-50]
          Length = 143

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 71/133 (53%), Gaps = 8/133 (6%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           ++T  +GR L      G      GDLG GK+  ++   + L  DD   V SPTFT+V+ Y
Sbjct: 11  EDTYRIGRELGEQAAPGQVFCFFGDLGVGKTIFSQGFAKGLGVDDI--VNSPTFTIVKEY 68

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKY----IDIH 130
           D   +P+ HFD YR+    E+ E+G+DE +    +C+IEW  +   +LP+ Y    I+  
Sbjct: 69  DDGRLPLYHFDVYRIGDVDEMEEIGYDEMVYGNGVCLIEWANLIEEILPEHYQKITIEKD 128

Query: 131 LSQGKTGRKATIS 143
           L +G   RK TI 
Sbjct: 129 LEKGVDYRKITIE 141


>gi|219848539|ref|YP_002462972.1| hypothetical protein Cagg_1635 [Chloroflexus aggregans DSM 9485]
 gi|219542798|gb|ACL24536.1| protein of unknown function UPF0079 [Chloroflexus aggregans DSM
           9485]
          Length = 173

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 67/117 (57%), Gaps = 8/117 (6%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-- 79
           +G  L  +L  GD + LSG LG+GK+ L + I R L +D    V SPTF L+  Y A   
Sbjct: 28  IGARLGRLLCAGDLILLSGPLGAGKTQLIKGIARGLGYDGP--VTSPTFVLINEYRADAA 85

Query: 80  ---IPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
              +P+ H D YRL   +E+  +G DE+L  E +C+IEWPE     LP +++ I LS
Sbjct: 86  HHRVPIYHVDLYRLDGVRELSTIGLDELLMTEGVCLIEWPERVAMALPSEHLQIVLS 142


>gi|115315041|ref|YP_763764.1| ATP-binding protein [Francisella tularensis subsp. holarctica
           OSU18]
 gi|156502748|ref|YP_001428813.1| hypothetical protein FTA_1382 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167009576|ref|ZP_02274507.1| hypothetical protein Ftulh_02359 [Francisella tularensis subsp.
           holarctica FSC200]
 gi|254367929|ref|ZP_04983949.1| nucleotide-binding protein yjeE [Francisella tularensis subsp.
           holarctica 257]
 gi|290954048|ref|ZP_06558669.1| hypothetical protein FtulhU_07182 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295312561|ref|ZP_06803320.1| hypothetical protein FtulhU_07174 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|115129940|gb|ABI83127.1| probable ATP-binding protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134253739|gb|EBA52833.1| nucleotide-binding protein yjeE [Francisella tularensis subsp.
           holarctica 257]
 gi|156253351|gb|ABU61857.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FTNF002-00]
          Length = 136

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 72/134 (53%), Gaps = 4/134 (2%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +  I + +E+    L +  A  L+ G  + L GDLG+GK+   + I+  L +     V S
Sbjct: 1   MKSILVNDEEQMYQLAKEYAQQLKPGQIIYLYGDLGAGKTTFVKGILNALGYTG--NVKS 58

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+     + HFD YRL+  +E+  +G  +  N++ IC IEWPE G+  LP  
Sbjct: 59  PTYTLVESYEFDKFDIYHFDLYRLADPEELEWIGARDCFNQKDICFIEWPEKGKGFLPLN 118

Query: 126 YIDIHLSQGKTGRK 139
              +H+     GR+
Sbjct: 119 TTKVHIKYLAQGRQ 132


>gi|254372246|ref|ZP_04987737.1| hypothetical protein FTCG_01312 [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|254373725|ref|ZP_04989208.1| nucleotide-binding protein [Francisella novicida GA99-3548]
 gi|151569975|gb|EDN35629.1| hypothetical protein FTCG_01312 [Francisella novicida GA99-3549]
 gi|151571446|gb|EDN37100.1| nucleotide-binding protein [Francisella novicida GA99-3548]
 gi|328676358|gb|AEB27228.1| ATPase YjeE, predicted to have essential role in cell wall
           biosynthesis [Francisella cf. novicida Fx1]
          Length = 136

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 75/130 (57%), Gaps = 7/130 (5%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I + +E+    L +  A  L+ G  + L GDLG+GK+   + I++ L +     V SPT+
Sbjct: 4   ILVNDEEQMYQLAKEYAQQLKPGQIIYLYGDLGAGKTTFVKGILKALGYTG--NVKSPTY 61

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLP--KKY 126
           TLV+ Y+     + HFD YRL+  +E+  +G  +  N++ IC IEWPE G+  LP     
Sbjct: 62  TLVESYEFDKFDIYHFDLYRLADPEELEWIGARDYFNQKDICFIEWPEKGKGFLPLNTTK 121

Query: 127 IDI-HLSQGK 135
           IDI +L+QG+
Sbjct: 122 IDIKYLAQGR 131


>gi|238923239|ref|YP_002936754.1| hypothetical protein EUBREC_0836 [Eubacterium rectale ATCC 33656]
 gi|238874913|gb|ACR74620.1| conserved hypothetical protein [Eubacterium rectale ATCC 33656]
          Length = 149

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 78/145 (53%), Gaps = 8/145 (5%)

Query: 4   SEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDAL 63
           SE ++TVI   +  +T  LG  L    + GD  TL GDLG GK+ L + I   L   + +
Sbjct: 3   SEGNITVIESFSADDTHALGVTLGQQAKPGDVCTLVGDLGVGKTVLTQGIAEGLGITEPI 62

Query: 64  EVLSPTFTLVQLY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSL 121
              SPTFT+VQ+Y D  +P  HFD YR+   +E+ E+G+ D    + + +IEW  +   +
Sbjct: 63  N--SPTFTIVQVYEDGRLPFYHFDVYRIGDIEEMDEIGYEDYFYGDGLTMIEWANLIEEI 120

Query: 122 LPKK----YIDIHLSQGKTGRKATI 142
           LP K     I+  L +G   RK TI
Sbjct: 121 LPNKRKEITIEKDLEKGFDYRKITI 145


>gi|293603565|ref|ZP_06685986.1| ATPase with strong ADP affinity [Achromobacter piechaudii ATCC
           43553]
 gi|292818001|gb|EFF77061.1| ATPase with strong ADP affinity [Achromobacter piechaudii ATCC
           43553]
          Length = 179

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 76/140 (54%), Gaps = 10/140 (7%)

Query: 13  IPNEKNTICLGRHLASILR------LGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
           +P+E  T  L R LA ++        G C+ L GDLG+GK+   R+++R         + 
Sbjct: 12  LPDEAATESLARQLAPLVSEGKTGPAGACIHLQGDLGAGKTAFTRALLRECGITG--RIK 69

Query: 67  SPTFTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPK 124
           SP++ L++ Y  S +   H DFYR S  +E ++ GF ++L E  + +IEWPE    LLP 
Sbjct: 70  SPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAGFRDLLREDAVVLIEWPERAEGLLPP 129

Query: 125 KYIDIHLSQGKTGRKATISA 144
             + I L+    GR AT++A
Sbjct: 130 PDLLISLAYADEGRDATLTA 149


>gi|149201428|ref|ZP_01878403.1| hypothetical protein RTM1035_17422 [Roseovarius sp. TM1035]
 gi|149145761|gb|EDM33787.1| hypothetical protein RTM1035_17422 [Roseovarius sp. TM1035]
          Length = 161

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 67/118 (56%), Gaps = 2/118 (1%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I + + + T  L R LAS L  GD L LSG +G+GK+  AR +I+ L+     +V SPT+
Sbjct: 8   ILLASPEATCALARSLASCLCPGDTLLLSGGVGAGKTHFARCLIQSLLLSPE-DVPSPTY 66

Query: 71  TLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYI 127
           TLVQ Y   S  + H D YRL    ++VELG  +   + IC+IEWP+    L P   +
Sbjct: 67  TLVQTYQGQSGEIWHADLYRLGDAMDLVELGLTDAFTDAICLIEWPDRLGDLTPPDAL 124


>gi|325208731|gb|ADZ04183.1| conserved hypothetical protein TIGR00150 [Neisseria meningitidis
           NZ-05/33]
          Length = 153

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGEAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR ++ +E  + G DE+     +C+IEWP+ G    P   I   
Sbjct: 69  VESYPLERFTLHHFDLYRFTTPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITAT 128

Query: 131 LSQGKTGRKATISA 144
           L+    GRK  ++A
Sbjct: 129 LTHDGDGRKCLLTA 142


>gi|149192039|ref|ZP_01870266.1| putative nucleotide-binding protein [Vibrio shilonii AK1]
 gi|148834140|gb|EDL51150.1| putative nucleotide-binding protein [Vibrio shilonii AK1]
          Length = 154

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 73/134 (54%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  TI +G  LA++      + L GDLG+GK+  +R  I+ L H     V SPT+TL
Sbjct: 8   LADESATILIGTKLANLCSKQTTIYLHGDLGAGKTTFSRGFIQSLGHRG--NVKSPTYTL 65

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      V HFD YRL+  +E+  +G  D   ++ IC++EWPE G  +LP   IDI 
Sbjct: 66  VEPYQLDGWNVYHFDLYRLADPEELEFMGIRDYFSDDAICLVEWPEKGIGVLPDADIDIE 125

Query: 131 LSQGKTGRKATISA 144
           +      R+   +A
Sbjct: 126 IKYVGEAREIAFTA 139


>gi|152996649|ref|YP_001341484.1| hypothetical protein Mmwyl1_2636 [Marinomonas sp. MWYL1]
 gi|150837573|gb|ABR71549.1| protein of unknown function UPF0079 [Marinomonas sp. MWYL1]
          Length = 153

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 76/135 (56%), Gaps = 4/135 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +  E+    LG   +S L+ G  + L GDLG GK+ L R ++R L +     V SPT+T+
Sbjct: 7   VYGEEAMENLGEVFSSALKSGAVVFLEGDLGMGKTTLVRGVLRGLGYKGP--VKSPTYTI 64

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+ A +   HFD YR+   +E+  +G  D   +  +C+IEW E+GR +LP+  + + 
Sbjct: 65  VEPYELADVEAFHFDLYRVVDAEELEFMGIRDYFTDGSLCLIEWAEMGRGVLPEADLLVS 124

Query: 131 LSQGKTGRKATISAE 145
           LS  + GR  +  A+
Sbjct: 125 LSLIRQGRHVSFEAQ 139


>gi|326790722|ref|YP_004308543.1| hypothetical protein Clole_1620 [Clostridium lentocellum DSM 5427]
 gi|326541486|gb|ADZ83345.1| Uncharacterized protein family UPF0079, ATPase [Clostridium
           lentocellum DSM 5427]
          Length = 139

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 75/140 (53%), Gaps = 7/140 (5%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +TV    +EK T  +G  LA+  + G    L GDLG GK+  ++     L   +   + S
Sbjct: 1   MTVYESNSEKQTFDIGYELAAASKKGAIYCLIGDLGVGKTVFSKGFAEGLGITEP--ITS 58

Query: 68  PTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKK- 125
           PTFT+VQ+YD   P+ HFD YR+    E+  +G+ D    + +C++EW      ++PK+ 
Sbjct: 59  PTFTIVQVYDGEKPLYHFDMYRIEDPDELEMIGYEDYFYGQGVCLVEWANNVSDVIPKEA 118

Query: 126 -YIDIH--LSQGKTGRKATI 142
            +IDI   L +G   RK TI
Sbjct: 119 IWIDIEKDLEKGFDYRKITI 138


>gi|254369632|ref|ZP_04985642.1| hypothetical protein FTAG_00942 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157122591|gb|EDO66720.1| hypothetical protein FTAG_00942 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 136

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 71/131 (54%), Gaps = 4/131 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I + +E+    L +  A  L+ G  + L GDLG+GK+   + I+  L +     V SPT+
Sbjct: 4   ILVNDEEQMYQLAKEYAQQLKPGHIIYLYGDLGAGKTTFVKGILNALGYTG--NVKSPTY 61

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYID 128
           TLV+ Y+     + HFD YRL+  +E+  +G  +  N++ IC IEWPE G+  LP     
Sbjct: 62  TLVESYEFDKFDIYHFDLYRLADPEELEWIGARDYFNQKDICFIEWPEKGKGFLPLNTTK 121

Query: 129 IHLSQGKTGRK 139
           +H+     GR+
Sbjct: 122 VHIKYLAQGRQ 132


>gi|330951470|gb|EGH51730.1| hypothetical protein PSYCIT7_08829 [Pseudomonas syringae Cit 7]
          Length = 156

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 74/140 (52%), Gaps = 9/140 (6%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E+  +  G  LA +      + L GDLG+GK+ L+R +IR   H  A++  SPTFTLV+
Sbjct: 10  GEEAMMDFGARLARVTEGLGVIFLDGDLGAGKTTLSRGLIRGFGHVGAVK--SPTFTLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+  +I V HFD YRL   +E+  +G  D    + +C+IEWP+ G   LPK  + I + 
Sbjct: 68  PYEIGAIKVFHFDLYRLVDPEELEYMGVRDYFDGDALCLIEWPQRGAGFLPKPDLTITIG 127

Query: 133 QGKTGRKATIS-----AERW 147
                R   +S      ERW
Sbjct: 128 PHGECRSVILSPLGSRGERW 147


>gi|294882677|ref|XP_002769797.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239873546|gb|EER02515.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 118

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 63/113 (55%), Gaps = 9/113 (7%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +PNE  TI LG+ +AS+LR G  + L G+LG+GK+ LAR+++R +     LEV SP++ +
Sbjct: 4   LPNEDATIKLGQQIASVLRPGLTVLLKGNLGAGKTCLARALMRHITQKTTLEVPSPSYLI 63

Query: 73  VQLY---------DASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
              Y         +    V H D YRL+S +      FD    E I IIEWPE
Sbjct: 64  SFTYIVEDEYGLLEKGSKVHHLDPYRLASGKVAALFDFDTAFREDITIIEWPE 116


>gi|169350978|ref|ZP_02867916.1| hypothetical protein CLOSPI_01755 [Clostridium spiroforme DSM 1552]
 gi|169292040|gb|EDS74173.1| hypothetical protein CLOSPI_01755 [Clostridium spiroforme DSM 1552]
          Length = 149

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/126 (35%), Positives = 73/126 (57%), Gaps = 5/126 (3%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           TVI I N   TI LG+ L  +L+    +TLSGDLG+GK+   + I   L     +   SP
Sbjct: 3   TVIRINNLDETIELGKQLGELLKPNMLITLSGDLGAGKTTFTKGIGLGLEIKKIIN--SP 60

Query: 69  TFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYI 127
           TFT+++ Y   + ++HFD YRL    +  +LGF+EI + + +C++EW      +LP + +
Sbjct: 61  TFTILKQYQGRLNLSHFDAYRLEGQDD--DLGFEEIFDSDDVCVVEWANYIEDILPTERL 118

Query: 128 DIHLSQ 133
           +I + +
Sbjct: 119 EIEIKK 124


>gi|66043835|ref|YP_233676.1| hypothetical protein Psyr_0568 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254542|gb|AAY35638.1| Protein of unknown function UPF0079 [Pseudomonas syringae pv.
           syringae B728a]
          Length = 143

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 72/133 (54%), Gaps = 9/133 (6%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASI 80
            G  LA +      + L GDLG+GK+ L+R +IR   H  A++  SPTFTLV+ Y+  +I
Sbjct: 4   FGARLAKVTEGLGVIFLDGDLGAGKTTLSRGLIRGFGHAGAVK--SPTFTLVEPYEIGAI 61

Query: 81  PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRK 139
            V HFD YRL   +E+  +G  D    + +C+IEWP+ G   LPK  + I +     GR 
Sbjct: 62  KVFHFDLYRLVDPEELEFMGVRDYFDGDALCLIEWPQRGAGFLPKPDLTITIVPHGEGRS 121

Query: 140 ATIS-----AERW 147
             +S      E+W
Sbjct: 122 VILSPLGSRGEQW 134


>gi|187929885|ref|YP_001900372.1| hypothetical protein Rpic_2816 [Ralstonia pickettii 12J]
 gi|187726775|gb|ACD27940.1| protein of unknown function UPF0079 [Ralstonia pickettii 12J]
          Length = 192

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 80/140 (57%), Gaps = 15/140 (10%)

Query: 3   FSEKHLTVIPIPNEKNTICLGRHLA-SILRLGD---CLTLSGDLGSGKSFLARSIIRFLM 58
            +E+ L+++   +E  T   G  LA ++L LG     + LSGDLG+GK+ L+R+I+R L 
Sbjct: 17  LAERTLSLV---DEAATSAFGTALAQAVLALGPRPVQVQLSGDLGAGKTTLSRAILRGLG 73

Query: 59  HDDALEVLSPTFTLVQLYD-----ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICII 112
           H     V SPT+TLV+ YD      +  V HFD YR +  +E  + GF +   E  +C++
Sbjct: 74  HTG--RVRSPTYTLVEPYDVAGTTGTQKVYHFDLYRFADPEEWTDAGFRDCFAEPALCLV 131

Query: 113 EWPEIGRSLLPKKYIDIHLS 132
           EWPE  ++LL    + I LS
Sbjct: 132 EWPEKAQALLGTPDLHIALS 151


>gi|90022316|ref|YP_528143.1| RNA binding S1 [Saccharophagus degradans 2-40]
 gi|89951916|gb|ABD81931.1| protein of unknown function UPF0079 [Saccharophagus degradans 2-40]
          Length = 157

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 71/132 (53%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+ T+ LG  L  ++  G  + L G LG+GK+   R ++     D +  V SPT+TLV+
Sbjct: 14  NEEATVALGAALGKMIPAGAVIFLDGTLGAGKTTFCRGVLHSF--DYSGPVKSPTYTLVE 71

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+ A   + HFD YRL   +E+  +G  D    E IC+IEW E G  +LP+  I + + 
Sbjct: 72  PYELAQRTIYHFDLYRLGDPEELEYMGIRDYFSAEAICLIEWFEKGEGVLPQADILVKVV 131

Query: 133 QGKTGRKATISA 144
               GR AT+  
Sbjct: 132 PSGEGRSATLCG 143


>gi|329924244|ref|ZP_08279417.1| hydrolase, P-loop family [Paenibacillus sp. HGF5]
 gi|328940791|gb|EGG37105.1| hydrolase, P-loop family [Paenibacillus sp. HGF5]
          Length = 156

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 75/131 (57%), Gaps = 5/131 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  L   LA+    G  + L GDLG+GK+  ++   R L  +    V SPTFT+++ Y
Sbjct: 7   EETEQLAAWLAARAEPGTVIGLDGDLGAGKTAFSQQFARHLGVNGV--VNSPTFTIIKEY 64

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL-SQG 134
           +  +P+ H D YRLS   E  ELG DE    E +C++EW  +   L+P++Y+ I L + G
Sbjct: 65  EGRLPLYHMDVYRLSV-DEADELGLDEYFYGEGVCLVEWSSLITELMPEQYLHIQLETTG 123

Query: 135 KTGRKATISAE 145
           +T R  T+S++
Sbjct: 124 ETNRIITLSSQ 134


>gi|325134823|gb|EGC57459.1| hypothetical protein TIGR00150 [Neisseria meningitidis M13399]
 gi|325144994|gb|EGC67277.1| hypothetical protein TIGR00150 [Neisseria meningitidis M01-240013]
 gi|325205522|gb|ADZ00975.1| conserved hypothetical protein TIGR00150 [Neisseria meningitidis
           M04-240196]
          Length = 153

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR ++ +E  + G DE+     +C+IEWP+ G    P   I   
Sbjct: 69  VESYPLERFTLHHFDLYRFTTPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITAT 128

Query: 131 LSQGKTGRKATISA 144
           L+    GRK  ++A
Sbjct: 129 LTHDGGGRKCLLTA 142


>gi|296315090|ref|ZP_06865031.1| ATPase with strong ADP affinity [Neisseria polysaccharea ATCC
           43768]
 gi|296837994|gb|EFH21932.1| ATPase with strong ADP affinity [Neisseria polysaccharea ATCC
           43768]
          Length = 153

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 70/132 (53%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +V+
Sbjct: 13  DEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAIVE 70

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLS 132
            Y      + HFD YR S  +E  + G DE+ +   +C+IEWP+ G    P   I   L+
Sbjct: 71  SYPLERFTLHHFDLYRFSFPEEWEDAGLDELFSANSVCLIEWPQQGGEFTPPADITATLT 130

Query: 133 QGKTGRKATISA 144
               GRK  ++A
Sbjct: 131 HDGDGRKCLLTA 142


>gi|315186997|gb|EFU20754.1| uncharacterized protein family UPF0079, ATPase [Spirochaeta
           thermophila DSM 6578]
          Length = 126

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 75/126 (59%), Gaps = 4/126 (3%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           +GR +AS +     + L   LG GK+ L R + R   +D    V SP++TL  +Y+A +P
Sbjct: 1   MGREIASRITAPVVVALYAPLGGGKTTLTRGLARGWGYDGL--VTSPSYTLATVYEAEVP 58

Query: 82  VAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS-QGKTGRK 139
           + H D YRL+S ++++ LG ++IL  + I +IEW E  ++LLP++++ I +     + RK
Sbjct: 59  IYHIDAYRLASEEDLIYLGLEDILYGDGIAVIEWAEKVKALLPERHVSITIEVVDASRRK 118

Query: 140 ATISAE 145
            T+  E
Sbjct: 119 ITVQEE 124


>gi|331270408|ref|YP_004396900.1| hypothetical protein CbC4_2238 [Clostridium botulinum BKT015925]
 gi|329126958|gb|AEB76903.1| protein of unknown function UPF0079 [Clostridium botulinum
           BKT015925]
          Length = 152

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 72/132 (54%), Gaps = 9/132 (6%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFL-MHDDALEVLSPTFTLVQLYD 77
           T+ +G  +  +   GD + L GDLG+GK+ + + I + L +HD    + SPTF +V  Y 
Sbjct: 11  TVDIGLQIGKLTNSGDIICLIGDLGTGKTHITKGIAKGLEIHD---HITSPTFNIVNEYQ 67

Query: 78  ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQ--- 133
             + + HFD YR++   E+  +GFDE I  + + I+EW      L+P +Y+ + + +   
Sbjct: 68  GRLKLYHFDVYRVNDPDEIEAIGFDEYIFGDGVSIVEWANYIEELIPNEYLKVEIKKLPE 127

Query: 134 -GKTGRKATISA 144
            G   RK TI+ 
Sbjct: 128 LGDNFRKITITC 139


>gi|84501216|ref|ZP_00999421.1| hypothetical protein OB2597_12663 [Oceanicola batsensis HTCC2597]
 gi|84390507|gb|EAQ02995.1| hypothetical protein OB2597_12663 [Oceanicola batsensis HTCC2597]
          Length = 156

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 70/128 (54%), Gaps = 6/128 (4%)

Query: 14  PNEKNTI-CLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           P E   + CL   + + LR GD + L G +G+GK+  AR +I+ L+ D   +V SPT+TL
Sbjct: 13  PEETGDLACL---VGAGLRPGDTILLDGAVGAGKTHFARCLIQSLL-DVPEDVPSPTYTL 68

Query: 73  VQLYDASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           VQ Y      + H D YRLSS  EVVELG +E     +C+IEWP+    L P   + +  
Sbjct: 69  VQTYQTGAGEIWHADLYRLSSATEVVELGLEEAFETAVCLIEWPDRLGDLAPAGALCLTF 128

Query: 132 SQGKTGRK 139
              + G +
Sbjct: 129 EVAEDGMR 136


>gi|325136844|gb|EGC59442.1| hypothetical protein TIGR00150 [Neisseria meningitidis M0579]
          Length = 153

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR S  +E  + G DE+ +   +C+IEWP+ G    P   I   
Sbjct: 69  VESYPLERFTLHHFDLYRFSFPEEWEDAGLDELFSANSVCLIEWPQQGGEFTPPADITAT 128

Query: 131 LSQGKTGRKATISA 144
           L+    GRK  ++A
Sbjct: 129 LTHDGDGRKCLLTA 142


>gi|307109880|gb|EFN58117.1| hypothetical protein CHLNCDRAFT_57163 [Chlorella variabilis]
          Length = 258

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 61/117 (52%), Gaps = 3/117 (2%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD- 77
           T  L    A  LR  DC  L G +G+GKS+ +R+ IR    D+ L V SPTF L  +Y  
Sbjct: 57  TQLLAHFCACELRPADCYLLYGSVGAGKSYFSRAFIRAAAKDEELPVPSPTFLLQNIYTD 116

Query: 78  -ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE-IGRSLLPKKYIDIHLS 132
               P+ HFD YRL+   E   L      NE + ++EWPE +     P + +++H+S
Sbjct: 117 HQGPPIHHFDLYRLTKQYEFARLDLRTSFNEAVSLVEWPERLDAHHQPAERLEVHIS 173


>gi|261378396|ref|ZP_05982969.1| ATPase with strong ADP affinity [Neisseria cinerea ATCC 14685]
 gi|269145168|gb|EEZ71586.1| ATPase with strong ADP affinity [Neisseria cinerea ATCC 14685]
          Length = 153

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 70/132 (53%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H     V SPT+ +V+
Sbjct: 13  DEAATLDLGEAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHRGP--VKSPTYAIVE 70

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLS 132
            Y      + HFD YR ++ +E  + G DE+ +   +C+IEWP+ G    P   I   L+
Sbjct: 71  SYPLKPFTLHHFDLYRFTTPEEWEDAGLDELFSANSVCLIEWPQQGEEFTPPADITATLT 130

Query: 133 QGKTGRKATISA 144
               GRK  ++A
Sbjct: 131 HDGDGRKCLLTA 142


>gi|119946848|ref|YP_944528.1| hypothetical protein Ping_3242 [Psychromonas ingrahamii 37]
 gi|119865452|gb|ABM04929.1| hypothetical protein UPF0079 [Psychromonas ingrahamii 37]
          Length = 152

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 72/133 (54%), Gaps = 9/133 (6%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           +NF ++ L      N + T+  G  L++  +   C+ L GDLG+GK+ L R  I+ L H 
Sbjct: 2   LNFFKEELL-----NAEQTVAFGGRLSAACKQPVCIYLHGDLGAGKTTLTRGFIQGLGHI 56

Query: 61  DALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIG 118
               V SPT+TLV+ Y+ A   V HFD YRL   +E+  +G  D       C++EWPE G
Sbjct: 57  G--HVKSPTYTLVEPYELADWQVYHFDLYRLGDPEELEFMGIRDYFTATSHCLVEWPERG 114

Query: 119 RSLLPKKYIDIHL 131
             +LP   ID+ L
Sbjct: 115 EGILPSPDIDLTL 127


>gi|56707521|ref|YP_169417.1| nucleotide-binding protein, yjeE [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110669992|ref|YP_666549.1| nucleotide-binding protein, yjeE [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134302541|ref|YP_001122511.1| hypothetical protein FTW_1704 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|187931144|ref|YP_001891128.1| hypothetical protein FTM_0292 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|224456586|ref|ZP_03665059.1| hypothetical protein FtultM_01927 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254370040|ref|ZP_04986046.1| hypothetical protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254874339|ref|ZP_05247049.1| uncharacterized P-loop hydrolase family protein [Francisella
           tularensis subsp. tularensis MA00-2987]
 gi|56604013|emb|CAG45003.1| Nucleotide-binding protein, yjeE [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110320325|emb|CAL08386.1| Nucleotide-binding protein, yjeE [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134050318|gb|ABO47389.1| Uncharacterised P-loop hydrolase family protein [Francisella
           tularensis subsp. tularensis WY96-3418]
 gi|151568284|gb|EDN33938.1| hypothetical protein FTBG_01130 [Francisella tularensis subsp.
           tularensis FSC033]
 gi|187712053|gb|ACD30350.1| conserved hypothetical protein [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|254840338|gb|EET18774.1| uncharacterized P-loop hydrolase family protein [Francisella
           tularensis subsp. tularensis MA00-2987]
 gi|282158662|gb|ADA78053.1| Uncharacterized P-loop hydrolase family protein [Francisella
           tularensis subsp. tularensis NE061598]
          Length = 136

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 72/135 (53%), Gaps = 4/135 (2%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +  I + +E+    L +  +  L+ G  + L GDLG+GK+   + I+  L +     V S
Sbjct: 1   MKSILVNDEEQMYQLAKEYSQQLKPGQIIYLYGDLGAGKTTFVKGILNALGYTG--NVKS 58

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+     + HFD YRL+  +E+  +G  +  N++ IC IEWPE G+  LP  
Sbjct: 59  PTYTLVESYEFDKFDIYHFDLYRLADPEELEWIGARDYFNQKDICFIEWPEKGKGFLPLN 118

Query: 126 YIDIHLSQGKTGRKA 140
              +H+     GR+ 
Sbjct: 119 TTKVHIKYLAQGRQV 133


>gi|152987898|ref|YP_001350996.1| hypothetical protein PSPA7_5677 [Pseudomonas aeruginosa PA7]
 gi|150963056|gb|ABR85081.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 155

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 70/131 (53%), Gaps = 4/131 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++    E   + LG  +A        + L GDLG+GK+ L+R I+R L H  A  V SPT
Sbjct: 5   ILSAEGEDAMVELGGRIARASGGQGVIYLHGDLGAGKTTLSRGILRGLGH--AGSVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           FTLV+ Y+   +   HFD YRL+  +E+   G  D      +C+IEWPE G  +LP   +
Sbjct: 63  FTLVEPYEIGELRAYHFDLYRLADPEELEFFGIRDYFDGSALCLIEWPERGAGVLPTADL 122

Query: 128 DIHLSQGKTGR 138
           DI ++    GR
Sbjct: 123 DITITAQAGGR 133


>gi|154502860|ref|ZP_02039920.1| hypothetical protein RUMGNA_00680 [Ruminococcus gnavus ATCC 29149]
 gi|153796399|gb|EDN78819.1| hypothetical protein RUMGNA_00680 [Ruminococcus gnavus ATCC 29149]
          Length = 142

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 8/140 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I   + + T  LG+ L      G   TL+GDLG GK+   +     L   +   V SPT
Sbjct: 2   IIETRSAQETFQLGKELGEKAYPGQVFTLTGDLGVGKTVFTQGFAAGLGITEP--VNSPT 59

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           FT+VQ+Y+   +P  HFD YR+   +E+ E+GF D ++ E + +IEW  +   +LP+K  
Sbjct: 60  FTIVQVYEEGRLPFYHFDVYRIGDVEEMDEVGFEDYVMGEGVSLIEWANLIEEILPQKRT 119

Query: 128 DI----HLSQGKTGRKATIS 143
           +I    +L +G   RK T+ 
Sbjct: 120 EITIEKNLEEGFDYRKITVE 139


>gi|254244163|ref|ZP_04937485.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|126197541|gb|EAZ61604.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
          Length = 155

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 70/131 (53%), Gaps = 4/131 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++    E   + LG  +A        + L GDLG+GK+ L+R I+R L H  A  V SPT
Sbjct: 5   ILSAEGEDAMLELGGRIARTSGGQGVIYLHGDLGAGKTTLSRGILRGLGH--AGSVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           FTLV+ Y+   +   HFD YRL+  +E+   G  D      +C+IEWPE G  +LP   +
Sbjct: 63  FTLVEPYEIGELRAYHFDLYRLADAEELEFFGIRDYFDGSALCLIEWPERGAGVLPTADL 122

Query: 128 DIHLSQGKTGR 138
           DI ++    GR
Sbjct: 123 DITITAQAGGR 133


>gi|49080312|gb|AAT50003.1| PA4948 [synthetic construct]
          Length = 156

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 70/131 (53%), Gaps = 4/131 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++    E   + LG  +A        + L GDLG+GK+ L+R I+R L H  A  V SPT
Sbjct: 5   ILSAEGEDAMLELGGRIARASGGQGVIYLHGDLGAGKTTLSRGILRGLGH--AGSVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           FTLV+ Y+   +   HFD YRL+  +E+   G  D      +C+IEWPE G  +LP   +
Sbjct: 63  FTLVEPYEIGELRAYHFDLYRLADAEELEFFGIRDYFDGSALCLIEWPERGAGVLPTADL 122

Query: 128 DIHLSQGKTGR 138
           DI ++    GR
Sbjct: 123 DITITAQAGGR 133


>gi|293393218|ref|ZP_06637533.1| ATPase with strong ADP affinity [Serratia odorifera DSM 4582]
 gi|291424364|gb|EFE97578.1| ATPase with strong ADP affinity [Serratia odorifera DSM 4582]
          Length = 140

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 69/123 (56%), Gaps = 4/123 (3%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASI 80
           +G  LA        + L GDLG+GK+  +R  ++ L H     V SPT+TLV+ Y    +
Sbjct: 1   MGAALAKACDRASVIYLYGDLGAGKTTFSRGFLQALGHQG--NVKSPTYTLVEPYALQPL 58

Query: 81  PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRK 139
            V HFD YRL+  +E+  +G  D    + IC++EWP+ G  +LP+  + +HLS    GR+
Sbjct: 59  AVYHFDLYRLADPEELEFMGIRDYFAQDAICLVEWPQQGTGVLPEPDLALHLSYHDRGRE 118

Query: 140 ATI 142
           A I
Sbjct: 119 ARI 121


>gi|15600141|ref|NP_253635.1| hypothetical protein PA4948 [Pseudomonas aeruginosa PAO1]
 gi|218894043|ref|YP_002442912.1| putative ATPase [Pseudomonas aeruginosa LESB58]
 gi|254238337|ref|ZP_04931660.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|9951228|gb|AAG08333.1|AE004907_11 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126170268|gb|EAZ55779.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|218774271|emb|CAW30088.1| putative ATPase [Pseudomonas aeruginosa LESB58]
          Length = 155

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 70/131 (53%), Gaps = 4/131 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++    E   + LG  +A        + L GDLG+GK+ L+R I+R L H  A  V SPT
Sbjct: 5   ILSAEGEDAMLELGGRIARASGGQGVIYLHGDLGAGKTTLSRGILRGLGH--AGSVKSPT 62

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           FTLV+ Y+   +   HFD YRL+  +E+   G  D      +C+IEWPE G  +LP   +
Sbjct: 63  FTLVEPYEIGELRAYHFDLYRLADAEELEFFGIRDYFDGSALCLIEWPERGAGVLPTADL 122

Query: 128 DIHLSQGKTGR 138
           DI ++    GR
Sbjct: 123 DITITAQAGGR 133


>gi|238897713|ref|YP_002923392.1| putative P-loop hydrolase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465469|gb|ACQ67243.1| putative P-loop hydrolase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 167

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 77/125 (61%), Gaps = 7/125 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E+ TI LG  L++       + LSGDLG+GK+  +R  I+   +    +V SPT+TLV+
Sbjct: 10  DERATIKLGATLSAACHHAIVIALSGDLGAGKTTFSRGFIQASGYTG--KVKSPTYTLVE 67

Query: 75  LYDASIP--VAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH- 130
            Y    P  + HFD YR+S  QE+  +G  +  NE+ IC+IEWP+ G S+LPK  +++H 
Sbjct: 68  SY-LLFPKTIHHFDLYRVSDPQELEWIGIRDYFNEQAICLIEWPDKGISVLPKADLELHF 126

Query: 131 LSQGK 135
           + QG+
Sbjct: 127 IYQGQ 131


>gi|332290022|ref|YP_004420874.1| putative ATPase [Gallibacterium anatis UMN179]
 gi|330432918|gb|AEC17977.1| putative ATPase [Gallibacterium anatis UMN179]
          Length = 161

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 80/137 (58%), Gaps = 7/137 (5%)

Query: 13  IPNEKNTICLGRHLASILR---LGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           + NE+ TI LG+ L+  LR       + L+G LG+GK+ L R+II+ + ++    V SPT
Sbjct: 9   LANEEATIALGQKLSRFLRSPTQNFVIYLNGQLGAGKTTLTRAIIQAMGYNG--NVKSPT 66

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYI 127
           + LV+ Y      + HFD YRLS  +E+  +GF +   E  +C++EW E G  L+P+  +
Sbjct: 67  YALVEEYHLQQKSIYHFDLYRLSDPEELEFIGFRDYFRENTLCLLEWAEKGGDLIPQPDL 126

Query: 128 DIHLSQGKTGRKATISA 144
            I++   +  R+ T++A
Sbjct: 127 LINIEYQQQARQITLTA 143


>gi|159045974|ref|YP_001534768.1| hypothetical protein Dshi_3434 [Dinoroseobacter shibae DFL 12]
 gi|157913734|gb|ABV95167.1| protein of unknown function UPF0079 [Dinoroseobacter shibae DFL 12]
          Length = 165

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 79/136 (58%), Gaps = 6/136 (4%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDAL--EVLSPTFTL 72
           +E +    G  LA +L+ GD L L G++G+GK+ L+R+II+  +    +  +V SPTFTL
Sbjct: 13  SEDSLRAFGACLAPVLQPGDALLLVGEIGAGKTVLSRAIIQTRLAAIGVMEDVPSPTFTL 72

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE-IGRSLLPKK-YIDI 129
           VQ Y   ++ + H D YRL+  +EVV LG +E   + I +IEWP+ +G  + P    ID+
Sbjct: 73  VQTYALGNVDLWHCDLYRLTDPEEVVALGLEEAFRDAITLIEWPDRLGDEIPPNALVIDL 132

Query: 130 HLSQGKT-GRKATISA 144
            +       R  T++A
Sbjct: 133 RIPDATPLQRDMTLTA 148


>gi|315649244|ref|ZP_07902333.1| hypothetical protein PVOR_28749 [Paenibacillus vortex V453]
 gi|315275232|gb|EFU38601.1| hypothetical protein PVOR_28749 [Paenibacillus vortex V453]
          Length = 156

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 74/131 (56%), Gaps = 5/131 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  L   LA     G  + L GDLG+GK+  ++   + L  +    V SPTFT+++ Y
Sbjct: 7   EETEQLAAWLAMRAEAGTVIGLDGDLGAGKTAFSKQFAQHLGVNGV--VNSPTFTIIKEY 64

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHL-SQG 134
           +  +P+ H D YRLS   E  ELG DE    E +C++EW  +   L+P++Y+ IHL + G
Sbjct: 65  EGRLPLYHMDVYRLSV-DEADELGLDEYFFGEGVCLVEWSSLITELMPERYLHIHLETTG 123

Query: 135 KTGRKATISAE 145
           +  R  T++++
Sbjct: 124 EAHRNITLTSQ 134


>gi|325474041|gb|EGC77229.1| hypothetical protein HMPREF9353_01579 [Treponema denticola F0402]
          Length = 143

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 71/120 (59%), Gaps = 3/120 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +  E++TI LG+ +   L+ GD + L G L +GK++L + I + L  D   ++ SPTFTL
Sbjct: 5   VKTEEDTINLGKKIGKQLKKGDVVALDGSLAAGKTYLTKGIAQGL--DIEEDITSPTFTL 62

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL 131
           +  Y   + + H D YRL   ++ ++LG +E+L  + +C+IEW +  + +LP   I I +
Sbjct: 63  ISEYSGRLHLYHMDVYRLEGVEDFLDLGTEEMLYGDGVCVIEWSKKVKQVLPPSTIYIGI 122


>gi|325142939|gb|EGC65298.1| hypothetical protein TIGR00150 [Neisseria meningitidis 961-5945]
          Length = 153

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 70/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR S  +E  + G DE+     +C+IEWP+ G    P   I   
Sbjct: 69  VESYPLERFTLHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITAT 128

Query: 131 LSQGKTGRKATISA 144
           L+    GRK  ++A
Sbjct: 129 LTHDGDGRKCLLTA 142


>gi|309389868|gb|ADO77748.1| Uncharacterized protein family UPF0079, ATPase [Halanaerobium
           praevalens DSM 2228]
          Length = 156

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 80/146 (54%), Gaps = 8/146 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  T      LA+++     + L G+LG+GK+ + ++    L + D  +V SPTF L+Q
Sbjct: 11  SEAETKKFAAKLANLITSPALILLKGELGTGKTLITKAAAAELGYQD--DVTSPTFNLIQ 68

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y A   + H D YRL    +++++GF++ L+ E +  IEWP++  +L+P  +I I +++
Sbjct: 69  EYQAETEIIHMDLYRLEQSDQLLDIGFEDYLDREAVIFIEWPDLALALIPADFIFIEITK 128

Query: 134 -GKTGRKATISAE----RWIISHINQ 154
                RK  +  E    + II  +N+
Sbjct: 129 IAAQKRKIVVRGEGEQSKLIIERLNK 154


>gi|325198861|gb|ADY94317.1| conserved hypothetical protein TIGR00150 [Neisseria meningitidis
           G2136]
          Length = 153

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 70/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR S  +E  + G DE+     +C+IEWP+ G    P   I   
Sbjct: 69  VESYPLERFTLHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITAT 128

Query: 131 LSQGKTGRKATISA 144
           L+    GRK  ++A
Sbjct: 129 LTHDGGGRKCLLTA 142


>gi|309792522|ref|ZP_07686985.1| hypothetical protein OSCT_2936 [Oscillochloris trichoides DG6]
 gi|308225425|gb|EFO79190.1| hypothetical protein OSCT_2936 [Oscillochloris trichoides DG6]
          Length = 173

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 68/120 (56%), Gaps = 8/120 (6%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
            T  +G+ L    + GD + L GD G GK+ L + + R L   D   V SP+F +V  Y 
Sbjct: 24  QTERIGQRLGEQFQAGDLILLIGDFGVGKTHLVKGVARGLESQDL--VTSPSFVIVNEYR 81

Query: 78  A-----SIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHL 131
           A     ++P+ H D YR++   E+  +G DE+ + + +C+IEWPE   +LLP +++ IH+
Sbjct: 82  AGRSRRAMPIYHADLYRIAETGEITTIGLDELWDGDGVCLIEWPERAGALLPSEHLAIHM 141


>gi|90408485|ref|ZP_01216644.1| putative nucleotide-binding protein [Psychromonas sp. CNPT3]
 gi|90310417|gb|EAS38543.1| putative nucleotide-binding protein [Psychromonas sp. CNPT3]
          Length = 152

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 69/119 (57%), Gaps = 4/119 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           + + T+  G+ L++      C+ L GDLG+GK+ L R  I+ L H     V SPT+TLV+
Sbjct: 11  DAEQTVLFGKRLSAACDTAICIYLHGDLGAGKTTLTRGFIQGLGHKG--HVKSPTYTLVE 68

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHL 131
            Y+  +  V HFD YRL S +E+  +G  D   ++  C++EWPE G  +L +  ID+ L
Sbjct: 69  PYELETWTVYHFDLYRLGSPEELEFMGIRDYFTDQSHCLVEWPERGEGVLAQADIDLTL 127


>gi|15676368|ref|NP_273504.1| hypothetical protein NMB0457 [Neisseria meningitidis MC58]
 gi|7225682|gb|AAF40894.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|316985799|gb|EFV64742.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
 gi|325130824|gb|EGC53558.1| hypothetical protein TIGR00150 [Neisseria meningitidis OX99.30304]
 gi|325140969|gb|EGC63476.1| hypothetical protein TIGR00150 [Neisseria meningitidis CU385]
 gi|325199642|gb|ADY95097.1| conserved hypothetical protein TIGR00150 [Neisseria meningitidis
           H44/76]
          Length = 153

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 70/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR S  +E  + G DE+     +C+IEWP+ G    P   I   
Sbjct: 69  VESYPLERFTLHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITAT 128

Query: 131 LSQGKTGRKATISA 144
           L+    GRK  ++A
Sbjct: 129 LTHDGDGRKCLLTA 142


>gi|325128816|gb|EGC51676.1| hypothetical protein TIGR00150 [Neisseria meningitidis N1568]
          Length = 153

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 70/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR S  +E  + G DE+     +C+IEWP+ G    P   I   
Sbjct: 69  VESYPLERFTLHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITAT 128

Query: 131 LSQGKTGRKATISA 144
           L+    GRK  ++A
Sbjct: 129 LTHDGDGRKCLLTA 142


>gi|218768778|ref|YP_002343290.1| hypothetical protein NMA2027 [Neisseria meningitidis Z2491]
 gi|121052786|emb|CAM09132.1| conserved hypothetical protein [Neisseria meningitidis Z2491]
 gi|319411018|emb|CBY91416.1| putative ATPase [Neisseria meningitidis WUE 2594]
          Length = 153

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 70/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR S  +E  + G DE+     +C+IEWP+ G    P   I   
Sbjct: 69  VESYPLERFTLHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITAT 128

Query: 131 LSQGKTGRKATISA 144
           L+    GRK  ++A
Sbjct: 129 LTHDGGGRKCLLTA 142


>gi|71279211|ref|YP_267087.1| hypothetical protein CPS_0321 [Colwellia psychrerythraea 34H]
 gi|71144951|gb|AAZ25424.1| conserved hypothetical protein TIGR00150 [Colwellia psychrerythraea
           34H]
          Length = 162

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 75/140 (53%), Gaps = 9/140 (6%)

Query: 13  IPNEKNTICLGRHLASILRLGDC-----LTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           + +E  TI +G  LA +L+         + L+GDLG+GK+ L R  +R + H     V S
Sbjct: 8   LADEAATIAIGSGLAEVLKNATVQQALVVYLNGDLGAGKTTLTRGFVRGMGHTG--NVKS 65

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+     V HFD YRL+  +E+  +G  D   N+  C IEWPE G  LL K 
Sbjct: 66  PTYTLVEPYELGEWRVFHFDLYRLADAEELEYMGIRDYFNNDCCCFIEWPEKGTGLLAKA 125

Query: 126 YIDIHLSQGKTGRKATISAE 145
            + I+++     R   + AE
Sbjct: 126 DLIINIAYQDEQRVIKLQAE 145


>gi|332185763|ref|ZP_08387510.1| uncharacterized P-loop hydrolase UPF0079 family protein
           [Sphingomonas sp. S17]
 gi|332014121|gb|EGI56179.1| uncharacterized P-loop hydrolase UPF0079 family protein
           [Sphingomonas sp. S17]
          Length = 148

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 77/144 (53%), Gaps = 11/144 (7%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +   T   GR LA+ +R GD +TL+G LG+GK+ LAR ++  L      E  SP+F +VQ
Sbjct: 7   DAAATEDFGRRLAAHIRPGDVVTLTGTLGAGKTSLARGLLAALGLPG--EAPSPSFAIVQ 64

Query: 75  LY---DASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE-IGRSLLPKKY---I 127
            Y   +  IP+ H D YRL   +++ ELG DE L +   ++EWP+  G    P+     +
Sbjct: 65  PYAPPETVIPILHVDLYRLDGPEQLDELGLDEALWDSALVVEWPDRAGEGAWPQALALTL 124

Query: 128 DIHLSQGK--TGRKATISAERWII 149
           ++  S G+  T +  +    RW I
Sbjct: 125 EMDPSGGRILTAKVPSGWEARWPI 148


>gi|167759780|ref|ZP_02431907.1| hypothetical protein CLOSCI_02143 [Clostridium scindens ATCC 35704]
 gi|167662399|gb|EDS06529.1| hypothetical protein CLOSCI_02143 [Clostridium scindens ATCC 35704]
          Length = 141

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 69/126 (54%), Gaps = 4/126 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI    EK T  LG  L    R G   TL GDLG GK+   + +   L  ++   V SPT
Sbjct: 2   VIESNCEKETYELGCRLGQEARAGQVYTLVGDLGVGKTVFTKGLAAGLGIEEP--VSSPT 59

Query: 70  FTLVQLY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           FT+VQ+Y +  +P  HFD YR+   +E+ E+GF D +  E + +IEW  +   +LP+ Y 
Sbjct: 60  FTIVQVYEEGRLPFYHFDVYRIGDVEEMDEVGFEDYVYGEGVSLIEWANLIEEILPQHYT 119

Query: 128 DIHLSQ 133
           ++ + +
Sbjct: 120 EVKIEK 125


>gi|121635400|ref|YP_975645.1| hypothetical protein NMC1693 [Neisseria meningitidis FAM18]
 gi|254805514|ref|YP_003083735.1| putative cell wall biosynthesis ATPase or kinase [Neisseria
           meningitidis alpha14]
 gi|120867106|emb|CAM10873.1| conserved hypothetical protein [Neisseria meningitidis FAM18]
 gi|254669056|emb|CBA07543.1| putative cell wall biosynthesis ATPase or kinase [Neisseria
           meningitidis alpha14]
 gi|254671043|emb|CBA07887.1| conserved hypothetical protein [Neisseria meningitidis alpha153]
 gi|325132880|gb|EGC55558.1| hypothetical protein TIGR00150 [Neisseria meningitidis M6190]
 gi|325138825|gb|EGC61376.1| hypothetical protein TIGR00150 [Neisseria meningitidis ES14902]
          Length = 153

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 70/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR S  +E  + G DE+     +C+IEWP+ G    P   I   
Sbjct: 69  VESYPLERFTLHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITAT 128

Query: 131 LSQGKTGRKATISA 144
           L+    GRK  ++A
Sbjct: 129 LTHDGGGRKCLLTA 142


>gi|261401389|ref|ZP_05987514.1| ATPase with strong ADP affinity [Neisseria lactamica ATCC 23970]
 gi|304386742|ref|ZP_07369011.1| ATPase with strong ADP affinity [Neisseria meningitidis ATCC 13091]
 gi|269208608|gb|EEZ75063.1| ATPase with strong ADP affinity [Neisseria lactamica ATCC 23970]
 gi|304339177|gb|EFM05262.1| ATPase with strong ADP affinity [Neisseria meningitidis ATCC 13091]
 gi|325203562|gb|ADY99015.1| conserved hypothetical protein [Neisseria meningitidis M01-240355]
          Length = 153

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 69/132 (52%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +V+
Sbjct: 13  DEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAIVE 70

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLS 132
            Y      + HFD YR S  +E  + G DE+     +C+IEWP+ G    P   I   L+
Sbjct: 71  SYPLERFTLHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITATLT 130

Query: 133 QGKTGRKATISA 144
               GRK  ++A
Sbjct: 131 HDGGGRKCLLTA 142


>gi|188590370|ref|YP_001919926.1| hypothetical protein CLH_0525 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|251778663|ref|ZP_04821583.1| conserved hypothetical protein [Clostridium botulinum E1 str. 'BoNT
           E Beluga']
 gi|188500651|gb|ACD53787.1| conserved hypothetical protein [Clostridium botulinum E3 str.
           Alaska E43]
 gi|243082978|gb|EES48868.1| conserved hypothetical protein [Clostridium botulinum E1 str. 'BoNT
           E Beluga']
          Length = 153

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 74/131 (56%), Gaps = 8/131 (6%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD- 77
           T  LG  +  +L  GD + L+GDLG+GK+ + + I   L   D  ++ SPTFT+V  YD 
Sbjct: 11  TTNLGIEIGKLLNSGDIICLTGDLGTGKTHITKGIALGLDIKD--DITSPTFTIVNEYDE 68

Query: 78  ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDI----HLS 132
             + + HFD YR++   E+  +GFD+ I ++ + IIEW      +LP  ++ I    +L 
Sbjct: 69  GRLKLNHFDVYRVNDPDEIYAIGFDDYIFSDSVSIIEWANYIEDILPDDFLHINIEKNLE 128

Query: 133 QGKTGRKATIS 143
           +G   RK T++
Sbjct: 129 KGDNYRKITLT 139


>gi|226227358|ref|YP_002761464.1| hypothetical protein GAU_1952 [Gemmatimonas aurantiaca T-27]
 gi|226090549|dbj|BAH38994.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 159

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 69/122 (56%), Gaps = 2/122 (1%)

Query: 14  PNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV 73
           P+  +    G+ L ++L     +TL GDLG+GK+ LAR++   L       V SPTF+LV
Sbjct: 18  PDRDSLDAWGKALGAVLPRPTVITLEGDLGTGKTTLARALCAGLGVLALDAVTSPTFSLV 77

Query: 74  QLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHL 131
           Q Y A   P+ H D YRL    ++  LG+DE++++  + ++EWP+    +LP   I I L
Sbjct: 78  QQYAAPRGPIVHVDLYRLKGPSDLEALGWDELVDQSPVLLVEWPDRAAKMLPSDTIGISL 137

Query: 132 SQ 133
           + 
Sbjct: 138 AH 139


>gi|212703319|ref|ZP_03311447.1| hypothetical protein DESPIG_01362 [Desulfovibrio piger ATCC 29098]
 gi|212673279|gb|EEB33762.1| hypothetical protein DESPIG_01362 [Desulfovibrio piger ATCC 29098]
          Length = 174

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 71/132 (53%), Gaps = 7/132 (5%)

Query: 18  NTICLGRHLASILRLGD---CLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +T CLG  LA +++       L L GDLGSGK+ L RS +  L   D  E+ SP+FT+  
Sbjct: 13  DTACLGTLLAGMMQNAPQVRALLLQGDLGSGKTTLTRSFVAALPGGDQAEISSPSFTICN 72

Query: 75  LYDASIPVAHFDFYRL-SSHQEVVELGFDEILNERICIIEWPE-IGRSLLPKKYIDIHLS 132
            Y    PV H D YR  +S  + V    D   +  ICI+EW + I  + LPK+++DI L 
Sbjct: 73  NYPTCPPVLHCDLYRCPASLPDEVWDALDA--DAGICIVEWAQYIPEAALPKEFLDIRLE 130

Query: 133 QGKTGRKATISA 144
             + GR  T+ A
Sbjct: 131 SCEKGRFLTVMA 142


>gi|114567384|ref|YP_754538.1| hypothetical protein Swol_1869 [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|114338319|gb|ABI69167.1| protein of unknown function UPF0079 [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 158

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 77/136 (56%), Gaps = 6/136 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I + ++     LG  LA +L  GD + L G LG+GK+ L R I   L +  +  V SPTF
Sbjct: 3   ISVKSDDEMRKLGYDLARVLEKGDIVYLRGVLGAGKTTLVRGISHGLGY--SGRVNSPTF 60

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKK--YI 127
           TL+ +Y A I + HFD YRL +  ++ +LG++E L  + I +IEWPE G+   P++  +I
Sbjct: 61  TLLNIYPAPIEIYHFDLYRLEN-CDLHDLGWEEYLEGDGISLIEWPEAGQGQFPREAMFI 119

Query: 128 DIHLSQGKTGRKATIS 143
           DI L      R+  + 
Sbjct: 120 DIKLCDDDYERERVVE 135


>gi|167756620|ref|ZP_02428747.1| hypothetical protein CLORAM_02157 [Clostridium ramosum DSM 1402]
 gi|237733909|ref|ZP_04564390.1| ATP/GTP hydrolase [Mollicutes bacterium D7]
 gi|167702795|gb|EDS17374.1| hypothetical protein CLORAM_02157 [Clostridium ramosum DSM 1402]
 gi|229382990|gb|EEO33081.1| ATP/GTP hydrolase [Coprobacillus sp. D7]
          Length = 149

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 71/125 (56%), Gaps = 5/125 (4%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI + N + TI LG  L  +L+    LTLSGDLG+GK+   + I + L     +   SPT
Sbjct: 4   VIKVNNLEETIALGNRLGLLLQPNMLLTLSGDLGAGKTTFTKGIGQGLGITKVIN--SPT 61

Query: 70  FTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYID 128
           FT+++ Y   + ++HFD YRL    +  +LGF+EI + + +C++EW      +LP   + 
Sbjct: 62  FTILKQYQGRLNLSHFDAYRLEGQDD--DLGFEEIFDSDDVCVVEWANFIEDILPVDRLT 119

Query: 129 IHLSQ 133
           I + +
Sbjct: 120 IEIKK 124


>gi|84685777|ref|ZP_01013673.1| hypothetical protein 1099457000261_RB2654_13700 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665870|gb|EAQ12344.1| hypothetical protein RB2654_13700 [Rhodobacterales bacterium
           HTCC2654]
          Length = 162

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 70/136 (51%), Gaps = 6/136 (4%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSII--RFLM 58
           MN +  H   +  P +  T       A ++R GD   LSG +G+GK+   RS+I  R   
Sbjct: 1   MNDAPAHRIRLTSPGK--TAQFAAAFARLVRPGDVFLLSGQIGAGKTHFTRSLIQARLAY 58

Query: 59  HDDALE-VLSPTFTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
            D  +E V SPTFTLVQ Y+     + H D YRL+   EV ELG  +  +  +C+IEWP+
Sbjct: 59  ADKPVEDVPSPTFTLVQTYEVDGFEIWHADLYRLTHPDEVEELGLFDAFDTAVCLIEWPD 118

Query: 117 IGRSLLPKKYIDIHLS 132
               L P K I +  S
Sbjct: 119 RLGDLAPAKAIGMDFS 134


>gi|306832806|ref|ZP_07465941.1| ATP/GTP hydrolase [Streptococcus bovis ATCC 700338]
 gi|304425041|gb|EFM28172.1| ATP/GTP hydrolase [Streptococcus bovis ATCC 700338]
          Length = 147

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 75/130 (57%), Gaps = 3/130 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE   I  G  L   L+ GD L L+G+LG+GK+ L + I + L  D    + SPT+T+V+
Sbjct: 6   NEDELIAYGNRLGQELQAGDVLVLTGNLGAGKTTLTKGIAKGL--DIHQMIKSPTYTIVR 63

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+ S+P+ H D YR+ +  + ++L  D +  + + +IEW E+  + L   Y+++ ++  
Sbjct: 64  EYEGSLPLYHLDVYRIGNDPDSIDLD-DFLYGDGVTVIEWGELLETDLLGDYLEVVITPS 122

Query: 135 KTGRKATISA 144
             GR+ T+ A
Sbjct: 123 GDGREITLHA 132


>gi|261391970|emb|CAX49434.1| putative ATPase [Neisseria meningitidis 8013]
          Length = 153

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 72/134 (53%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHLGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR ++ +E  + G DE+ +   +C+IEWP+ G    P   I   
Sbjct: 69  VESYPLERFTLHHFDLYRFTTPEEWEDAGLDELFSANSVCLIEWPQQGGEFTPPADITAT 128

Query: 131 LSQGKTGRKATISA 144
           L+    GRK  ++A
Sbjct: 129 LTHDGDGRKCLLTA 142


>gi|89896723|ref|YP_520210.1| hypothetical protein DSY3977 [Desulfitobacterium hafniense Y51]
 gi|219667447|ref|YP_002457882.1| hypothetical protein Dhaf_1390 [Desulfitobacterium hafniense DCB-2]
 gi|89336171|dbj|BAE85766.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219537707|gb|ACL19446.1| protein of unknown function UPF0079 [Desulfitobacterium hafniense
           DCB-2]
          Length = 167

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 79/153 (51%), Gaps = 17/153 (11%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-- 76
           T  LG +L  +LR GD + L+GDLG+GK+ LA+ I   L   + +   SPTFT    Y  
Sbjct: 13  THALGYNLGKVLRGGDVVCLAGDLGAGKTALAKGIGEALAVQEPM--TSPTFTFQIEYSG 70

Query: 77  ---DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHL- 131
              D+ + + H D YRL   +EV  +G ++   E  IC+IEWP I   +LP   + I + 
Sbjct: 71  MAQDSPVRLIHMDLYRLRYPEEVEIIGVEDAFQEDAICLIEWPGIAEDILPDDSLAIRIE 130

Query: 132 SQGKTGRKATIS--AERW------IISHINQMN 156
             G+  R    S  AE W      II+ IN +N
Sbjct: 131 GSGEEPRLIGFSSQAEAWAERLKDIITEINLVN 163


>gi|297621918|ref|YP_003710055.1| hypothetical protein wcw_1705 [Waddlia chondrophila WSU 86-1044]
 gi|297377219|gb|ADI39049.1| conserved hypothetical protein [Waddlia chondrophila WSU 86-1044]
          Length = 144

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           LG  L   L     +   GDLG+GK+   + + R     D  EV SPTF  + +Y+  +P
Sbjct: 20  LGFQLGKQLPNRSVVCFFGDLGAGKTTFIKGLARGAGGIDPDEVNSPTFVYLNIYEGQLP 79

Query: 82  VAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDI---HLSQGK 135
           + HFD YRL   QE + +G DE LN E IC +EW E     LP K I +   H+ Q K
Sbjct: 80  IYHFDLYRLKDVQEFIRMGLDEYLNGEGICCLEWSERIEGHLPPKTIRVEICHVDQSK 137


>gi|87200017|ref|YP_497274.1| hypothetical protein Saro_2001 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135698|gb|ABD26440.1| protein of unknown function UPF0079 [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 149

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 63/116 (54%), Gaps = 6/116 (5%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS---IPVAHFDFYR 89
           GD + LSG LG+GK+ LAR II  L H+   EV SP+F +V+LYD     +P+ H DFYR
Sbjct: 25  GDVVALSGGLGAGKTTLARGIIAALGHEG--EVPSPSFAIVELYDPPSVRLPLVHADFYR 82

Query: 90  LSSHQEVVELGFDEILNERICIIEWPE-IGRSLLPKKYIDIHLSQGKTGRKATISA 144
           L    E  E+G D+       + EWPE  G        + I L   + GR+A +S 
Sbjct: 83  LDDPSEADEIGLDDYRQGAALLAEWPEHAGGFAHEPGCLSIMLESTEKGRRAIVSG 138


>gi|312897888|ref|ZP_07757303.1| conserved hypothetical protein TIGR00150 [Megasphaera
           micronuciformis F0359]
 gi|310621087|gb|EFQ04632.1| conserved hypothetical protein TIGR00150 [Megasphaera
           micronuciformis F0359]
          Length = 155

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 71/136 (52%), Gaps = 5/136 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  TI  G  +  +L+ GD + L GDLG+GK+ L +   + +       V+SPTF+L+ 
Sbjct: 8   SEAETIAFGECVGKVLKQGDVIALKGDLGAGKTHLVQGAAKQMGITSP--VVSPTFSLMN 65

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQ- 133
           +YD   P+ HFDFYRL    E+  +  +E     I  +EW E     LP     I + + 
Sbjct: 66  VYDHVPPLHHFDFYRLEEEYELDSIDPEEYWETGISFVEWSEKFPHRLPDDAAVITIKKT 125

Query: 134 GKTGRKATISAE--RW 147
           G T R+ T+ A+  RW
Sbjct: 126 GDTQREITVEADASRW 141


>gi|317500824|ref|ZP_07959037.1| nucleotide-binding protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331089700|ref|ZP_08338597.1| hypothetical protein HMPREF1025_02180 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|316897791|gb|EFV19849.1| nucleotide-binding protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330404281|gb|EGG83827.1| hypothetical protein HMPREF1025_02180 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 142

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 75/133 (56%), Gaps = 8/133 (6%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T   GR L      G  +TL+GDLG GK+   + + + L  ++   V SPTFT+VQ+Y
Sbjct: 9   QETFSAGRQLGEKAFPGQVITLTGDLGVGKTVFTQGLAKGLGIEEP--VNSPTFTIVQVY 66

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDI----H 130
           D   +P+ HFD YR+   +E+ E+GF+E ++ + + +IEW  +   +LP+   ++     
Sbjct: 67  DEGRLPLYHFDVYRIGDIEEMDEVGFEEYVMGDGVSLIEWANLIEEILPENRTEVIIEKD 126

Query: 131 LSQGKTGRKATIS 143
           L +G   RK  I+
Sbjct: 127 LEKGFDYRKIIIN 139


>gi|227485940|ref|ZP_03916256.1| ATP-binding protein [Anaerococcus lactolyticus ATCC 51172]
 gi|227235985|gb|EEI86000.1| ATP-binding protein [Anaerococcus lactolyticus ATCC 51172]
          Length = 148

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 72/134 (53%), Gaps = 8/134 (5%)

Query: 26  LASILRLGDCLTLSGDLGSGKSFLARSIIRFL-MHDDALEVLSPTFTLVQLYDASIPVAH 84
           LA +L+ GD + L GD+G+GK+ L  S+ RF  ++D +    SPTF +V +YD  I + H
Sbjct: 16  LAPLLKEGDVINLIGDMGAGKTTLVNSLARFFNIYDSS----SPTFAIVNIYDGDIRIYH 71

Query: 85  FDFYRLSSHQEVVELGFDEIL--NERICIIEWPEIGRSLLPKKYIDIHLSQ-GKTGRKAT 141
            D YR  S  +++++ F+        I  +EW E G   LP   I+I + + G + R+ T
Sbjct: 72  LDLYRFESPDDLLDIDFETYFYPESAITFLEWAENGEGYLPDDMINIRIDKLGPSTREIT 131

Query: 142 ISAERWIISHINQM 155
           I  +      IN +
Sbjct: 132 ILNDTERAKEINDL 145


>gi|241663994|ref|YP_002982354.1| hypothetical protein Rpic12D_2410 [Ralstonia pickettii 12D]
 gi|240866021|gb|ACS63682.1| protein of unknown function UPF0079 [Ralstonia pickettii 12D]
          Length = 192

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 72/128 (56%), Gaps = 12/128 (9%)

Query: 15  NEKNTICLGRHLASILR-LGD---CLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           +E  T   G  LA  +R LG     + LSGDLG+GK+ L+R+I+R L H     V SPT+
Sbjct: 26  DEAATSAFGAALAQAVRALGARPLQVQLSGDLGAGKTTLSRAILRGLGHTG--RVRSPTY 83

Query: 71  TLVQLYD-----ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPK 124
           TLV+ YD      +  V HFD YR +  +E  + GF +   E  +C++EWPE  ++LL  
Sbjct: 84  TLVEPYDVAGTTGTQKVYHFDLYRFADPEEWTDAGFRDCFAEPALCLVEWPEKAQALLGT 143

Query: 125 KYIDIHLS 132
             + I LS
Sbjct: 144 PDLHIALS 151


>gi|92113399|ref|YP_573327.1| hypothetical protein Csal_1273 [Chromohalobacter salexigens DSM
           3043]
 gi|91796489|gb|ABE58628.1| protein of unknown function UPF0079 [Chromohalobacter salexigens
           DSM 3043]
          Length = 159

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +PNE   +  G  L   L     + L G+LG+GK+ L R ++R   HD A  V SPT+TL
Sbjct: 5   LPNEAAHVAFGEALGHALGGHGRVHLEGELGAGKTTLTRGVLRAYGHDGA--VKSPTYTL 62

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y    I V HFD YRL   +E+  +G  ++L  + + +IEWP  G   LP   + + 
Sbjct: 63  VEPYVLQGIEVYHFDLYRLGDPEELEFMGARDMLGGDGLSLIEWPSRGEGWLPPPDLVVR 122

Query: 131 LSQGKTGRKATISA 144
           L+    GR+ ++  
Sbjct: 123 LALAGEGREVSLEG 136


>gi|255283221|ref|ZP_05347776.1| ATPase [Bryantella formatexigens DSM 14469]
 gi|255266294|gb|EET59499.1| ATPase [Bryantella formatexigens DSM 14469]
          Length = 145

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 68/119 (57%), Gaps = 4/119 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T   GR L    + G    L+GDLG+GK+   + +   L   +   V SPTFT+VQ+Y
Sbjct: 9   EETFAAGRKLGEQAQPGQIFALTGDLGTGKTVFTKGVAAGLGICEP--VSSPTFTIVQIY 66

Query: 77  -DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            +  +P+ HFD YR++  +E+ E+G+ D    E +C++EW ++   L+P+  I I + +
Sbjct: 67  GEGRMPLYHFDVYRIAEPEEMDEIGYEDYFFGEGVCLVEWADLIEELMPENTIWIRIEK 125


>gi|309781414|ref|ZP_07676150.1| ATP/GTP hydrolase [Ralstonia sp. 5_7_47FAA]
 gi|308919827|gb|EFP65488.1| ATP/GTP hydrolase [Ralstonia sp. 5_7_47FAA]
          Length = 189

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 72/128 (56%), Gaps = 12/128 (9%)

Query: 15  NEKNTICLGRHLASILR-LGD---CLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           +E  T   G  LA  +R LG     + LSGDLG+GK+ L+R+I+R L H     V SPT+
Sbjct: 23  DEAATSAFGAALAQAVRALGARPVQVQLSGDLGAGKTTLSRAILRGLGHTG--RVRSPTY 80

Query: 71  TLVQLYD-----ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPK 124
           TLV+ YD      +  V HFD YR +  +E  + GF +   E  +C++EWPE  ++LL  
Sbjct: 81  TLVEPYDVAGTMGTQKVYHFDLYRFADPEEWTDAGFRDCFAEPALCLVEWPEKAQALLGT 140

Query: 125 KYIDIHLS 132
             + I LS
Sbjct: 141 PDLHIALS 148


>gi|51894062|ref|YP_076753.1| putative ATPase or kinase [Symbiobacterium thermophilum IAM 14863]
 gi|51857751|dbj|BAD41909.1| putative ATPase or kinase [Symbiobacterium thermophilum IAM 14863]
          Length = 157

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 68/119 (57%), Gaps = 4/119 (3%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
            T  LGR L   L+ GD + L GDLG+GK+ L+  I+  L    +    SPTFTL+  Y+
Sbjct: 11  QTQALGRWLGERLQPGDFVALVGDLGTGKTALSTGILAGLGVSRSGG--SPTFTLLWEYE 68

Query: 78  ASIPVAHFDFYRLSSHQEVVELGFDEIL--NERICIIEWPEIGRSLLPKKYIDIHLSQG 134
             IPV H+D YRL    E+ +LGF+E    +  + ++EW +  R L P + ++I LS G
Sbjct: 69  GRIPVFHWDVYRLEDAAELEDLGFEEYFFSDHGVNLVEWADRVRPLWPDEVLEISLSYG 127


>gi|268318064|ref|YP_003291783.1| hypothetical protein Rmar_2519 [Rhodothermus marinus DSM 4252]
 gi|262335598|gb|ACY49395.1| protein of unknown function UPF0079 [Rhodothermus marinus DSM 4252]
          Length = 159

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 69/121 (57%), Gaps = 3/121 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           + + T  LGR LA  LR GD + L GDLG+GK+ L + I   L   D +EV SPTFTLV 
Sbjct: 16  SPEATHALGRRLAEHLRPGDVVALYGDLGAGKTQLVKGIAAGLGIPD-VEVSSPTFTLVH 74

Query: 75  LYDAS-IPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y    +P+ HFD YRL + +E  +LG++E    + + ++EW +    LLP   + + L 
Sbjct: 75  EYRGGRLPLYHFDAYRLRNLEEFFDLGYEEYFYGDGVSVVEWADRIEPLLPPHTLRLRLE 134

Query: 133 Q 133
            
Sbjct: 135 H 135


>gi|292493406|ref|YP_003528845.1| hypothetical protein Nhal_3429 [Nitrosococcus halophilus Nc4]
 gi|291582001|gb|ADE16458.1| protein of unknown function UPF0079 [Nitrosococcus halophilus Nc4]
          Length = 157

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 77/138 (55%), Gaps = 6/138 (4%)

Query: 11  IPIPNEKNTICLGRHLA-SILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           I +  ++ T+ LG  LA +  + G  + L G LG GK+ LAR  ++ L H  A  V SPT
Sbjct: 4   ITLTGQEATLALGARLARTCEKEGAVIFLIGTLGVGKTTLARGFLQALGHRGA--VKSPT 61

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y      + HFD YRLS  QE+  +G  +  + + IC++EWPE G SLLP   +
Sbjct: 62  YTLVEPYTLGQRQLYHFDLYRLSDPQELEFMGIQDYFSPDAICLVEWPERGTSLLPLPDL 121

Query: 128 DIHLS-QGKTGRKATISA 144
            + L  QG   R A + A
Sbjct: 122 QVTLEYQGTHSRLARLEA 139


>gi|167580053|ref|ZP_02372927.1| hypothetical protein BthaT_18008 [Burkholderia thailandensis TXDOH]
          Length = 184

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 73/153 (47%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASILRL------------GDCLTLSGDLGSGKSFLARSIIRFL 57
            + + +E  TI  G  LA  L              G  + L GDLG+GK+ L R+++R L
Sbjct: 22  TLALADEAATIAFGERLAHALDAVRAERAAAHGFDGLQIQLYGDLGAGKTTLVRAMLRGL 81

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICI 111
            H  A  V SPT+TLV+ Y     D  + V HFD YR S   E  + GF E  N   ICI
Sbjct: 82  GH--AGRVKSPTYTLVEPYALARSDGELAVYHFDLYRFSDPAEWADAGFREYFNSGAICI 139

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +EWP+   +LL    +   L     GR+ T  A
Sbjct: 140 VEWPQRAGALLGVPDLVFSLDVDGEGRRLTARA 172


>gi|261409087|ref|YP_003245328.1| hypothetical protein GYMC10_5311 [Paenibacillus sp. Y412MC10]
 gi|261285550|gb|ACX67521.1| protein of unknown function UPF0079 [Paenibacillus sp. Y412MC10]
          Length = 156

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 75/131 (57%), Gaps = 5/131 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  L   LA+    G  + L GDLG+GK+  ++   R L  +    V SPTFT+++ Y
Sbjct: 7   EETEQLAAWLAARAEPGTVIGLDGDLGAGKTAFSQQFARHLGVNGV--VNSPTFTIIKEY 64

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL-SQG 134
           +  +P+ H D YRLS   E  ELG DE    + +C++EW  +   L+P++Y+ I L + G
Sbjct: 65  EGRLPLYHMDVYRLSV-DEADELGLDEYFYGDGVCLVEWSSLITELMPEQYLHIQLETTG 123

Query: 135 KTGRKATISAE 145
           +T R  T+S++
Sbjct: 124 ETNRIITLSSQ 134


>gi|153843191|ref|ZP_01993548.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|149745334|gb|EDM56585.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
          Length = 127

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 65/111 (58%), Gaps = 4/111 (3%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQ 94
           + L GDLG+GK+  +R  +R L H     V SPT+TLV+ Y      V HFD YRL+  +
Sbjct: 4   IYLHGDLGAGKTTFSRGFVRALGHQG--NVKSPTYTLVEPYQLDKWQVYHFDLYRLADPE 61

Query: 95  EVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           E+  +G  D   ++ IC++EWPE G+ LLP+  +D+ +      R A I+A
Sbjct: 62  ELEFMGIRDYFTDDAICLVEWPEKGQGLLPQPDLDVEIRYQGEQRVAEITA 112


>gi|187935564|ref|YP_001884738.1| hypothetical protein CLL_A0532 [Clostridium botulinum B str. Eklund
           17B]
 gi|187723717|gb|ACD24938.1| conserved hypothetical protein [Clostridium botulinum B str. Eklund
           17B]
          Length = 153

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 75/133 (56%), Gaps = 8/133 (6%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           K T  LG  +  +L  GD + L+GDLG+GK+ + + I   L   D  ++ SPTFT+V  Y
Sbjct: 9   KETTTLGIEIGKLLNSGDIICLTGDLGTGKTHITKGIALGLDIKD--DITSPTFTIVNEY 66

Query: 77  -DASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIH---- 130
            D  + + HFD YR++   E+  +GFD+ I ++ + IIEW      ++P +++ I+    
Sbjct: 67  DDGRLKLNHFDVYRVNDPDEIYAIGFDDYIFSDSVSIIEWANYIEDIIPDEFLHINIEKD 126

Query: 131 LSQGKTGRKATIS 143
           L +G   RK  ++
Sbjct: 127 LEKGDNYRKIILT 139


>gi|53718499|ref|YP_107485.1| putative hydrolase [Burkholderia pseudomallei K96243]
 gi|53725154|ref|YP_102183.1| hypothetical protein BMA0366 [Burkholderia mallei ATCC 23344]
 gi|67642856|ref|ZP_00441607.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|76811777|ref|YP_332477.1| hypothetical protein BURPS1710b_1065 [Burkholderia pseudomallei
           1710b]
 gi|121600092|ref|YP_992012.1| hypothetical protein BMASAVP1_A0666 [Burkholderia mallei SAVP1]
 gi|124384821|ref|YP_001028459.1| hypothetical protein BMA10229_A2501 [Burkholderia mallei NCTC
           10229]
 gi|126439327|ref|YP_001057959.1| hypothetical protein BURPS668_0908 [Burkholderia pseudomallei 668]
 gi|126450031|ref|YP_001079694.1| hypothetical protein BMA10247_0115 [Burkholderia mallei NCTC 10247]
 gi|126453763|ref|YP_001065192.1| hypothetical protein BURPS1106A_0911 [Burkholderia pseudomallei
           1106a]
 gi|134279567|ref|ZP_01766279.1| conserved hypothetical protein TIGR00150 [Burkholderia pseudomallei
           305]
 gi|167737432|ref|ZP_02410206.1| hypothetical protein Bpse14_05173 [Burkholderia pseudomallei 14]
 gi|167814551|ref|ZP_02446231.1| hypothetical protein Bpse9_05365 [Burkholderia pseudomallei 91]
 gi|167844584|ref|ZP_02470092.1| hypothetical protein BpseB_04786 [Burkholderia pseudomallei B7210]
 gi|167893116|ref|ZP_02480518.1| hypothetical protein Bpse7_05058 [Burkholderia pseudomallei 7894]
 gi|167901575|ref|ZP_02488780.1| hypothetical protein BpseN_04808 [Burkholderia pseudomallei NCTC
           13177]
 gi|167909815|ref|ZP_02496906.1| hypothetical protein Bpse112_04934 [Burkholderia pseudomallei 112]
 gi|167917841|ref|ZP_02504932.1| hypothetical protein BpseBC_04748 [Burkholderia pseudomallei
           BCC215]
 gi|217419894|ref|ZP_03451400.1| ATPase, YjeE family [Burkholderia pseudomallei 576]
 gi|226192834|ref|ZP_03788447.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|237811108|ref|YP_002895559.1| hypothetical protein GBP346_A0835 [Burkholderia pseudomallei
           MSHR346]
 gi|242315883|ref|ZP_04814899.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|254176729|ref|ZP_04883386.1| conserved hypothetical protein TIGR00150 [Burkholderia mallei ATCC
           10399]
 gi|254181550|ref|ZP_04888147.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|254187510|ref|ZP_04894022.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254196710|ref|ZP_04903134.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|254203863|ref|ZP_04910223.1| conserved hypothetical protein TIGR00150 [Burkholderia mallei FMH]
 gi|254208844|ref|ZP_04915192.1| conserved hypothetical protein TIGR00150 [Burkholderia mallei JHU]
 gi|254258669|ref|ZP_04949723.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|254296368|ref|ZP_04963825.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|254298191|ref|ZP_04965643.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|254360101|ref|ZP_04976371.1| conserved hypothetical protein TIGR00150 [Burkholderia mallei
           2002721280]
 gi|52208913|emb|CAH34852.1| putative hydrolase [Burkholderia pseudomallei K96243]
 gi|52428577|gb|AAU49170.1| conserved hypothetical protein TIGR00150 [Burkholderia mallei ATCC
           23344]
 gi|76581230|gb|ABA50705.1| conserved hypothetical protein TIGR00150 [Burkholderia pseudomallei
           1710b]
 gi|121228902|gb|ABM51420.1| conserved hypothetical protein TIGR00150 [Burkholderia mallei
           SAVP1]
 gi|124292841|gb|ABN02110.1| conserved hypothetical protein TIGR00150 [Burkholderia mallei NCTC
           10229]
 gi|126218820|gb|ABN82326.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|126227405|gb|ABN90945.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|126242901|gb|ABO05994.1| conserved hypothetical protein TIGR00150 [Burkholderia mallei NCTC
           10247]
 gi|134248767|gb|EBA48849.1| conserved hypothetical protein TIGR00150 [Burkholderia pseudomallei
           305]
 gi|147745375|gb|EDK52455.1| conserved hypothetical protein TIGR00150 [Burkholderia mallei FMH]
 gi|147750720|gb|EDK57789.1| conserved hypothetical protein TIGR00150 [Burkholderia mallei JHU]
 gi|148029341|gb|EDK87246.1| conserved hypothetical protein TIGR00150 [Burkholderia mallei
           2002721280]
 gi|157806034|gb|EDO83204.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|157808291|gb|EDO85461.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|157935190|gb|EDO90860.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|160697770|gb|EDP87740.1| conserved hypothetical protein TIGR00150 [Burkholderia mallei ATCC
           10399]
 gi|169653453|gb|EDS86146.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|184212088|gb|EDU09131.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|217397198|gb|EEC37214.1| ATPase, YjeE family [Burkholderia pseudomallei 576]
 gi|225935084|gb|EEH31058.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|237505566|gb|ACQ97884.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346]
 gi|238524063|gb|EEP87498.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|242139122|gb|EES25524.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|254217358|gb|EET06742.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 184

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 73/153 (47%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASILRL------------GDCLTLSGDLGSGKSFLARSIIRFL 57
            + + +E  TI LG  LA  L              G  + L GDLG+GK+ L R+++R L
Sbjct: 22  TLALADEAATIALGERLAHALDAMRGARAAAHAFDGLQIQLYGDLGAGKTTLVRAMLRGL 81

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICI 111
            H  A  V SPT+TLV+ Y     D  + V HFD YR S   E  + GF E  N   ICI
Sbjct: 82  GH--AGRVKSPTYTLVEPYALARSDGELEVYHFDLYRFSDPAEWADAGFREYFNSGAICI 139

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +EWP+   +LL    +   L     GR  T  A
Sbjct: 140 VEWPQRAGALLGVPDLVFSLDVAGEGRLLTARA 172


>gi|224823851|ref|ZP_03696960.1| protein of unknown function UPF0079 [Lutiella nitroferrum 2002]
 gi|224604306|gb|EEG10480.1| protein of unknown function UPF0079 [Lutiella nitroferrum 2002]
          Length = 163

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 79/135 (58%), Gaps = 4/135 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+ LG  LA  +  G  + L GDLG+GK+ L+R ++  L H     V SPT+TL
Sbjct: 13  LPDEDATLALGAALAHAIAPGTVIYLWGDLGAGKTTLSRGLLTALGHHG--RVKSPTYTL 70

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y  AS+ V HFD YR +  +E  + GF D    + +C++EWP+    LLP+  + + 
Sbjct: 71  VESYPLASLTVHHFDLYRFADPEEWEDAGFRDYFGPDTLCLVEWPDKAEGLLPRADLVVE 130

Query: 131 LSQGKTGRKATISAE 145
           L+   +GR   I+A+
Sbjct: 131 LAVAGSGRSYRITAQ 145


>gi|307718459|ref|YP_003873991.1| hypothetical protein STHERM_c07670 [Spirochaeta thermophila DSM
           6192]
 gi|306532184|gb|ADN01718.1| hypothetical protein STHERM_c07670 [Spirochaeta thermophila DSM
           6192]
          Length = 126

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 75/126 (59%), Gaps = 4/126 (3%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           +GR +AS +     + L   LG GK+ L R + R   +D    V SP++T+V +Y+  +P
Sbjct: 1   MGRRIASRITAPVVVALYAPLGGGKTTLMRGLARGWGYDGP--VTSPSYTIVTVYEGEVP 58

Query: 82  VAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS-QGKTGRK 139
           + H D YR++S ++++ LG ++IL  + I +IEW E  ++LLP++++ I +     + RK
Sbjct: 59  IYHIDAYRIASEEDLIYLGLEDILYGDGIAVIEWAEKVKTLLPERHVSITIEVVDASRRK 118

Query: 140 ATISAE 145
            T+  E
Sbjct: 119 ITVKEE 124


>gi|223042139|ref|ZP_03612310.1| hypothetical protein AM202_0724 [Actinobacillus minor 202]
 gi|223017078|gb|EEF15519.1| hypothetical protein AM202_0724 [Actinobacillus minor 202]
          Length = 151

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 77/141 (54%), Gaps = 12/141 (8%)

Query: 22  LGRHLASILR--------LGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV 73
            G+ LA+ ++        +G  + L GDLG+GK+ L RSI+R   +     V SPT+TLV
Sbjct: 4   FGQQLATAVKEVLINHPDIGVVIYLKGDLGAGKTTLTRSIVRSFGYQG--NVKSPTYTLV 61

Query: 74  QLYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHL 131
           + Y  S   + HFD YRL+  +E+  +G  +    R +C++EWP  G+ ++P+  + I L
Sbjct: 62  EEYQLSPFTLYHFDLYRLADPEELEFMGIKDYFRPRTLCLLEWPSKGQGMIPEADLVIEL 121

Query: 132 SQGKTGRKATISAERWIISHI 152
              + GR   +S++  I   I
Sbjct: 122 EYAELGRNLNLSSQSDIGQQI 142


>gi|237809132|ref|YP_002893572.1| hypothetical protein Tola_2389 [Tolumonas auensis DSM 9187]
 gi|237501393|gb|ACQ93986.1| protein of unknown function UPF0079 [Tolumonas auensis DSM 9187]
          Length = 155

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 77/139 (55%), Gaps = 5/139 (3%)

Query: 9   TVIPIPNEKN-TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           T+I   N+ + T+ LG  LA        + L GDLG+GK+ L+R  ++ L H    +V S
Sbjct: 4   TLIRTLNDSDATVALGAELAHACDQSTTIFLHGDLGAGKTTLSRGFVQALGHQG--KVKS 61

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+     V HFD YRL+  +E+  +G  D    + +C+IEWPE G   LP  
Sbjct: 62  PTYTLVEAYELPKWQVYHFDLYRLADPEELEFMGIRDYFAPDCLCLIEWPEKGVGWLPVP 121

Query: 126 YIDIHLSQGKTGRKATISA 144
            ++I L      R+A I++
Sbjct: 122 DLEITLHYEHGARRAEITS 140


>gi|89256616|ref|YP_513978.1| nucleotide-binding protein, yjeE [Francisella tularensis subsp.
           holarctica LVS]
 gi|89144447|emb|CAJ79746.1| Nucleotide-binding protein, yjeE [Francisella tularensis subsp.
           holarctica LVS]
          Length = 125

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 66/120 (55%), Gaps = 4/120 (3%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASI 80
           L +  A  L+ G  + L GDLG+GK+   + I+  L +     V SPT+TLV+ Y+    
Sbjct: 4   LAKEYAQQLKPGQIIYLYGDLGAGKTTFVKGILNALGYTG--NVKSPTYTLVESYEFDKF 61

Query: 81  PVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLSQGKTGRK 139
            + HFD YRL+  +E+  +G  +  N++ IC IEWPE G+  LP     +H+     GR+
Sbjct: 62  DIYHFDLYRLADPEELEWIGARDCFNQKDICFIEWPEKGKGFLPLNTTKVHIKYLAQGRQ 121


>gi|88798915|ref|ZP_01114497.1| hypothetical protein MED297_12692 [Reinekea sp. MED297]
 gi|88778395|gb|EAR09588.1| hypothetical protein MED297_12692 [Reinekea sp. MED297]
          Length = 173

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 78/149 (52%), Gaps = 4/149 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E+  +  G  L    R G  + L G LG GK+ L+R++I+ L   D   V SPT+TL +
Sbjct: 22  DEEQMMPFGGVLGHCCRGGSVIYLDGTLGMGKTTLSRALIQGLGWTD--RVKSPTYTLYE 79

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLS 132
            YD   + V HFD YRLS  +E+  LG  ++ ++R I +IEWPE G   LP   I + L+
Sbjct: 80  QYDLPDVQVCHFDLYRLSDPEELEFLGIRDLDSQRSIWLIEWPEKGDGYLPPADIRLTLA 139

Query: 133 QGKTGRKATISAERWIISHINQMNRSTSQ 161
            G      T+S +   +    Q+   + Q
Sbjct: 140 PGTEDDNRTLSLDGLTMRGQQQVQAVSEQ 168


>gi|293401342|ref|ZP_06645486.1| ATP/GTP hydrolase [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305468|gb|EFE46713.1| ATP/GTP hydrolase [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 148

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 68/117 (58%), Gaps = 5/117 (4%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
            T  LG  +  +L  G  LTLSGDLG+GK+ L +SI + L     +   SPTFT+++ Y 
Sbjct: 11  ETAQLGEKIGHLLHPGSLLTLSGDLGAGKTTLTKSIGKALGVKKVIN--SPTFTILKTYY 68

Query: 78  ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
             +P+ H D YRL    +  +LGF+EI  ++ +C++EWP      LPK+ + I + +
Sbjct: 69  GKMPLYHIDAYRLEGISQ--DLGFEEIFEDDGVCVVEWPHYIEEQLPKERLRIEIRR 123


>gi|225573324|ref|ZP_03782079.1| hypothetical protein RUMHYD_01515 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039313|gb|EEG49559.1| hypothetical protein RUMHYD_01515 [Blautia hydrogenotrophica DSM
           10507]
          Length = 144

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 73/134 (54%), Gaps = 8/134 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  LGR +    + G   TL GDLG GK+ L + +   L   + +   SPTFT++Q Y
Sbjct: 9   QETFELGRRIGQQAKKGQIYTLEGDLGVGKTVLTQGVAAGLKITEPIS--SPTFTILQEY 66

Query: 77  -DASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDI----H 130
            +  +P  HFD YR+   +E+ E+G+D+    + IC+IEW  + + +LP+  I I    +
Sbjct: 67  QEGRLPFYHFDVYRIGDVEEMEEIGYDDYFFGDGICLIEWANLIQEILPENVISIVIEKN 126

Query: 131 LSQGKTGRKATISA 144
           L +G   R+ T+  
Sbjct: 127 LEKGFDYRRITLEG 140


>gi|225377511|ref|ZP_03754732.1| hypothetical protein ROSEINA2194_03161 [Roseburia inulinivorans DSM
           16841]
 gi|225210649|gb|EEG93003.1| hypothetical protein ROSEINA2194_03161 [Roseburia inulinivorans DSM
           16841]
          Length = 145

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 75/140 (53%), Gaps = 8/140 (5%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           T+I   + + T  LG+ +    + GD  TL GDLG GK+   + I   L   +   + SP
Sbjct: 4   TMIETFSPEETHALGKKIGQQAKPGDVYTLIGDLGVGKTVFTQGIAEGLGIREP--ICSP 61

Query: 69  TFTLVQLY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKY 126
           TFT+VQ+Y +  +P  HFD YR+   +E+ E+G+ D      +C+IEW  +   +LP+K 
Sbjct: 62  TFTIVQVYEEGRMPFYHFDVYRIGDIEEMDEIGYEDYFYGNGLCMIEWANLIEEILPEKR 121

Query: 127 IDI----HLSQGKTGRKATI 142
            DI     L +G   RK TI
Sbjct: 122 HDISIEKDLEKGFDYRKITI 141


>gi|331006900|ref|ZP_08330147.1| ATPase YjeE [gamma proteobacterium IMCC1989]
 gi|330419289|gb|EGG93708.1| ATPase YjeE [gamma proteobacterium IMCC1989]
          Length = 162

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+  G  LA+ L  G  + L G LG+GK+ + R I++   H  A  V SPT+TL
Sbjct: 10  LADEAATVQAGEQLAAQLSAGMTVFLEGTLGAGKTTITRGILQGFGHSGA--VKSPTYTL 67

Query: 73  VQLYDASIP-VAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+   P + HFD YRL   +E+  +G  D    + +CI+EW E G  +LP+  + + 
Sbjct: 68  VEPYENVSPTIYHFDLYRLGDPEELEYMGIRDYFSAQSLCIVEWAERGVGVLPEPDVIVS 127

Query: 131 LS 132
           LS
Sbjct: 128 LS 129


>gi|323697774|ref|ZP_08109686.1| uncharacterized protein family UPF0079, ATPase [Desulfovibrio sp.
           ND132]
 gi|323457706|gb|EGB13571.1| uncharacterized protein family UPF0079, ATPase [Desulfovibrio
           desulfuricans ND132]
          Length = 161

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 74/137 (54%), Gaps = 6/137 (4%)

Query: 13  IPNEKNTICLGRHLASILRLGD---CLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +P+ + T+ LGR LASIL   D    L L GDLGSGK+ L R  +  L   ++ EV SP+
Sbjct: 7   LPDSEATVALGRALASILSRMDTPPALLLQGDLGSGKTTLVRGFVESLPGAESAEVSSPS 66

Query: 70  FTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPE-IGRSLLPKKYI 127
           F +  LY  +  VAHFD YRL   +    L FD   + + I I+EW + + + + P+  +
Sbjct: 67  FNICNLYPTTPGVAHFDLYRLEGMEPDDAL-FDAFEDPDTITIVEWIQYLPKEMWPEDAL 125

Query: 128 DIHLSQGKTGRKATISA 144
            +  +   TGR   + A
Sbjct: 126 FLEWTPSDTGRSLVLHA 142


>gi|308388658|gb|ADO30978.1| hypothetical protein NMBB_0503A [Neisseria meningitidis alpha710]
 gi|325202735|gb|ADY98189.1| conserved hypothetical protein TIGR00150 [Neisseria meningitidis
           M01-240149]
          Length = 153

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 70/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHLGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR S  +E  + G DE+     +C+IEWP+ G    P   I   
Sbjct: 69  VESYPLKPFTLHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITTT 128

Query: 131 LSQGKTGRKATISA 144
           L+    GRK  ++A
Sbjct: 129 LTHDGGGRKCLLTA 142


>gi|296132249|ref|YP_003639496.1| protein of unknown function UPF0079 [Thermincola sp. JR]
 gi|296030827|gb|ADG81595.1| protein of unknown function UPF0079 [Thermincola potens JR]
          Length = 156

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 67/125 (53%), Gaps = 3/125 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI   + + T  +   L+  +R GD + L GDLG+GK+  A+   R L  ++   V SPT
Sbjct: 2   VIFSKSPEETYKIAEALSRHVRPGDVICLQGDLGAGKTHFAQGFARGLGIEE--HVTSPT 59

Query: 70  FTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYID 128
           FTL+  Y   +P  H D YRL    E  ELG +E      + +IEWP   + LLP+ Y++
Sbjct: 60  FTLINEYTGRLPFYHIDAYRLEDPDEGYELGLEEYFYGSGVTLIEWPSKIKELLPEAYLE 119

Query: 129 IHLSQ 133
           I + +
Sbjct: 120 IAIEK 124


>gi|161870617|ref|YP_001599790.1| hypothetical protein NMCC_1686 [Neisseria meningitidis 053442]
 gi|161596170|gb|ABX73830.1| conserved hypothetical protein [Neisseria meningitidis 053442]
          Length = 153

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 70/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHQGA--VKSPTYAI 68

Query: 73  VQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR S  +E  + G DE+     +C+IEWP+ G    P   I   
Sbjct: 69  VESYLLERFTLHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITAT 128

Query: 131 LSQGKTGRKATISA 144
           L+    GRK  ++A
Sbjct: 129 LTHDGDGRKCLLTA 142


>gi|126732966|ref|ZP_01748727.1| hypothetical protein SSE37_17745 [Sagittula stellata E-37]
 gi|126706583|gb|EBA05659.1| hypothetical protein SSE37_17745 [Sagittula stellata E-37]
          Length = 487

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 47/116 (40%), Positives = 70/116 (60%), Gaps = 8/116 (6%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA-SIPVAHFDFYRLS 91
           GD + LSG +G+GK+  AR++++ L+ +   +V SPTFTLVQ Y+  S  + H D YRL+
Sbjct: 33  GDVVLLSGGIGAGKTHFARALVQSLL-ETPEDVPSPTFTLVQEYETRSGSLWHADLYRLT 91

Query: 92  SHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTG----RKATIS 143
             QE+VELG  +   + IC++EWP+  + L P     +HL+    G    R  TIS
Sbjct: 92  GPQEIVELGLVDAFEDAICLVEWPDRLQDLAPAS--ALHLTFQAIGDDDTRALTIS 145


>gi|83720658|ref|YP_441279.1| hypothetical protein BTH_I0723 [Burkholderia thailandensis E264]
 gi|167618120|ref|ZP_02386751.1| hypothetical protein BthaB_17566 [Burkholderia thailandensis Bt4]
 gi|257140054|ref|ZP_05588316.1| hypothetical protein BthaA_12760 [Burkholderia thailandensis E264]
 gi|83654483|gb|ABC38546.1| conserved hypothetical protein TIGR00150 [Burkholderia
           thailandensis E264]
          Length = 184

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 73/153 (47%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASILRL------------GDCLTLSGDLGSGKSFLARSIIRFL 57
            + + +E  TI  G  LA  L              G  + L GDLG+GK+ L R+++R L
Sbjct: 22  TLALADEAATIAFGGRLAHALDAVRAERAAAHAFDGLQIQLYGDLGAGKTTLVRAMLRGL 81

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICI 111
            H  A  V SPT+TLV+ Y     D  + V HFD YR S   E  + GF E  N   ICI
Sbjct: 82  GH--AGRVKSPTYTLVEPYALARSDGELAVYHFDLYRFSDPAEWADAGFREYFNSGAICI 139

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +EWP+   +LL    +   L     GR+ T  A
Sbjct: 140 VEWPQRAGALLGVPDLVFSLDVDGEGRRLTARA 172


>gi|319787570|ref|YP_004147045.1| hypothetical protein Psesu_1977 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466082|gb|ADV27814.1| Uncharacterized protein family UPF0079, ATPase [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 158

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 74/139 (53%), Gaps = 12/139 (8%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I +P  + T  LG  LA+       + L GDLG+GKS LAR+++R L       V SPT+
Sbjct: 3   IELPGPEATDELGHALAASRPPRAVVHLHGDLGAGKSSLARALLRALGVQG--PVRSPTY 60

Query: 71  TLVQLYDASIPVA-----HFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKK 125
           TLV+ Y    PVA     H D YR++   E+  LG D      + ++EWPE G   LPK 
Sbjct: 61  TLVERY----PVAGGEAWHLDLYRIADAGELDFLGLDGD-EATLWLVEWPERGLGALPKA 115

Query: 126 YIDIHLSQGKTGRKATISA 144
            + +HL+   TGR A + A
Sbjct: 116 DLAVHLAVAGTGRTARLEA 134


>gi|302334973|ref|YP_003800180.1| protein of unknown function UPF0079 [Olsenella uli DSM 7084]
 gi|301318813|gb|ADK67300.1| protein of unknown function UPF0079 [Olsenella uli DSM 7084]
          Length = 172

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 73/122 (59%), Gaps = 4/122 (3%)

Query: 14  PNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV 73
           P+  +TI LG  L   L  GD L L+GDLG+GK+ L + I R L   D  +V SPTFT+ 
Sbjct: 16  PDTASTIELGCELGRCLGPGDVLVLTGDLGAGKTQLTKGIARGLGVTD--DVTSPTFTIE 73

Query: 74  QLYDA-SIPVAHFDFYRLSSHQEVVELG-FDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
            +Y+  S+P+ HFD YRL+   ++ + G FD +  +  C+IEW E     + ++ +D+ +
Sbjct: 74  MVYEGSSMPLYHFDLYRLNDAAQLEDTGLFDVLGADGPCVIEWGEQFSDDIGEERLDVFV 133

Query: 132 SQ 133
           ++
Sbjct: 134 TR 135


>gi|304311525|ref|YP_003811123.1| Protein of unknown function UPF0079 [gamma proteobacterium HdN1]
 gi|301797258|emb|CBL45478.1| Protein of unknown function UPF0079 [gamma proteobacterium HdN1]
          Length = 173

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 67/112 (59%), Gaps = 6/112 (5%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASI 80
           LGR LA  L+      L G LG+GK+ L+R I+R L HD +++  SPT+T+V+ Y    +
Sbjct: 23  LGRWLAVSLQAPLVAFLDGALGAGKTTLSRGILRGLGHDGSVK--SPTYTVVEPYSVGDV 80

Query: 81  PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHL 131
            V HFD YR+S   E+  +G  D      IC++EWP+ G  +LPK   DIHL
Sbjct: 81  TVYHFDLYRISDPDELELMGIRDYFTATSICLLEWPQNGMGVLPKP--DIHL 130


>gi|319760222|ref|YP_004124160.1| putative nucleotide-binding protein [Candidatus Blochmannia vafer
           str. BVAF]
 gi|318038936|gb|ADV33486.1| putative nucleotide-binding protein [Candidatus Blochmannia vafer
           str. BVAF]
          Length = 165

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 76/137 (55%), Gaps = 6/137 (4%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ + NE  T+ LG +LA +  LG    L G++GSGK+ L R  ++ L +   ++  SPT
Sbjct: 5   VLILYNESQTLLLGANLAKVCVLGCIFYLHGNIGSGKTTLCRGFLKALGYTKYVK--SPT 62

Query: 70  FTLVQLYDASIP-VAHFDFYRLSSHQEVVELG-FDEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  S   + H D YRL S  E++ +G +D   N+ I +IEWP++    LP   I
Sbjct: 63  YTLVEFYSLSNKHIYHIDLYRLHSKDELINMGIYDCFDNKSILLIEWPKLEVDCLPNPDI 122

Query: 128 DIHLSQGK--TGRKATI 142
            I +   K  T R+  I
Sbjct: 123 SISIDYYKHETYRQVVI 139


>gi|258645525|ref|ZP_05732994.1| ATPase [Dialister invisus DSM 15470]
 gi|260402879|gb|EEW96426.1| ATPase [Dialister invisus DSM 15470]
          Length = 157

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 71/119 (59%), Gaps = 2/119 (1%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E+ T+  G  + +       + L+GDLG+GK+   + + + +  +DA  V SPTF ++ 
Sbjct: 10  SEEETMAFGEWIGAHAVNDLFIALNGDLGTGKTHFVQGLAKGMGINDA--VGSPTFMIMN 67

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ HFDFYRL   +++  +G++E  +  + ++EW ++  +LLP + I +H+ +
Sbjct: 68  YYEGVLPLKHFDFYRLGDEEDLYNIGWEEYSSGGVTVVEWADVFPALLPPESITVHIER 126


>gi|170717825|ref|YP_001784886.1| hypothetical protein HSM_1566 [Haemophilus somnus 2336]
 gi|168825954|gb|ACA31325.1| protein of unknown function UPF0079 [Haemophilus somnus 2336]
          Length = 156

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 75/127 (59%), Gaps = 9/127 (7%)

Query: 13  IPNEKNTICLGRHLA-SILRL----GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E      G+ L  SI ++    G  L L GDLG+GK+ L+R +I+ + H     V S
Sbjct: 7   IPDEYTMCQFGKKLIHSIAQIKSNKGITLYLQGDLGAGKTTLSRGMIQGIGHTG--HVKS 64

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y      + HFD YRLS  +E+  +G  +  NER IC+IEW E G+ +LP+ 
Sbjct: 65  PTYTLVEEYHLDEKDIYHFDLYRLSDPEELEFMGIRDYFNERSICLIEWAEKGQGILPEP 124

Query: 126 YIDIHLS 132
            + +H++
Sbjct: 125 DLIVHIN 131


>gi|113461224|ref|YP_719293.1| ATPase [Haemophilus somnus 129PT]
 gi|112823267|gb|ABI25356.1| conserved hypothetical protein [Haemophilus somnus 129PT]
          Length = 156

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 75/127 (59%), Gaps = 9/127 (7%)

Query: 13  IPNEKNTICLGRHLA-SILRL----GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E      G+ L  SI ++    G  L L GDLG+GK+ L+R +I+ + H     V S
Sbjct: 7   IPDEYTMCQFGKLLIHSIAQIKSNKGITLYLQGDLGAGKTTLSRGMIQGIGHTG--NVKS 64

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y      + HFD YRLS  +E+  +G  +  NER IC+IEW E G+ +LP+ 
Sbjct: 65  PTYTLVEEYHLGEKDIYHFDLYRLSDPEELEFMGIRDYFNERSICLIEWAEKGQGILPEP 124

Query: 126 YIDIHLS 132
            + +H++
Sbjct: 125 DLIVHIN 131


>gi|171463892|ref|YP_001798005.1| protein of unknown function UPF0079 [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171193430|gb|ACB44391.1| protein of unknown function UPF0079 [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 178

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 73/134 (54%), Gaps = 16/134 (11%)

Query: 15  NEKNTICLGRHLAS-----ILRLGDC---LTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
            E +T  L + LA+     + +  D    ++L GDLG+GK+  AR +I+ L H+   +V 
Sbjct: 20  QEADTAALAKRLAASFAQYLSKQPDSHLNISLEGDLGAGKTTFARYLIQALGHEG--KVK 77

Query: 67  SPTFTL-----VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRS 120
           SPT+TL     +QL D +I V HFD YR+    E  E GF E  +   ICIIEWP+    
Sbjct: 78  SPTYTLCESYPLQLKDQAITVHHFDLYRMRDPLEWQEAGFAEHFDVPGICIIEWPKKAEG 137

Query: 121 LLPKKYIDIHLSQG 134
            LP+  I I L+ G
Sbjct: 138 TLPRFDIQIQLAAG 151


>gi|315222152|ref|ZP_07864061.1| conserved hypothetical protein TIGR00150 [Streptococcus anginosus
           F0211]
 gi|315188778|gb|EFU22484.1| conserved hypothetical protein TIGR00150 [Streptococcus anginosus
           F0211]
          Length = 146

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 71/131 (54%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE   +  G  L ++LR  D L L+GDLG+GK+   + + R L     ++  SPT+T+V+
Sbjct: 5   NEDELMAWGEKLGALLRKQDVLILTGDLGAGKTTFTKGLARGLGIKQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            YD  +P+ H D YR+    + ++L  D +  + + +IEW E+    LP  Y+ + + + 
Sbjct: 63  EYDGRLPLYHLDVYRIGEDPDSIDLD-DFLFGDGVTVIEWGELLGDSLPSDYLKLTILRK 121

Query: 135 KTGRKATISAE 145
             GR+    A+
Sbjct: 122 SDGRELVFDAK 132


>gi|322391052|ref|ZP_08064556.1| ATP/GTP hydrolase [Streptococcus parasanguinis ATCC 903]
 gi|321142282|gb|EFX37756.1| ATP/GTP hydrolase [Streptococcus parasanguinis ATCC 903]
          Length = 151

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 71/130 (54%), Gaps = 3/130 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE   I LG+ L  +L   D + LSGDLG+GK+   + I + L  D  ++  SPT+T+V+
Sbjct: 5   NETELIALGKQLGKLLEKQDVIILSGDLGAGKTTFTKGIAKGLGIDQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+ +  + ++L  D +  +   IIEW E+    L   Y+ I + + 
Sbjct: 63  EYEGRLPLYHLDVYRIGNDPDSIDLD-DFLFGDGATIIEWGELIEPSLSDAYLKIFIRKL 121

Query: 135 KTGRKATISA 144
           + GR+    A
Sbjct: 122 EDGRELAFEA 131


>gi|313896357|ref|ZP_07829910.1| hydrolase, P-loop family [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|320530768|ref|ZP_08031812.1| conserved hypothetical protein TIGR00150 [Selenomonas artemidis
           F0399]
 gi|312975156|gb|EFR40618.1| hydrolase, P-loop family [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|320137055|gb|EFW28993.1| conserved hypothetical protein TIGR00150 [Selenomonas artemidis
           F0399]
          Length = 158

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 71/131 (54%), Gaps = 5/131 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  L   +  I+R G  + L G+LG GK+   R++ R L  +   +V SPTF L+ +Y
Sbjct: 10  EETAHLAGTIGKIIREGTVICLDGELGVGKTLFVRALARTLGVES--DVTSPTFNLMNIY 67

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEI--LNERICIIEWPEIGRSLLPKKYIDIHLSQ- 133
           +A+ P+ HFD YRL++ +E+ ++GF E     E I +IEW E     +P   + + +   
Sbjct: 68  EAACPIVHFDLYRLNTEEELEDIGFYEYAEAQEGIVLIEWAEKFPDAMPADRLTVRIDAV 127

Query: 134 GKTGRKATISA 144
              GR+ T  A
Sbjct: 128 SAEGRQFTFDA 138


>gi|330831018|ref|YP_004393970.1| putative ATPase or kinase [Aeromonas veronii B565]
 gi|328806154|gb|AEB51353.1| Predicted ATPase or kinase [Aeromonas veronii B565]
          Length = 157

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 78/152 (51%), Gaps = 4/152 (2%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           ++ +P+E  T+ LG  LA   +    + L G LG+GK+ L R  ++ L H    +V SPT
Sbjct: 6   MMTLPDEAATVALGGRLAQACQQATTVFLHGTLGAGKTTLTRGWVQGLGHQG--KVKSPT 63

Query: 70  FTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y+     V HFD YRL+  +E+  +G  D      +C++EW E G   LP   +
Sbjct: 64  YTLVEPYELDGWQVYHFDLYRLADPEELEFMGIRDYFAANTLCLVEWSEKGEGWLPAPDL 123

Query: 128 DIHLSQGKTGRKATISAERWIISHINQMNRST 159
           +I L+     R+  I A   I   I +   ST
Sbjct: 124 EITLTYVGEQREVLIEARTAIGEAILERLSST 155


>gi|293115527|ref|ZP_05791934.2| nucleotide-binding protein, YjeE [Butyrivibrio crossotus DSM 2876]
 gi|292809442|gb|EFF68647.1| nucleotide-binding protein, YjeE [Butyrivibrio crossotus DSM 2876]
          Length = 145

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 71/133 (53%), Gaps = 8/133 (6%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ-LYD 77
           T    + +   L+ GD L L GDLG GK+   + +   L   D  +V SPTFTL+Q  Y 
Sbjct: 14  TFEFAKKIGQNLKRGDVLCLDGDLGVGKTVFTKGVAAGLGIKD--DVSSPTFTLIQEYYG 71

Query: 78  ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIH----LS 132
             +P+ HFD YR+    ++ +LG++E    E +C++EW  + + L P+  I +     L 
Sbjct: 72  GRLPLYHFDVYRIDGPWDMDDLGYEEYFYGEGVCLVEWGSMIKELFPENTIYVRIEKDLE 131

Query: 133 QGKTGRKATISAE 145
           +G   RK T+S +
Sbjct: 132 KGFDYRKITVSKD 144


>gi|253579745|ref|ZP_04857013.1| uncharacterized P-loop hydrolase UPF0079 [Ruminococcus sp.
           5_1_39B_FAA]
 gi|251848744|gb|EES76706.1| uncharacterized P-loop hydrolase UPF0079 [Ruminococcus sp.
           5_1_39BFAA]
          Length = 144

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 72/126 (57%), Gaps = 4/126 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I     + T  +G+ +    + G   TL+GDLG GK+   + +   L   +   + SPT
Sbjct: 2   IIETKTPQETFEVGKKIGENAKPGQIYTLTGDLGVGKTVFTQGVAAGLGITEP--ICSPT 59

Query: 70  FTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYI 127
           FT++Q Y++  +P+ HFD YR+   +E+ E+G+D+    + IC+IEW ++   +LP+K I
Sbjct: 60  FTIIQEYESGRLPLYHFDVYRIGDIEEMEEIGYDDYFFGQGICLIEWADLIEEILPEKLI 119

Query: 128 DIHLSQ 133
            + + +
Sbjct: 120 KVTIEK 125


>gi|116621276|ref|YP_823432.1| hypothetical protein Acid_2157 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116224438|gb|ABJ83147.1| protein of unknown function UPF0079 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 138

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 67/118 (56%), Gaps = 3/118 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E+ TI LG  LAS L     + L G+LG+GK+ LA+ I       +  +V SPTFTL+ 
Sbjct: 8   SEQETIALGEQLASTLPRKGVVLLIGNLGAGKTTLAKGIAHGRGAAETDDVSSPTFTLIH 67

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHL 131
            Y A   V H D YRL   ++V  LG DE+ + E + +IEW E   +++P    +I+L
Sbjct: 68  EYGAG--VYHIDLYRLDEPRQVATLGLDELFDREALVLIEWGERFPAMMPAHRTEIYL 123


>gi|77918611|ref|YP_356426.1| hypothetical protein Pcar_1005 [Pelobacter carbinolicus DSM 2380]
 gi|77544694|gb|ABA88256.1| conserved hypothetical protein TIGR00150 [Pelobacter carbinolicus
           DSM 2380]
          Length = 160

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 68/111 (61%), Gaps = 2/111 (1%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           LGR L  +++    L LSGDLG+GK+ L + I R L   ++  ++SPT+TL+ LY+  +P
Sbjct: 17  LGRCLGQVIKDPVVLLLSGDLGAGKTCLTQGIARGLDIPESEPIVSPTYTLMNLYEGRLP 76

Query: 82  VAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL 131
           + HFD YRL+   E+ +LG +E L  + + ++EW +    L P  Y+ I +
Sbjct: 77  LYHFDLYRLADPSELEDLGLEEYLPGDGVAVVEWADRFDDLCP-TYLAIRI 126


>gi|295702440|ref|YP_003595515.1| hypothetical protein BMD_0250 [Bacillus megaterium DSM 319]
 gi|294800099|gb|ADF37165.1| conserved hypothetical protein [Bacillus megaterium DSM 319]
          Length = 156

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 76/134 (56%), Gaps = 9/134 (6%)

Query: 14  PNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV 73
           P+E N   L   LA++L  GD L L GDLG+GK+   +S+ + L  +    V SPTFT++
Sbjct: 14  PDETNQ--LAARLATLLEAGDVLLLEGDLGAGKTTFTKSLAKGLGIER--NVNSPTFTII 69

Query: 74  QLYDAS-IPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL 131
           + Y +  +P+ H D YRL    E  +LGFDE    + + ++EW  +    LP +YI I++
Sbjct: 70  KEYKSGRLPLYHMDVYRLGD--EFEDLGFDEYFEGDGVTVVEWAHLIEEQLPNEYIQINI 127

Query: 132 S-QGKTGRKATISA 144
             + +T RK  + A
Sbjct: 128 YHENETTRKILVKA 141


>gi|294497075|ref|YP_003560775.1| hypothetical protein BMQ_0256 [Bacillus megaterium QM B1551]
 gi|294347012|gb|ADE67341.1| conserved hypothetical protein [Bacillus megaterium QM B1551]
          Length = 156

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 76/134 (56%), Gaps = 9/134 (6%)

Query: 14  PNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV 73
           P+E N   L   LA++L  GD L L GDLG+GK+   +S+ + L  +    V SPTFT++
Sbjct: 14  PDETNQ--LAARLATLLEAGDVLLLEGDLGAGKTTFTKSLAKGLGIER--NVNSPTFTII 69

Query: 74  QLYDAS-IPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL 131
           + Y +  +P+ H D YRL    E  +LGFDE    + + ++EW  +    LP +YI I++
Sbjct: 70  KEYKSGRLPLYHMDVYRLGD--EFEDLGFDEYFEGDGVTVVEWAHLIEEQLPNEYIQINI 127

Query: 132 S-QGKTGRKATISA 144
             + +T RK  + A
Sbjct: 128 YHENETTRKILVKA 141


>gi|210615508|ref|ZP_03290635.1| hypothetical protein CLONEX_02851 [Clostridium nexile DSM 1787]
 gi|210150357|gb|EEA81366.1| hypothetical protein CLONEX_02851 [Clostridium nexile DSM 1787]
          Length = 143

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 73/140 (52%), Gaps = 8/140 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I   + + T  LG  +    + G   T+ GDLG GK+   + +   L   + +   SPT
Sbjct: 2   IIETRSAQETYELGLKIGKEAKKGQVYTMVGDLGVGKTVFTQGMAHGLGIKEPIS--SPT 59

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           FT+VQ+YD   +P  HFD YR+    E+ E+G+ D I  E + +IEW  +   +LPK+ I
Sbjct: 60  FTIVQVYDDGRMPFYHFDVYRIGDITEMDEIGYEDYIYGEGVSLIEWANLIEEILPKERI 119

Query: 128 DIH----LSQGKTGRKATIS 143
           +I     L QG   RK TI 
Sbjct: 120 EIQIEKDLEQGFDYRKITIE 139


>gi|327462392|gb|EGF08717.1| ATP/GTP hydrolase [Streptococcus sanguinis SK1057]
          Length = 146

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 74/131 (56%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L  +L+ GD L L+G+LG+GK+   + +   L     ++  SPT+T+V+
Sbjct: 5   NEEELIQQGQRLGKLLQAGDVLVLTGNLGAGKTTFTKGLALGLGISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + +IEW E+    LP+ Y+ + L + 
Sbjct: 63  EYEGRLPLYHLDVYRIGGDPDSIDLD-DFLFGEGVTVIEWGELLGENLPEDYLKLSLLKK 121

Query: 135 KTGRKATISAE 145
           + GR+    A+
Sbjct: 122 EDGRELVFEAK 132


>gi|296877079|ref|ZP_06901120.1| ATP/GTP hydrolase [Streptococcus parasanguinis ATCC 15912]
 gi|296431940|gb|EFH17746.1| ATP/GTP hydrolase [Streptococcus parasanguinis ATCC 15912]
          Length = 151

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 71/130 (54%), Gaps = 3/130 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE   I LG+ L  +L   D + LSGDLG+GK+   + I + L  D  ++  SPT+T+V+
Sbjct: 5   NEMELIALGKQLGKLLEKQDVIILSGDLGAGKTTFTKGIAKGLGIDQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+ +  + ++L  D +  +   IIEW E+    L   Y+ I + + 
Sbjct: 63  EYEGRLPLYHLDVYRIGNDPDSIDLD-DFLFGDGATIIEWGELIEPSLSDAYLKIFIRKL 121

Query: 135 KTGRKATISA 144
           + GR+    A
Sbjct: 122 EEGRELAFEA 131


>gi|225571644|ref|ZP_03780640.1| hypothetical protein CLOHYLEM_07742 [Clostridium hylemonae DSM
           15053]
 gi|225159721|gb|EEG72340.1| hypothetical protein CLOHYLEM_07742 [Clostridium hylemonae DSM
           15053]
          Length = 141

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 70/121 (57%), Gaps = 4/121 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +EK+T  LGR +      G   TL GDLG+GK+   + +   L   +   V SPTFT+VQ
Sbjct: 7   SEKDTYELGRSMGEKACPGKVFTLIGDLGTGKTVFTKGLAAGLGIKEP--VSSPTFTIVQ 64

Query: 75  LY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           +Y +  +P  HFD YR+   +E+ E+G+ D +  + + +IEW ++   +LP+ Y +I + 
Sbjct: 65  VYEEGRLPFYHFDVYRIGCVEEMDEIGYEDYVYGDGVTLIEWADLIEEILPEHYTEIKIE 124

Query: 133 Q 133
           +
Sbjct: 125 K 125


>gi|262275159|ref|ZP_06052970.1| ATPase YjeE [Grimontia hollisae CIP 101886]
 gi|262221722|gb|EEY73036.1| ATPase YjeE [Grimontia hollisae CIP 101886]
          Length = 155

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 65/109 (59%), Gaps = 4/109 (3%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEV 96
           L GDLG+GK+  +R  I+ L H     V SPT+TLV+ Y   S  V HFD YRL+  +E+
Sbjct: 34  LHGDLGAGKTTFSRGFIQSLGHRG--NVKSPTYTLVEPYQLESWQVYHFDLYRLADPEEL 91

Query: 97  VELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
             +G  D    + +C++EWPE G+ LLP+  ++I L+  +  R   ++A
Sbjct: 92  EFMGIRDYFTPDALCLVEWPEKGKGLLPQPDLNITLTYNEKQRSVQVNA 140


>gi|163855136|ref|YP_001629434.1| hypothetical protein Bpet0831 [Bordetella petrii DSM 12804]
 gi|163258864|emb|CAP41163.1| conserved hypothetical protein [Bordetella petrii]
          Length = 223

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 77/140 (55%), Gaps = 10/140 (7%)

Query: 13  IPNEKNTICLGRHLASILR------LGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
           +P+E  T  L R  A +L        G  + L G+LG+GK+  AR+++R         + 
Sbjct: 57  LPDETATEALARQFAPLLTGARGVPAGGRIHLQGELGAGKTAFARALLRECGITG--RIK 114

Query: 67  SPTFTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPK 124
           SP++ L++ Y  S +   HFDFYR S  +E ++ GF ++L ++ + +IEWPE    +LP 
Sbjct: 115 SPSYALLESYKVSNLYFYHFDFYRFSDSREWLDAGFRDLLRDDAVVLIEWPERAEGVLPP 174

Query: 125 KYIDIHLSQGKTGRKATISA 144
             + I L+    GR+ T++A
Sbjct: 175 PDMQISLAYAGPGREVTLTA 194


>gi|313898140|ref|ZP_07831679.1| hydrolase, P-loop family [Clostridium sp. HGF2]
 gi|312957168|gb|EFR38797.1| hydrolase, P-loop family [Clostridium sp. HGF2]
          Length = 150

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 80/133 (60%), Gaps = 8/133 (6%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           IP+ + + T  LG  LAS+++ G  +TLSGDLG+GK+   + + + L     +   SPTF
Sbjct: 4   IPVCSLEETGELGLKLASLIKPGMLITLSGDLGAGKTTFTKYLGKGLGVKKTIN--SPTF 61

Query: 71  TLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKK--Y 126
           T++++Y   S+PV H D YRL    +  +LGF+E   ++ +C+IEWP    S LP +  +
Sbjct: 62  TILKIYQGTSMPVYHIDAYRLEGITQ--DLGFEEYFEDDGVCVIEWPHFIESQLPGERLH 119

Query: 127 IDIHLSQGKTGRK 139
           IDI   +G+  ++
Sbjct: 120 IDITRVEGEDEKR 132


>gi|119474827|ref|ZP_01615180.1| hypothetical protein GP2143_13446 [marine gamma proteobacterium
           HTCC2143]
 gi|119451030|gb|EAW32263.1| hypothetical protein GP2143_13446 [marine gamma proteobacterium
           HTCC2143]
          Length = 154

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 64/105 (60%), Gaps = 7/105 (6%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY--DASIPVAHFDFYRLSSHQE 95
           L+GDLG GK+ L R I+R   H   ++  SPT+TLV+ Y  D+SI V HFD YRL   +E
Sbjct: 34  LNGDLGMGKTTLCRGILRAFGHKGPVK--SPTYTLVEPYNFDSSI-VYHFDLYRLGDPEE 90

Query: 96  VVELGFDEILNE--RICIIEWPEIGRSLLPKKYIDIHLSQGKTGR 138
           +  +G  +  +E   +C++EWPE G   LPK  I I+++    GR
Sbjct: 91  LEYMGIRDYFDEDNTLCLLEWPEKGGQFLPKADIAINITLTPGGR 135


>gi|226322511|ref|ZP_03798029.1| hypothetical protein COPCOM_00282 [Coprococcus comes ATCC 27758]
 gi|225209128|gb|EEG91482.1| hypothetical protein COPCOM_00282 [Coprococcus comes ATCC 27758]
          Length = 137

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 71/126 (56%), Gaps = 4/126 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I   + K T  LG+ + S  + G+  TL GDLG GK+   + + + L  ++ +   SPT
Sbjct: 2   IIETRSAKETYDLGKKIGSHAKAGEVYTLVGDLGVGKTVFTQGLAKGLGIEEPIS--SPT 59

Query: 70  FTLVQLY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           FT+VQ+Y D  +P  HFD YR+   +E+ E+GF D +  + + +IEW  +   +LP    
Sbjct: 60  FTIVQVYDDGRLPFYHFDVYRIGDIEEMDEIGFEDYVYGDGVSLIEWANLIDEILPANRT 119

Query: 128 DIHLSQ 133
           +I + +
Sbjct: 120 EITIEK 125


>gi|322386061|ref|ZP_08059700.1| ATP/GTP hydrolase [Streptococcus cristatus ATCC 51100]
 gi|321269905|gb|EFX52826.1| ATP/GTP hydrolase [Streptococcus cristatus ATCC 51100]
          Length = 146

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 74/131 (56%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L S+L+  D L L+GDLG+GK+   + + + L     ++  SPT+T+V+
Sbjct: 5   NEEELINWGQRLGSLLQEQDVLVLTGDLGAGKTTFTKGLAQGLGIKQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + +IEW E+    LP  Y+ + L + 
Sbjct: 63  EYEGRLPLYHLDVYRIGEDPDSIDLD-DFLFGEGVTVIEWGELLGDSLPDDYLKLTLLKK 121

Query: 135 KTGRKATISAE 145
           + GR+    ++
Sbjct: 122 EDGRELVFESQ 132


>gi|319744381|gb|EFV96741.1| ATP/GTP hydrolase [Streptococcus agalactiae ATCC 13813]
          Length = 169

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 81/138 (58%), Gaps = 3/138 (2%)

Query: 7   HLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
           ++++    NE+  I LG+ L ++L+ GD + L+G+LG+GK+ L + I + L  D    + 
Sbjct: 20  NISMFYTQNEEELIALGQKLGTVLKSGDIVLLTGNLGAGKTTLTKGIAKGL--DIKQMIK 77

Query: 67  SPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKY 126
           SPT+T+V+ Y+  +P+ H D YR+    + ++L  D +  + + +IEW E+    L   Y
Sbjct: 78  SPTYTIVREYEGRVPLYHLDVYRIGDDLDSIDL-DDFLFGQGVTVIEWGELLSDNLINNY 136

Query: 127 IDIHLSQGKTGRKATISA 144
           ++I +++   GR+  + A
Sbjct: 137 LEIVITRSNQGRQVQLEA 154


>gi|297616748|ref|YP_003701907.1| hypothetical protein Slip_0558 [Syntrophothermus lipocalidus DSM
           12680]
 gi|297144585|gb|ADI01342.1| protein of unknown function UPF0079 [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 169

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 72/119 (60%), Gaps = 10/119 (8%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + + ++ + LG+ +A  L  GD + L G+LG+GK+ LA+ I+R L +  A  V SPTF L
Sbjct: 3   VRDTESMLQLGKLIAKRLVPGDTVYLMGELGAGKTTLAQGIVRGLGY--AGRVTSPTFAL 60

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPE------IGRSLLPK 124
           + +Y   IPV H DFYRL   ++  ++G ++ L  E I +IEWPE       GR+LL K
Sbjct: 61  INVYQGRIPVYHCDFYRL-EEKDFYDIGIEDYLEKEGIVLIEWPERLSRELPGRALLIK 118


>gi|238926145|ref|ZP_04657905.1| ATP-binding protein [Selenomonas flueggei ATCC 43531]
 gi|304437004|ref|ZP_07396967.1| ATPase with strong ADP affinity [Selenomonas sp. oral taxon 149
           str. 67H29BP]
 gi|238886035|gb|EEQ49673.1| ATP-binding protein [Selenomonas flueggei ATCC 43531]
 gi|304369955|gb|EFM23617.1| ATPase with strong ADP affinity [Selenomonas sp. oral taxon 149
           str. 67H29BP]
          Length = 158

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 68/117 (58%), Gaps = 4/117 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  L   +  I+R G  + L G+LG GK+   R++ R L  +   +V SPTF L+ +Y
Sbjct: 10  EETAHLAGTIGKIIREGTVICLDGELGVGKTLFVRALARTLGVES--DVTSPTFNLMNIY 67

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEI--LNERICIIEWPEIGRSLLPKKYIDIHL 131
           +A+ P+ HFD YR++S +E+ ++GF E     E I +IEW E   + +P  ++ + +
Sbjct: 68  EAACPIVHFDLYRIASEEELEDIGFFEYAEATEGIVLIEWAEKFPNAIPADHLSVRI 124


>gi|325577876|ref|ZP_08148109.1| ATPase with strong ADP affinity [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160306|gb|EGC72433.1| ATPase with strong ADP affinity [Haemophilus parainfluenzae ATCC
           33392]
          Length = 156

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 81/147 (55%), Gaps = 9/147 (6%)

Query: 13  IPNEKNTICLGRHLASIL--RLGD---CLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E   +  G+ LA +L  +  D    L  +GDLG+GK+ L R +++ L +     V S
Sbjct: 8   IPDEGTMLRFGKKLAEVLVKQPKDNAIVLYFNGDLGAGKTTLTRGMVQGLGYQG--NVKS 65

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y  A   + HFD YRL+  +E+  +G  +  ++  IC+IEW E G  +LP+ 
Sbjct: 66  PTYTLVEEYSIAGKMIYHFDLYRLADPEELEFMGIRDYFSQNCICLIEWAEKGEGILPEA 125

Query: 126 YIDIHLSQGKTGRKATISAERWIISHI 152
            + +++      R  T+ A+  +  HI
Sbjct: 126 DLLVNIDYYDDARNITLIAQNSVGEHI 152


>gi|22536549|ref|NP_687400.1| hypothetical protein SAG0366 [Streptococcus agalactiae 2603V/R]
 gi|76787736|ref|YP_329087.1| hypothetical protein SAK_0440 [Streptococcus agalactiae A909]
 gi|76798056|ref|ZP_00780313.1| ATP/GTP hydrolase [Streptococcus agalactiae 18RS21]
 gi|77406369|ref|ZP_00783431.1| Uncharacterised P-loop hydrolase UPF0079, putative [Streptococcus
           agalactiae H36B]
 gi|77409545|ref|ZP_00786229.1| Uncharacterised P-loop hydrolase UPF0079, putative [Streptococcus
           agalactiae COH1]
 gi|77411649|ref|ZP_00787989.1| Uncharacterised P-loop hydrolase UPF0079, putative [Streptococcus
           agalactiae CJB111]
 gi|77414446|ref|ZP_00790597.1| putative Uncharacterised P-loop hydrolase UPF0079 [Streptococcus
           agalactiae 515]
 gi|22533383|gb|AAM99272.1|AE014208_12 conserved hypothetical protein TIGR00150 [Streptococcus agalactiae
           2603V/R]
 gi|76562793|gb|ABA45377.1| conserved hypothetical protein TIGR00150 [Streptococcus agalactiae
           A909]
 gi|76586615|gb|EAO63116.1| ATP/GTP hydrolase [Streptococcus agalactiae 18RS21]
 gi|77159491|gb|EAO70651.1| putative Uncharacterised P-loop hydrolase UPF0079 [Streptococcus
           agalactiae 515]
 gi|77162293|gb|EAO73264.1| Uncharacterised P-loop hydrolase UPF0079, putative [Streptococcus
           agalactiae CJB111]
 gi|77171846|gb|EAO75031.1| Uncharacterised P-loop hydrolase UPF0079, putative [Streptococcus
           agalactiae COH1]
 gi|77175038|gb|EAO77845.1| Uncharacterised P-loop hydrolase UPF0079, putative [Streptococcus
           agalactiae H36B]
          Length = 169

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 81/138 (58%), Gaps = 3/138 (2%)

Query: 7   HLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
           ++++    NE+  I LG+ L ++L+ GD + L+G+LG+GK+ L + I + L  D    + 
Sbjct: 20  NISMFYTQNEEELIALGQKLGTVLKSGDIVLLTGNLGAGKTTLTKGIAKGL--DIKQMIK 77

Query: 67  SPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKY 126
           SPT+T+V+ Y+  +P+ H D YR+    + ++L  D +  + + +IEW E+    L   Y
Sbjct: 78  SPTYTIVREYEGRVPLYHLDVYRIGDDPDSIDL-DDFLFGQGVTVIEWGELLSDNLINNY 136

Query: 127 IDIHLSQGKTGRKATISA 144
           ++I +++   GR+  + A
Sbjct: 137 LEIVITRSNQGRQVQLEA 154


>gi|291532262|emb|CBL05375.1| conserved hypothetical nucleotide-binding protein [Megamonas
           hypermegale ART12/1]
          Length = 159

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 75/129 (58%), Gaps = 4/129 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  LG  +A++++    + L GDLG+GK+   +S+ + L   +   V SPTF L+ +Y
Sbjct: 10  EQTSLLGEKIANLIQDNLIICLEGDLGAGKTLFTQSLCKALKVKEI--VTSPTFNLMNVY 67

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEI--LNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
           +    + HFD YRL   +++ E+GF E   + + + +IEWP+   + +P+ Y+ + + +G
Sbjct: 68  EGKKRIYHFDLYRLEQPEDLEEIGFYEYTDVEDEVVLIEWPDRFFAYMPEDYLHLKIERG 127

Query: 135 KTGRKATIS 143
            + +K  I+
Sbjct: 128 DSEQKRIIT 136


>gi|167749704|ref|ZP_02421831.1| hypothetical protein EUBSIR_00662 [Eubacterium siraeum DSM 15702]
 gi|167657327|gb|EDS01457.1| hypothetical protein EUBSIR_00662 [Eubacterium siraeum DSM 15702]
 gi|291529818|emb|CBK95403.1| conserved hypothetical nucleotide-binding protein [Eubacterium
           siraeum 70/3]
 gi|291556467|emb|CBL33584.1| conserved hypothetical nucleotide-binding protein [Eubacterium
           siraeum V10Sc8a]
          Length = 144

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 63/101 (62%), Gaps = 3/101 (2%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T+ +G+ +AS L+ GDC+  +G++G+GK+ L + I  +    D  +V SPTF LV  Y
Sbjct: 10  EETVEIGKKIASYLKAGDCVLYTGEMGAGKTHLTKGIAEYFGSTD--DVTSPTFALVNEY 67

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPE 116
           +  +P+ HFD +R+++  ++  +GF + L+   I  IEW E
Sbjct: 68  EGDVPIFHFDLFRINTLDDLYAIGFFDYLDRGGIMCIEWSE 108


>gi|251795056|ref|YP_003009787.1| hypothetical protein Pjdr2_1021 [Paenibacillus sp. JDR-2]
 gi|247542682|gb|ACS99700.1| protein of unknown function UPF0079 [Paenibacillus sp. JDR-2]
          Length = 165

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 81/142 (57%), Gaps = 6/142 (4%)

Query: 6   KHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEV 65
           K   V  + +E+ T  L + +A +++ G  L L GDLG+GK+  ++   + +   D   V
Sbjct: 4   KGQVVFTVRSEQETALLAQRIAGLVKPGTVLALDGDLGAGKTTFSQKFAKAIGVTDI--V 61

Query: 66  LSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLP 123
            SPTFT+++ Y+ AS+P  H D YRL S +E  ELG D+    + + I+EW  +   LLP
Sbjct: 62  NSPTFTIIKEYEGASMPFYHMDVYRL-SLEEADELGLDDYFFGDGVTIVEWASLIEELLP 120

Query: 124 KKYIDIHLS-QGKTGRKATISA 144
            + ++++++ +G   R+  IS 
Sbjct: 121 PERLEMYIAHEGGEERQFRISG 142


>gi|192360576|ref|YP_001983540.1| hypothetical protein CJA_3086 [Cellvibrio japonicus Ueda107]
 gi|190686741|gb|ACE84419.1| conserved hypothetical protein TIGR00150 [Cellvibrio japonicus
           Ueda107]
          Length = 159

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 7/137 (5%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLT---LSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           + +E+ T+  G  L ++L      T   L GDLG+GK+ L R ++R   H  A  V SPT
Sbjct: 10  LADEQATLAWGERLGALLAARHTFTSVYLLGDLGAGKTTLTRGLLRAFGHQGA--VKSPT 67

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y+     + HFD YRL   +E+  +G  D   +  +C++EWP  G  +LP+  +
Sbjct: 68  YTLVECYELGERRIYHFDLYRLGDPEELEFMGIRDYFSDNSLCLVEWPARGAGVLPEPDL 127

Query: 128 DIHLSQGKTGRKATISA 144
            I L+    GR+   S 
Sbjct: 128 MIALTPEAEGRRIAWSG 144


>gi|309378293|emb|CBX23081.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 153

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 69/134 (51%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+  L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILHGLGHQGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR S  +E  + G DE+     +C+IEWP+ G    P   I   
Sbjct: 69  VESYPLERFTLHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWPQQGGEFTPPADITAT 128

Query: 131 LSQGKTGRKATISA 144
           L+    GRK  ++A
Sbjct: 129 LTHDGGGRKCLLAA 142


>gi|257065699|ref|YP_003151955.1| hypothetical protein Apre_0182 [Anaerococcus prevotii DSM 20548]
 gi|256797579|gb|ACV28234.1| protein of unknown function UPF0079 [Anaerococcus prevotii DSM
           20548]
          Length = 148

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 71/136 (52%), Gaps = 6/136 (4%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
                A +L+ GD + L GD+G+GK+ L   I  +   +D+    SPTF +V +Y+    
Sbjct: 12  FAYKFAPLLKEGDVINLKGDMGAGKTTLTGYISEYFAIEDSS---SPTFAIVNIYEGDKK 68

Query: 82  VAHFDFYRLSSHQEVVELGFDEIL--NERICIIEWPEIGRSLLPKKYIDIHLSQ-GKTGR 138
           + H D YR    +E+ ++ F+E     + I I+EW E  R  LP+  I+I + + G+  R
Sbjct: 69  IYHLDLYRFDDPEEIFDIDFEEYFYPEDAITILEWAENVRPYLPEDMINISIEKLGENER 128

Query: 139 KATISAERWIISHINQ 154
           + TI +     S IN+
Sbjct: 129 EITIDSGSIRGSEINE 144


>gi|166031529|ref|ZP_02234358.1| hypothetical protein DORFOR_01229 [Dorea formicigenerans ATCC
           27755]
 gi|166028506|gb|EDR47263.1| hypothetical protein DORFOR_01229 [Dorea formicigenerans ATCC
           27755]
          Length = 145

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 69/126 (54%), Gaps = 4/126 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I    E++T  LG  L    + G   TL GDLG GK+   + +   L   +   V SPT
Sbjct: 6   IIESNKEQDTYDLGYELGQHAKPGQVFTLVGDLGVGKTVFTKGLAAGLGITEP--VSSPT 63

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
           FT+VQ+YD   +P  HFD YR+   +E+ E+G+ D +  E + +IEW  +   +LP+ + 
Sbjct: 64  FTIVQVYDEGRLPFYHFDVYRIGDVEEMDEIGYEDYVYGEGVSLIEWANLIEEILPEHFT 123

Query: 128 DIHLSQ 133
           +I + +
Sbjct: 124 EIKIEK 129


>gi|301156620|emb|CBW16091.1| ATPase with strong ADP affinity [Haemophilus parainfluenzae T3T1]
          Length = 156

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 81/147 (55%), Gaps = 9/147 (6%)

Query: 13  IPNEKNTICLGRHLASIL--RLGD---CLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E   +  G+ LA +L  +  D    L  +GDLG+GK+ L R +++ L +     V S
Sbjct: 8   IPDEGTMLRFGKKLAEVLVKQPKDNAIVLYFNGDLGAGKTTLTRGMVQGLGYQG--NVKS 65

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y  A   + HFD YRL+  +E+  +G  +  ++  IC+IEW E G  +LP+ 
Sbjct: 66  PTYTLVEEYSIAGKMIYHFDLYRLADPEELEFMGIRDYFSQNCICLIEWAEKGEGILPEP 125

Query: 126 YIDIHLSQGKTGRKATISAERWIISHI 152
            + +++      R  T+ A+  +  HI
Sbjct: 126 DLLVNIDYYDDARNITLIAQNSVGEHI 152


>gi|149278204|ref|ZP_01884342.1| putative ATPase/GTPase [Pedobacter sp. BAL39]
 gi|149230970|gb|EDM36351.1| putative ATPase/GTPase [Pedobacter sp. BAL39]
          Length = 167

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 66/109 (60%), Gaps = 5/109 (4%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-IPVAHFDFYRLSSHQEV 96
             G++G+GK+   +S+ R L   +   V SPTF++V  YDAS   V HFDFYR+ + QE 
Sbjct: 59  FEGEMGAGKTTFIKSLGRALGVTEV--VSSPTFSIVNEYDASGTVVYHFDFYRIKNLQEA 116

Query: 97  VELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS-QGKTGRKATIS 143
            ++G++E   +   C+IEWPE    LLP +YI I ++  G+T R  T S
Sbjct: 117 YDIGYEEYFYSGDYCLIEWPEKVAELLPDQYIKIEIAVVGETRRTLTFS 165


>gi|54295540|ref|YP_127955.1| hypothetical protein lpl2627 [Legionella pneumophila str. Lens]
 gi|53755372|emb|CAH16868.1| hypothetical protein lpl2627 [Legionella pneumophila str. Lens]
          Length = 160

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 67/111 (60%), Gaps = 4/111 (3%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQ 94
           +TLSGD+G+GK+ + R++++ L    A++  SPTF+LV+ Y+     + HFD YR+   +
Sbjct: 37  ITLSGDIGAGKTTIIRAMLKSLGVISAIK--SPTFSLVESYNCGQFHIHHFDLYRIHQEE 94

Query: 95  EVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           E+  LGF D   N+ +C IEWPE G   LP   I  +L    TGR   I+A
Sbjct: 95  ELEYLGFRDYFSNQSVCCIEWPEHGGKTLPPVDIQFNLIIKGTGRLIQIAA 145


>gi|322388599|ref|ZP_08062199.1| ATP/GTP hydrolase [Streptococcus infantis ATCC 700779]
 gi|321140519|gb|EFX36024.1| ATP/GTP hydrolase [Streptococcus infantis ATCC 700779]
          Length = 159

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 73/132 (55%), Gaps = 7/132 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFL-MHDDALEVLSPTFTLV 73
           NE   I LG+ L S+L   D L L+G+LG+GK+ L + + + L +H     + SPT+T+V
Sbjct: 17  NEDELIALGQELGSLLEKNDVLILTGELGAGKTTLTKGLAKGLGIHQ---MIKSPTYTIV 73

Query: 74  QLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
           + Y+  +P+ H D YR+    + ++L  DE L    + +IEW  +    LP  Y+++ + 
Sbjct: 74  REYEGRLPLYHLDVYRIEGDADSIDL--DEFLFGSGVTVIEWGHLLGEALPSDYLELEIL 131

Query: 133 QGKTGRKATISA 144
           +   GR+    A
Sbjct: 132 KDGEGREVVFHA 143


>gi|325265231|ref|ZP_08131957.1| ATP/GTP hydrolase [Clostridium sp. D5]
 gi|324029635|gb|EGB90924.1| ATP/GTP hydrolase [Clostridium sp. D5]
          Length = 141

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 71/133 (53%), Gaps = 8/133 (6%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  +G  L    + G   TL+GDLG GK+   +   + L  D    V SPTFT+VQ Y
Sbjct: 9   EQTFQIGVRLGQKAKPGQVYTLTGDLGVGKTVFTQGFAKGL--DIEEPVCSPTFTIVQEY 66

Query: 77  -DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDI----H 130
            +  +P  HFD YR+   +E+ E+G+ D I+ E + +IEW  +   +LP+K  ++     
Sbjct: 67  GEGRLPFYHFDVYRIGDVEEMDEVGYEDYIMGEGVSLIEWASLIEEILPEKRTEVIIEKD 126

Query: 131 LSQGKTGRKATIS 143
           L QG   R+ TI 
Sbjct: 127 LEQGFEYRRITIE 139


>gi|288904571|ref|YP_003429792.1| hypothetical ATP/GTP binding protein-P-loop hydrolase
           [Streptococcus gallolyticus UCN34]
 gi|306830566|ref|ZP_07463733.1| ATP/GTP hydrolase [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|325977544|ref|YP_004287260.1| hypothetical protein SGGBAA2069_c03440 [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|288731296|emb|CBI12847.1| conserved hypothetical ATP/GTP binding protein-P-loop hydrolase
           [Streptococcus gallolyticus UCN34]
 gi|304427284|gb|EFM30389.1| ATP/GTP hydrolase [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|325177472|emb|CBZ47516.1| conserved hypothetical protein [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 147

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 74/130 (56%), Gaps = 3/130 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE   I  G  L   L+ GD L L+G+LG+GK+ L + I + L  D    + SPT+T+V+
Sbjct: 6   NEDELIAYGNRLGQELQAGDILVLTGNLGAGKTTLTKGIAKGL--DIHQMIKSPTYTIVR 63

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+ +  + ++L  D +  + + +IEW E+  + L   Y+++ ++  
Sbjct: 64  EYEGRLPLYHLDVYRIGNDPDSIDLD-DFLYGDGVTVIEWGELLETDLLGDYLEVVITPS 122

Query: 135 KTGRKATISA 144
             GR+ T+ A
Sbjct: 123 GDGREITLHA 132


>gi|148358564|ref|YP_001249771.1| ATPase or kinase [Legionella pneumophila str. Corby]
 gi|296108346|ref|YP_003620047.1| ATPase or kinase [Legionella pneumophila 2300/99 Alcoy]
 gi|148280337|gb|ABQ54425.1| ATPase or kinase [Legionella pneumophila str. Corby]
 gi|295650248|gb|ADG26095.1| ATPase or kinase [Legionella pneumophila 2300/99 Alcoy]
          Length = 160

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 67/111 (60%), Gaps = 4/111 (3%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQ 94
           +TLSGD+G+GK+ + R++++ L    A++  SPTF+LV+ Y+     + HFD YR+   +
Sbjct: 37  ITLSGDIGAGKTTIIRAMLKSLGVISAIK--SPTFSLVESYNCGQFHIHHFDLYRIHQEE 94

Query: 95  EVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           E+  LGF D   N+ +C IEWPE G   LP   I  +L    TGR   I+A
Sbjct: 95  ELEYLGFRDYFSNQSVCCIEWPEHGGKTLPPVDIQFNLIIKGTGRLIQIAA 145


>gi|329917180|ref|ZP_08276438.1| hypothetical protein IMCC9480_2286 [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327544620|gb|EGF30092.1| hypothetical protein IMCC9480_2286 [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 161

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 67/121 (55%), Gaps = 14/121 (11%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIR---FLMHDDALEVLSPTFTL-----VQLYDASIPVAH 84
           G  + L GDLG+GK+ L R+++    ++ H     V SPT+TL     +QL+   + V H
Sbjct: 28  GLTIYLHGDLGTGKTALTRALLHAAGYVGH-----VKSPTYTLAEPYTIQLHAIDVDVIH 82

Query: 85  FDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATIS 143
           FD YR+ S  + ++ GF E  N   ICI+EWPE    +LP   ID+ L+    GR+  + 
Sbjct: 83  FDLYRMLSADDFLDAGFREYFNNSNICIVEWPEKADGVLPAADIDVFLTVAGAGREVKLL 142

Query: 144 A 144
           A
Sbjct: 143 A 143


>gi|258592306|emb|CBE68615.1| conserved protein of unknown function [NC10 bacterium 'Dutch
           sediment']
          Length = 168

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 67/130 (51%), Gaps = 1/130 (0%)

Query: 3   FSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDA 62
           F +K +T     + + T  LG  +  +  +GD + L G+LG+GK+     +   L  D A
Sbjct: 5   FEQKKVTTYHSASPEQTRALGEAVGRLADVGDVIALIGELGAGKTLFVGGLACGLEIDPA 64

Query: 63  LEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSL 121
             V SPTFT++  +   +P+ H D YR+ + +  + LG DE L  + +  IEW E G   
Sbjct: 65  TYVSSPTFTIIHCHRGRLPLYHIDLYRIETPEAFLNLGLDEYLQRDGVTAIEWAEHGWGY 124

Query: 122 LPKKYIDIHL 131
           LPK+ +   L
Sbjct: 125 LPKEILTFRL 134


>gi|302669934|ref|YP_003829894.1| hypothetical protein bpr_I0567 [Butyrivibrio proteoclasticus B316]
 gi|302394407|gb|ADL33312.1| hypothetical protein bpr_I0567 [Butyrivibrio proteoclasticus B316]
          Length = 145

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 70/135 (51%), Gaps = 8/135 (5%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           M    KH T     + + T  +GR +    + G   TL GDLG GK+ L + + + L   
Sbjct: 1   MEIVTKHETF----SAQETFEIGRRIGENAQPGMVYTLVGDLGVGKTVLTQGVAKGLGIT 56

Query: 61  DALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIG 118
               V SPTFT++Q+YD   IP  HFD YR+    E+ E+G+ D    + IC +EW  + 
Sbjct: 57  GP--VSSPTFTILQVYDEGRIPFYHFDVYRIGDVSEMDEIGYEDYFYGDGICFVEWANLI 114

Query: 119 RSLLPKKYIDIHLSQ 133
             LLP+ Y +I + +
Sbjct: 115 EELLPEHYTEIVIEK 129


>gi|332653026|ref|ZP_08418771.1| ATP/GTP hydrolase [Ruminococcaceae bacterium D16]
 gi|332518172|gb|EGJ47775.1| ATP/GTP hydrolase [Ruminococcaceae bacterium D16]
          Length = 144

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 73/131 (55%), Gaps = 4/131 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E++T  LGR L   +  G  +  +GDLG+GK+   R + + L      +V SPTFT+V 
Sbjct: 7   SERDTEELGRRLGERVAPGTVIAYTGDLGAGKTAFTRGLAQGLGV--PGQVTSPTFTIVN 64

Query: 75  LYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHLS 132
            Y+   +P+ HFD YRL S  E+ ++G+++ L    +C +EW E     L +  I + + 
Sbjct: 65  EYEGGRLPLFHFDMYRLGSADELFDIGWEDYLARGGVCAVEWSENVEDALEEDTIRVDIR 124

Query: 133 QGKTGRKATIS 143
           +G T ++  IS
Sbjct: 125 RGDTDQQRRIS 135


>gi|223985642|ref|ZP_03635691.1| hypothetical protein HOLDEFILI_02997 [Holdemania filiformis DSM
           12042]
 gi|223962386|gb|EEF66849.1| hypothetical protein HOLDEFILI_02997 [Holdemania filiformis DSM
           12042]
          Length = 149

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 64/102 (62%), Gaps = 7/102 (6%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  LG  + S+ +     T+SGDLG+GK+ L + I R L       V SPTFT++++Y
Sbjct: 11  QETKNLGEKMGSLSKPNMVWTMSGDLGAGKTTLTQGIARGL--GITRTVSSPTFTILKIY 68

Query: 77  DASIPVAHFDFYRL-SSHQEVVELGFDEILN-ERICIIEWPE 116
              +P+ HFD YRL  +HQ   ELGF+E+++ E + +IEWPE
Sbjct: 69  QGRLPLYHFDAYRLEGTHQ---ELGFEEMIDGEGLTVIEWPE 107


>gi|52842905|ref|YP_096704.1| ATPase or kinase [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|54298690|ref|YP_125059.1| hypothetical protein lpp2754 [Legionella pneumophila str. Paris]
 gi|52630016|gb|AAU28757.1| ATPase or kinase [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|53752475|emb|CAH13907.1| hypothetical protein lpp2754 [Legionella pneumophila str. Paris]
 gi|307611577|emb|CBX01257.1| hypothetical protein LPW_29551 [Legionella pneumophila 130b]
          Length = 160

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 67/111 (60%), Gaps = 4/111 (3%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQ 94
           +TLSGD+G+GK+ + R++++ L    A++  SPTF+LV+ Y+     + HFD YR+   +
Sbjct: 37  ITLSGDIGAGKTTIIRAMLKSLGVISAIK--SPTFSLVESYNCGQFHIHHFDLYRIHQEE 94

Query: 95  EVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           E+  LGF D   N+ +C IEWPE G   LP   I  +L    TGR   I+A
Sbjct: 95  ELEYLGFRDYFSNQSVCCIEWPEHGGKTLPPVDIQFNLIIKGTGRLIQIAA 145


>gi|25010427|ref|NP_734822.1| hypothetical protein gbs0353 [Streptococcus agalactiae NEM316]
 gi|23094779|emb|CAD45998.1| Unknown [Streptococcus agalactiae NEM316]
          Length = 147

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 77/130 (59%), Gaps = 3/130 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I LG+ L ++L+ GD + L+G+LG+GK+ L + I + L  D    + SPT+T+V+
Sbjct: 6   NEEELIALGQKLGTVLKSGDIVLLTGNLGAGKTTLTKGIAKGL--DIKQMIKSPTYTIVR 63

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  + + +IEW E+    L   Y++I +++ 
Sbjct: 64  EYEGRVPLYHLDVYRIGDDPDSIDL-DDFLFGQGVTVIEWGELLSDNLINNYLEIVITRS 122

Query: 135 KTGRKATISA 144
             GR+  + A
Sbjct: 123 NQGRQVQLEA 132


>gi|322392537|ref|ZP_08065997.1| ATP/GTP hydrolase [Streptococcus peroris ATCC 700780]
 gi|321144529|gb|EFX39930.1| ATP/GTP hydrolase [Streptococcus peroris ATCC 700780]
          Length = 147

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 73/132 (55%), Gaps = 7/132 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFL-MHDDALEVLSPTFTLV 73
           NE   I LG+ L S+L   D L L+G+LG+GK+ L + + + L +H     + SPT+T+V
Sbjct: 5   NEDELITLGQELGSLLEKNDVLILTGELGAGKTTLTKGLAKGLGIHQ---MIKSPTYTIV 61

Query: 74  QLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
           + Y+  +P+ H D YR+    + ++L  DE L    + +IEW  +    LP  Y+++ + 
Sbjct: 62  REYEGRLPLYHLDVYRIEGDADSIDL--DEFLFGSGVTVIEWGHLLADALPSDYLELEIL 119

Query: 133 QGKTGRKATISA 144
           +   GR+    A
Sbjct: 120 KDGEGREVVFHA 131


>gi|229542551|ref|ZP_04431611.1| protein of unknown function UPF0079 [Bacillus coagulans 36D1]
 gi|229326971|gb|EEN92646.1| protein of unknown function UPF0079 [Bacillus coagulans 36D1]
          Length = 151

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 65/116 (56%), Gaps = 5/116 (4%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T      +A+ L+ GD L L GDLG+GK+   + I   L       V SPTFT+++ Y
Sbjct: 12  EETFSFAEKMAAHLKPGDVLLLEGDLGAGKTTFTKGIANGLGIRRT--VNSPTFTIIKEY 69

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL 131
             ++P+ H D YRL   QE  +LGFDE    + + ++EW    + LLP+ Y++I +
Sbjct: 70  RGNLPLYHMDVYRLEDAQE--DLGFDEYFEGDGVTVVEWAHFIKDLLPESYLEIRI 123


>gi|253583459|ref|ZP_04860657.1| ATP/GTP hydrolase [Fusobacterium varium ATCC 27725]
 gi|251834031|gb|EES62594.1| ATP/GTP hydrolase [Fusobacterium varium ATCC 27725]
          Length = 154

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 67/113 (59%), Gaps = 4/113 (3%)

Query: 21  CLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV-QLYDAS 79
            L   L+        + L GDLG+GK+   ++  + L   ++L+  SPTF  V + +   
Sbjct: 12  TLAEKLSDYAEENTTIALIGDLGTGKTTFTQTFAKRLGVKESLK--SPTFNYVLEYFSGR 69

Query: 80  IPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHL 131
           +P+ HFD YRLS  +E+ E+G+++ LN   I +IEW +I +S LPK+YI+I L
Sbjct: 70  LPLYHFDVYRLSEAEEIYEVGYEDYLNSGGIILIEWADIIKSELPKEYIEIKL 122


>gi|154247225|ref|YP_001418183.1| hypothetical protein Xaut_3297 [Xanthobacter autotrophicus Py2]
 gi|154161310|gb|ABS68526.1| protein of unknown function UPF0079 [Xanthobacter autotrophicus
           Py2]
          Length = 523

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 39/101 (38%), Positives = 60/101 (59%), Gaps = 5/101 (4%)

Query: 34  DCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP---VAHFDFYRL 90
           D +TL+GDLG+GK+  AR++IR    +  ++V SPTF ++  YD   P   V H D YR+
Sbjct: 40  DTITLTGDLGAGKTEFARALIRAFAEEPGVDVPSPTFPILISYD--FPRGRVVHADLYRI 97

Query: 91  SSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
               E+ ELG+DE+    + ++EWP+     LP   +D+ L
Sbjct: 98  IETDELDELGWDELRENALLLVEWPDRADDRLPTDRLDVEL 138


>gi|319939758|ref|ZP_08014115.1| ATP-binding protein [Streptococcus anginosus 1_2_62CV]
 gi|319811096|gb|EFW07407.1| ATP-binding protein [Streptococcus anginosus 1_2_62CV]
          Length = 146

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 71/131 (54%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE   +  G  L ++L+  D L L+GDLG+GK+   + + R L     ++  SPT+T+V+
Sbjct: 5   NEDELMAWGEKLGALLQKQDVLILTGDLGAGKTTFTKGLARGLGIKQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            YD  +P+ H D YR+    + ++L  D +  + + +IEW E+    LP  Y+ + + + 
Sbjct: 63  EYDGRLPLYHLDVYRIGEDPDSIDLD-DFLFGDGVTVIEWGELLGDSLPSDYLKLTILRK 121

Query: 135 KTGRKATISAE 145
             GR+    A+
Sbjct: 122 SDGRELVFDAK 132


>gi|251766586|ref|ZP_02264321.2| conserved hypothetical protein TIGR00150 [Burkholderia mallei
           PRL-20]
 gi|243065515|gb|EES47701.1| conserved hypothetical protein TIGR00150 [Burkholderia mallei
           PRL-20]
          Length = 697

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 51/130 (39%), Positives = 67/130 (51%), Gaps = 20/130 (15%)

Query: 11  IPIPNEKNTICLGRHLASILRL------------GDCLTLSGDLGSGKSFLARSIIRFLM 58
           + + +E  TI LG  LA  L              G  + L GDLG+GK+ L R+++R L 
Sbjct: 23  LALADEAATIALGERLAHALDAMRGARAAAHAFDGLQIQLYGDLGAGKTTLVRAMLRGLG 82

Query: 59  HDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICII 112
           H  A  V SPT+TLV+ Y     D  + V HFD YR S   E  + GF E  N   ICI+
Sbjct: 83  H--AGRVKSPTYTLVEPYALARSDGELEVYHFDLYRFSDPAEWADAGFREYFNSGAICIV 140

Query: 113 EWPEIGRSLL 122
           EWP+   +LL
Sbjct: 141 EWPQRAGALL 150


>gi|332970135|gb|EGK09129.1| ATPase [Desmospora sp. 8437]
          Length = 260

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 74/130 (56%), Gaps = 6/130 (4%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           + + T  L R+LA   + GD + L GDLG+GK+  A+ +   L  ++ ++  SPTFTL++
Sbjct: 118 SPEETRTLARNLARCFQPGDVVLLEGDLGAGKTTFAQGVAIGLGIEEPVD--SPTFTLIK 175

Query: 75  LYDAS-IPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y    +P+ H D YR+ S +E  ELG+DE    E + ++EW       LP+K I + LS
Sbjct: 176 EYHGGRLPLYHMDVYRIQSPEE--ELGWDEYFYGEGVTLVEWASRISPWLPEKLIQVELS 233

Query: 133 QGKTGRKATI 142
            G+  R+  I
Sbjct: 234 HGENCRQIRI 243


>gi|46143181|ref|ZP_00135709.2| COG0802: Predicted ATPase or kinase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 122

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 69/118 (58%), Gaps = 9/118 (7%)

Query: 13  IPNEKNTICLGRHLA-SILRL----GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E      G+ L  SI ++    G  L L GDLG+GK+ L+R +I+ + H     V S
Sbjct: 7   IPDEYTMCQFGKKLIHSIAQIKSNKGITLYLQGDLGAGKTTLSRGMIQGIGHTG--HVKS 64

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLP 123
           PT+TLV+ Y      + HFD YRLS  +E+  +G  +  NER IC+IEW E G+ +LP
Sbjct: 65  PTYTLVEEYHLDEKDIYHFDLYRLSDPEELEFMGIRDYFNERSICLIEWAEKGQGILP 122


>gi|311104122|ref|YP_003976975.1| ATPase [Achromobacter xylosoxidans A8]
 gi|310758811|gb|ADP14260.1| ATPase, YjeE family protein [Achromobacter xylosoxidans A8]
          Length = 179

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 76/140 (54%), Gaps = 10/140 (7%)

Query: 13  IPNEKNTICLGRHLASILRLGDC------LTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
           +P+E  T  L R LA ++  G        + L GDLG+GK+   R+++R         + 
Sbjct: 12  LPDEAATESLARQLAPLVSGGQTGPAGGHIHLQGDLGAGKTAFTRALLRECGITG--RIK 69

Query: 67  SPTFTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPK 124
           SP++ L++ Y  S +   H DFYR S  +E ++ GF ++L +E + +IEWPE    LLP 
Sbjct: 70  SPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAGFRDLLRDEAVVLIEWPERAGGLLPP 129

Query: 125 KYIDIHLSQGKTGRKATISA 144
             + I L+    GR AT++A
Sbjct: 130 PDLLISLAYAGDGRDATLTA 149


>gi|302039391|ref|YP_003799713.1| hypothetical protein NIDE4120 [Candidatus Nitrospira defluvii]
 gi|300607455|emb|CBK43788.1| conserved protein of unknown function UPF0079, putative ATPase
           [Candidatus Nitrospira defluvii]
          Length = 174

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 78/133 (58%), Gaps = 4/133 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           + + T  LGR L ++L+ G+ L L G+LG+GK+ L + I   L+ +   EV SPTFTL+ 
Sbjct: 5   SSQQTHRLGRCLGTLLQGGEVLALFGELGAGKTSLVKGIADGLLAEPT-EVSSPTFTLIH 63

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLS- 132
            Y   +P+ H D YRL++ Q + + G ++ ++   + +IEW +     LP   +D+HLS 
Sbjct: 64  EYQGRLPLVHTDLYRLTASQ-LEDTGLNDYVDGHTVTVIEWADRWGDGLPSDRLDVHLSH 122

Query: 133 QGKTGRKATISAE 145
           +    R+A ++A 
Sbjct: 123 RPPATRRAILTAR 135


>gi|260913836|ref|ZP_05920310.1| ATPase with strong ADP affinity [Pasteurella dagmatis ATCC 43325]
 gi|260631923|gb|EEX50100.1| ATPase with strong ADP affinity [Pasteurella dagmatis ATCC 43325]
          Length = 168

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 79/140 (56%), Gaps = 9/140 (6%)

Query: 13  IPNEKNTICLGRHLA-SILRL--GDCLT--LSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E      G  L  +I +L   + +T  L+GDLG+GK+ L+R II+ L H     V S
Sbjct: 11  IPDETAMCAFGADLVNAICKLPSSNAITFYLNGDLGAGKTTLSRGIIQALGHQG--NVKS 68

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y      V HFD YRLS  +E+  +G  +  N+  +C+IEW E G+ LL + 
Sbjct: 69  PTYTLVEEYHLPQKTVYHFDLYRLSDPEELEFMGIRDYFNQNCLCLIEWSEKGKGLLAEP 128

Query: 126 YIDIHLSQGKTGRKATISAE 145
            I I+++     R  ++ A+
Sbjct: 129 DIIINIAYADNARNISLIAQ 148


>gi|212638052|ref|YP_002314572.1| ATP/GTP binding protein [Anoxybacillus flavithermus WK1]
 gi|212559532|gb|ACJ32587.1| ATP/GTP binding protein [Anoxybacillus flavithermus WK1]
          Length = 157

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 73/123 (59%), Gaps = 7/123 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           ++T+ L   LA  ++  D +TL GDLG+GK+   + + + L  D    V SPTFT+++ Y
Sbjct: 12  EDTLALAMKLAQYVQPQDVITLEGDLGAGKTTFTKGLAKGLGIDR--NVSSPTFTIIKQY 69

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKK--YIDIHLSQ 133
           +  IP+ H D YRL+  +E  +LGF+E    + + ++EW  +  + LP +  +I+IH   
Sbjct: 70  EGRIPLYHMDVYRLAESEE--DLGFEEYFFGDGVTVVEWAHLIEAYLPAERLHINIHHMD 127

Query: 134 GKT 136
           G++
Sbjct: 128 GES 130


>gi|149910180|ref|ZP_01898826.1| putative nucleotide-binding protein [Moritella sp. PE36]
 gi|149806766|gb|EDM66730.1| putative nucleotide-binding protein [Moritella sp. PE36]
          Length = 158

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+  G  L+ +      + L GDLG+GK+ L R  ++ L H     V SPT+TL
Sbjct: 9   LADESETVAFGASLSRLCDSATTIFLHGDLGAGKTTLTRGFVQALGHQG--NVKSPTYTL 66

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+ A   V HFD YRL+  +E+  +G  D   +  +C++EWP+ G   LP + + + 
Sbjct: 67  VEPYELADWNVYHFDLYRLADPEELEFMGIRDYFTDNCLCLVEWPQRGEGFLPVEDLQVT 126

Query: 131 LSQGKTGRKATISA 144
           L+     R+  +  
Sbjct: 127 LTYVGEQREVVVKG 140


>gi|153872180|ref|ZP_02001147.1| conserved hypothetical protein [Beggiatoa sp. PS]
 gi|152071354|gb|EDN68853.1| conserved hypothetical protein [Beggiatoa sp. PS]
          Length = 153

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 69/137 (50%), Gaps = 6/137 (4%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I  P+   T   G +LA        L L GDLG GK+ L R  +R L H     V SPT
Sbjct: 4   LIQTPSAMET--YGSYLAHACHSRAILHLCGDLGVGKTTLVRGFLRALGHTGI--VKSPT 59

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYI 127
           +TLV+ Y  A   + HFDFYRL   +E+   G  + L N+ IC+IEWPE G    P   +
Sbjct: 60  YTLVEPYRIAHRMIYHFDFYRLGDPEELEYFGIRDYLDNDMICLIEWPEKGGPFTPAPDL 119

Query: 128 DIHLSQGKTGRKATISA 144
            I LS     R+  + A
Sbjct: 120 QIKLSHHAEDRQLELQA 136


>gi|71065478|ref|YP_264205.1| hypothetical protein Psyc_0918 [Psychrobacter arcticus 273-4]
 gi|71038463|gb|AAZ18771.1| conserved hypothetical protein [Psychrobacter arcticus 273-4]
          Length = 175

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 72/130 (55%), Gaps = 11/130 (8%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E +T  L   LA+ L L   + L+GDLG+GK+ L R  ++ L H  A  V SPT+TLV+
Sbjct: 20  TEADTKRLAEQLAA-LPLTGSVWLAGDLGAGKTTLTRYWLQALGHKGA--VKSPTYTLVE 76

Query: 75  LY-----DASI-PVAHFDFYRLSSHQEVVELGFDEILNE--RICIIEWPEIGRSLLPKKY 126
            Y     D SI PV H D YRL   +E+  +GFDE L+E   + IIEW     S LP   
Sbjct: 77  PYSITQDDGSIKPVYHADLYRLQDPEELSFIGFDEYLDEPNALVIIEWASRADSYLPPPT 136

Query: 127 IDIHLSQGKT 136
           + I ++Q  +
Sbjct: 137 VFIDITQSDS 146


>gi|330818127|ref|YP_004361832.1| hypothetical protein bgla_1g32700 [Burkholderia gladioli BSR3]
 gi|327370520|gb|AEA61876.1| hypothetical protein bgla_1g32700 [Burkholderia gladioli BSR3]
          Length = 184

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 71/145 (48%), Gaps = 20/145 (13%)

Query: 13  IPNEKNTICLGRHLASIL------RL------GDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           +P+E  T   G   A  L      RL      G  + L GDLG+GK+ L R+I+R L H 
Sbjct: 25  LPDEAATAAFGLRFAQALDAVRAERLAANAFDGLQIQLLGDLGAGKTTLVRAILRGLGH- 83

Query: 61  DALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEW 114
            A  V SPT+TLV+ Y     D  + V HFD YR S   E  + GF E  N   IC++EW
Sbjct: 84  -AGRVRSPTYTLVEPYALERADGELAVHHFDLYRFSDPAEWADAGFREYFNAGAICLVEW 142

Query: 115 PEIGRSLLPKKYIDIHLSQGKTGRK 139
           P+   +LL    +   L     GR+
Sbjct: 143 PQQAGTLLGVPDLVFALDVDGEGRR 167


>gi|283798428|ref|ZP_06347581.1| ATPase with strong ADP affinity [Clostridium sp. M62/1]
 gi|291073831|gb|EFE11195.1| ATPase with strong ADP affinity [Clostridium sp. M62/1]
 gi|295090783|emb|CBK76890.1| conserved hypothetical nucleotide-binding protein [Clostridium cf.
           saccharolyticum K10]
 gi|295115025|emb|CBL35872.1| conserved hypothetical nucleotide-binding protein
           [butyrate-producing bacterium SM4/1]
          Length = 143

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 75/145 (51%), Gaps = 8/145 (5%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           + +I   + + T   GR +    + G+   L+GDLG GK+   +   R L       V S
Sbjct: 1   MKIIETYSPEETFEAGRRMGEKAKAGEVYCLNGDLGVGKTVFTQGFARGLGIQGT--VNS 58

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKK 125
           PTFT+VQ YD   +P+ HFD YR+    E+ E+G+++    E +C+IEW  +   +LP+ 
Sbjct: 59  PTFTIVQQYDEGRLPLYHFDVYRIGDISEMDEIGYEDCFYGEGVCLIEWSTLIEEILPEH 118

Query: 126 YIDIH----LSQGKTGRKATISAER 146
             +I     L+QG   R+ ++   +
Sbjct: 119 ATEIRIEKDLNQGFDYRRISVEERK 143


>gi|224543541|ref|ZP_03684080.1| hypothetical protein CATMIT_02750 [Catenibacterium mitsuokai DSM
           15897]
 gi|224523543|gb|EEF92648.1| hypothetical protein CATMIT_02750 [Catenibacterium mitsuokai DSM
           15897]
          Length = 148

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 72/123 (58%), Gaps = 5/123 (4%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I + NE   I  G+ +   +     +TL+GDLG+GK+   + I + L     +   SPT
Sbjct: 1   MINLKNEAEMIAFGKRIGETIFPHSIITLTGDLGAGKTTFTKGIGQGLEIKKIIN--SPT 58

Query: 70  FTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYID 128
           FT+V++Y   + + HFD YRL    +  +LGF+E+  ++ +C+IEWP+    ++P++ ++
Sbjct: 59  FTIVKVYSGRMTLYHFDAYRLEGADD--DLGFEEMFEDDGLCVIEWPQFIEDIIPEERLE 116

Query: 129 IHL 131
           I +
Sbjct: 117 IEI 119


>gi|85859375|ref|YP_461577.1| ATP/GTP hydrolase [Syntrophus aciditrophicus SB]
 gi|85722466|gb|ABC77409.1| ATP/GTP hydrolase [Syntrophus aciditrophicus SB]
          Length = 157

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 67/117 (57%), Gaps = 1/117 (0%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T+ +G+ + S L  GD + L G+LG+GK+ L + I R L   ++  + SPTFTL+  Y
Sbjct: 11  EETLYIGKIIGSCLTAGDVVALIGELGAGKTSLTQGIARGLEISESYAITSPTFTLINEY 70

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
                + HFD YRL    ++ ++G++E    + + +IEW E    ++P+  I I ++
Sbjct: 71  PGRHVLYHFDVYRLQGSNDLEDMGYEEYFYGKGVSVIEWAEKIADIIPETAITIEIT 127


>gi|16272039|ref|NP_438238.1| hypothetical protein HI0065 [Haemophilus influenzae Rd KW20]
 gi|68248616|ref|YP_247728.1| hypothetical protein NTHI0078 [Haemophilus influenzae 86-028NP]
 gi|260580631|ref|ZP_05848458.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
 gi|319775008|ref|YP_004137496.1| protein, ATPase [Haemophilus influenzae F3047]
 gi|329123090|ref|ZP_08251660.1| ATPase with strong ADP affinity [Haemophilus aegyptius ATCC 11116]
 gi|1176349|sp|P44492|Y065_HAEIN RecName: Full=UPF0079 ATP-binding protein HI_0065
 gi|22218761|pdb|1HTW|A Chain A, Complex Of Hi0065 With Adp And Magnesium
 gi|22218762|pdb|1HTW|B Chain B, Complex Of Hi0065 With Adp And Magnesium
 gi|22218763|pdb|1HTW|C Chain C, Complex Of Hi0065 With Adp And Magnesium
 gi|1573014|gb|AAC21743.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|68056815|gb|AAX87068.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP]
 gi|260092693|gb|EEW76629.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
 gi|317449599|emb|CBY85804.1| conserved hypothetical protein, ATPase [Haemophilus influenzae
           F3047]
 gi|327471645|gb|EGF17087.1| ATPase with strong ADP affinity [Haemophilus aegyptius ATCC 11116]
          Length = 158

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 78/140 (55%), Gaps = 9/140 (6%)

Query: 13  IPNEKNTICLGRHLASIL-----RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E + +  G+  A IL          + L+GDLG+GK+ L R +++ + H     V S
Sbjct: 8   IPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQG--NVKS 65

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+ A   + HFD YRL+  +E+  +G  +  N + IC+IEW E G+ +LP+ 
Sbjct: 66  PTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEA 125

Query: 126 YIDIHLSQGKTGRKATISAE 145
            I +++      R   + A+
Sbjct: 126 DILVNIDYYDDARNIELIAQ 145


>gi|22218634|pdb|1FL9|A Chain A, The Yjee Protein
 gi|22218635|pdb|1FL9|B Chain B, The Yjee Protein
 gi|22218636|pdb|1FL9|C Chain C, The Yjee Protein
          Length = 161

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 78/140 (55%), Gaps = 9/140 (6%)

Query: 13  IPNEKNTICLGRHLASIL-----RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E + +  G+  A IL          + L+GDLG+GK+ L R +++ + H     V S
Sbjct: 11  IPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQG--NVKS 68

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+ A   + HFD YRL+  +E+  +G  +  N + IC+IEW E G+ +LP+ 
Sbjct: 69  PTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEA 128

Query: 126 YIDIHLSQGKTGRKATISAE 145
            I +++      R   + A+
Sbjct: 129 DILVNIDYYDDARNIELIAQ 148


>gi|149912860|ref|ZP_01901394.1| hypothetical protein RAZWK3B_02690 [Roseobacter sp. AzwK-3b]
 gi|149813266|gb|EDM73092.1| hypothetical protein RAZWK3B_02690 [Roseobacter sp. AzwK-3b]
          Length = 158

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 65/118 (55%), Gaps = 2/118 (1%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +   T  L + +A  L  GD L LSG +G+GKS  AR +I   + D   +V SPT+TLVQ
Sbjct: 12  DPDQTCALAQAIAPRLEPGDVLLLSGQIGAGKSHFARCLILASL-DTPEDVPSPTYTLVQ 70

Query: 75  LYDASI-PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
            Y      + H D YRL+   E+ ELG  +  ++ IC++EWP+    L P   + +HL
Sbjct: 71  SYPGRRGEIWHADLYRLTDISEIEELGLIDAFSDAICLVEWPDRLGDLAPASALCLHL 128


>gi|83648047|ref|YP_436482.1| ATPase [Hahella chejuensis KCTC 2396]
 gi|83636090|gb|ABC32057.1| predicted ATPase or kinase [Hahella chejuensis KCTC 2396]
          Length = 159

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 80/151 (52%), Gaps = 9/151 (5%)

Query: 14  PNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV 73
           P+E+    LG  L+        + L G LG+GK+ L R+++R + +     V SPT+TLV
Sbjct: 10  PDEEAMAVLGDQLSQCFAAPGVVYLQGQLGAGKTTLTRAMMRGMGYSGL--VKSPTYTLV 67

Query: 74  QLYDASIP-VAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHL 131
           + Y      V HFD YRL+  +E+  LG  +  +E  IC++EWP+ G  LLP+  + + +
Sbjct: 68  EPYQLEDKLVFHFDLYRLADPEELEFLGIRDYFHENSICLVEWPDKGAPLLPEPDLTVDI 127

Query: 132 SQGKTGRKATISAE-----RWIISHINQMNR 157
                GR+  + A      +W+ ++  + +R
Sbjct: 128 QVLMKGRRIKLLAHTTRGCQWLEAYDAKQSR 158


>gi|56477958|ref|YP_159547.1| hypothetical protein ebA4453 [Aromatoleum aromaticum EbN1]
 gi|56314001|emb|CAI08646.1| conserved hypothetical protein [Aromatoleum aromaticum EbN1]
          Length = 171

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 73/132 (55%), Gaps = 9/132 (6%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-IPVAHFDFYRLS 91
           G  + L GDLG+GK+ L R ++  L H    +V SPT+TL++ Y  S + + HFDFYR +
Sbjct: 39  GLVIYLRGDLGAGKTTLVRGVLHALGHGG--KVKSPTYTLIEPYVLSRLNLYHFDFYRFA 96

Query: 92  SHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATIS----AER 146
             +E +E G DE   +  +C++EWP+     L    +++ L    TGR+  +S    A R
Sbjct: 97  VPEEYLEAGLDEYFGDTGVCLVEWPDKASPYLAPPDVEMRLVVAGTGRRLEVSGLTEAGR 156

Query: 147 WIISHIN-QMNR 157
                +N ++NR
Sbjct: 157 TCTRKLNSELNR 168


>gi|329116111|ref|ZP_08244828.1| hydrolase, P-loop family [Streptococcus parauberis NCFD 2020]
 gi|326906516|gb|EGE53430.1| hydrolase, P-loop family [Streptococcus parauberis NCFD 2020]
          Length = 149

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 74/131 (56%), Gaps = 5/131 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE   I  G+ L   L+  D + L+GDLGSGK+ L + I + L  + A  + SPT+T+V+
Sbjct: 6   NENELIAFGKRLGQALQKEDLIVLTGDLGSGKTTLTKGIAQGL--NIAQMIKSPTYTIVR 63

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+   P+ H D YR+    + ++L  DE I  + + +IEW E+  + L   +++I + +
Sbjct: 64  EYEGRFPLYHLDVYRIGDDPDSIDL--DEFIYGQGVTVIEWGELLDASLLNDFLEIIIDK 121

Query: 134 GKTGRKATISA 144
             +GR  T+ +
Sbjct: 122 VDSGRSVTLKS 132


>gi|225023443|ref|ZP_03712635.1| hypothetical protein EIKCOROL_00301 [Eikenella corrodens ATCC
           23834]
 gi|224943792|gb|EEG25001.1| hypothetical protein EIKCOROL_00301 [Eikenella corrodens ATCC
           23834]
          Length = 160

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 69/133 (51%), Gaps = 4/133 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E  T   G  +A  L     + L GDLG+GK+ L R+I+R L H  A  V SPT+ +V+
Sbjct: 11  GEAATEAFGNRIAPDLAAPLVVWLEGDLGAGKTTLVRAILRRLGHAGA--VKSPTYAIVE 68

Query: 75  LYDAS-IPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHLS 132
            Y  + + V HFD YR ++ +E  + G  E+  E  +  IEWP+      P   + I L 
Sbjct: 69  SYRPNGLAVNHFDLYRFAAPEEWEDAGLGELFVEPTLHFIEWPQRAEGFAPAADLRIALQ 128

Query: 133 QGKTGRKATISAE 145
              +GR  T+SA+
Sbjct: 129 NSGSGRVCTLSAD 141


>gi|145642146|ref|ZP_01797715.1| hypothetical protein CGSHiR3021_11059 [Haemophilus influenzae
           R3021]
 gi|145273137|gb|EDK13014.1| hypothetical protein CGSHiR3021_11059 [Haemophilus influenzae
           22.4-21]
          Length = 158

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 78/140 (55%), Gaps = 9/140 (6%)

Query: 13  IPNEKNTICLGRHLASIL-----RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E + +  G+  A IL          + L+GDLG+GK+ L R +++ + H     V S
Sbjct: 8   IPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGTGKTTLTRGMLQGIGHQG--NVKS 65

Query: 68  PTFTLVQLYDASIP-VAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+ S   + HFD YRL+  +E+  +G  +  N + IC+IEW E G+ +LP+ 
Sbjct: 66  PTYTLVEEYNISGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEA 125

Query: 126 YIDIHLSQGKTGRKATISAE 145
            I I++      R   + A+
Sbjct: 126 DILINIDYYDDARNIELIAQ 145


>gi|53804635|ref|YP_113762.1| hypothetical protein MCA1300 [Methylococcus capsulatus str. Bath]
 gi|53758396|gb|AAU92687.1| conserved hypothetical protein TIGR00150 [Methylococcus capsulatus
           str. Bath]
          Length = 144

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 72/136 (52%), Gaps = 4/136 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+     L + L  G  + L G+LG+GK+ L R  +R   +     V SPT+TL
Sbjct: 5   LPDEAATLAFAARLQTTLAPGCVVFLHGNLGAGKTTLVRGYLRAAGYLGT--VKSPTYTL 62

Query: 73  VQLYDASI-PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y  S   V HFD YRL+  +E+  +G  D    + +C +EWPE G  +LP   ++I+
Sbjct: 63  VEEYALSDRTVYHFDLYRLNDPEELEWMGIRDYFRPDSLCFLEWPEKGEGILPLPDLEIY 122

Query: 131 LSQGKTGRKATISAER 146
           L     GR   I + +
Sbjct: 123 LEPEDGGRSVRIVSAK 138


>gi|313892604|ref|ZP_07826191.1| hydrolase, P-loop family [Dialister microaerophilus UPII 345-E]
 gi|313119001|gb|EFR42206.1| hydrolase, P-loop family [Dialister microaerophilus UPII 345-E]
          Length = 158

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + TI LG+ +         + +SGDLG+GK+   + I + +   D   V SPTFT++  Y
Sbjct: 13  EETITLGKIIGENAVDDLFIAMSGDLGAGKTHFVQGIAKGMKIQDV--VTSPTFTIMNYY 70

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLP 123
           +  +P+ HFDFYRL S  ++  +G++E     + ++EW E+  SL+P
Sbjct: 71  EGKLPLKHFDFYRLESEYDLYNIGWEEYSVGGVTVVEWSELFPSLIP 117


>gi|253996208|ref|YP_003048272.1| hypothetical protein Mmol_0835 [Methylotenera mobilis JLW8]
 gi|253982887|gb|ACT47745.1| protein of unknown function UPF0079 [Methylotenera mobilis JLW8]
          Length = 162

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 71/140 (50%), Gaps = 9/140 (6%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
            + + +E  T+  G  L+  +     + L GDLG+GK+ L R ++  L    A +V SPT
Sbjct: 6   TLELADEAATLAFGTVLSKAIVANLTIYLHGDLGAGKTTLVRGLLHGLGF--AGKVKSPT 63

Query: 70  FTLVQLYD------ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLL 122
           +TLV+ Y+        + + HFD YR +  +E    GF +  N   +C+IEWPE    +L
Sbjct: 64  YTLVEPYENIEAAQGVLNLYHFDLYRFNDEEEWESAGFRDYFNAASVCLIEWPEKAEHIL 123

Query: 123 PKKYIDIHLSQGKTGRKATI 142
           P   +DI+      GRK  +
Sbjct: 124 PTPDLDIYFEIKPDGRKVRV 143


>gi|315086906|gb|EFT58882.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL002PA3]
          Length = 297

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 62/109 (56%), Gaps = 5/109 (4%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           T + +P  +     G  LA+ LR GD +  SGDLG+GK+ LA+ I R L  D    V+SP
Sbjct: 127 TRVVVPTAEAMHAFGAALAAQLRAGDIVLASGDLGAGKTTLAQGIGRGLGVDG--PVISP 184

Query: 69  TFTLVQLYDAS---IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEW 114
           TF L + +  S     V H D YRL S  E+++L  DE +++ + +IEW
Sbjct: 185 TFVLARRHAGSEGRPGVVHVDAYRLGSAAELIDLDLDETMDQAVTLIEW 233


>gi|325109388|ref|YP_004270456.1| hypothetical protein Plabr_2835 [Planctomyces brasiliensis DSM
           5305]
 gi|324969656|gb|ADY60434.1| Uncharacterized protein family UPF0079, ATPase [Planctomyces
           brasiliensis DSM 5305]
          Length = 174

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 73/130 (56%), Gaps = 4/130 (3%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
            T+   R LAS    G  +TL G LG+GK+F  R+    L    A +V SPT+ L+Q Y 
Sbjct: 24  QTVEQARLLASCCPAGLVITLDGTLGAGKTFFTRAFATGLGV-PAEDVTSPTYVLIQHYQ 82

Query: 78  ASI-PVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL-SQG 134
            +   + HFD YRL    E  ELG +E+L +E IC++EW      +LP+  + I + S G
Sbjct: 83  GTARSIHHFDLYRLRDLDEWDELGAEELLESEGICLVEWANRFPEVLPEDRLAIQIESTG 142

Query: 135 KTGRKATISA 144
           +T R+ T++A
Sbjct: 143 ETSREFTLTA 152


>gi|282880106|ref|ZP_06288826.1| ATPase, YjeE family [Prevotella timonensis CRIS 5C-B1]
 gi|281305979|gb|EFA98019.1| ATPase, YjeE family [Prevotella timonensis CRIS 5C-B1]
          Length = 137

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 64/111 (57%), Gaps = 6/111 (5%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASI---PVAHFDFYR 89
           G+     G +G+GK+   ++I   L  DD   + SPTF++V  Y ++     + HFDFYR
Sbjct: 25  GNVFAFYGKMGAGKTTFIKAICECLQVDDV--ITSPTFSIVNEYYSNKLDDSIYHFDFYR 82

Query: 90  LSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRK 139
           +   +EV ++G+ D   + R+C +EWPE+   LLPK  + +H+ + + G +
Sbjct: 83  IKKVEEVFDMGYEDYFYSGRLCFLEWPELIEGLLPKDAVKVHIMEQEDGSR 133


>gi|94265010|ref|ZP_01288779.1| Protein of unknown function UPF0079 [delta proteobacterium MLMS-1]
 gi|93454499|gb|EAT04784.1| Protein of unknown function UPF0079 [delta proteobacterium MLMS-1]
          Length = 173

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 21  CLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASI 80
            LGR L  + R GD + L G+LG+GK+ L ++I   L       V SPTF L+  Y   +
Sbjct: 28  ALGRQLGELARPGDVIFLLGELGAGKTTLTQAIAAGLGVPTNEPVTSPTFGLIHEYPGRL 87

Query: 81  PVAHFDFYRLSSHQ-EVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ-GKTG 137
           P+ H D YRL   + E++ELG ++ L    +C+IEWP+    L P   ++I L+  G T 
Sbjct: 88  PLYHLDLYRLGDDEDELLELGVEDYLYGLGVCVIEWPQRLGRLQPATRLEITLTMAGATH 147

Query: 138 R 138
           R
Sbjct: 148 R 148


>gi|228989424|ref|ZP_04149412.1| ATP/GTP hydrolase [Bacillus pseudomycoides DSM 12442]
 gi|228770295|gb|EEM18871.1| ATP/GTP hydrolase [Bacillus pseudomycoides DSM 12442]
          Length = 160

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 73/142 (51%), Gaps = 8/142 (5%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I   + + T  L   L  ++R  D L L GDLG+GK+   + + + L       V SPTF
Sbjct: 9   ITTTSSEETQNLSERLGQLVREQDVLVLEGDLGAGKTTFTKGLAKGLGVKRV--VNSPTF 66

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDI 129
            +++ Y   +P+ H D YRL+  +E  +LGFDE    E I ++EW  +  S LP + + I
Sbjct: 67  NIIKEYKGRLPLYHMDVYRLAESEE--DLGFDEYFYGEGITVVEWAHLIESFLPNEKLKI 124

Query: 130 HL-SQGKTGRKATI--SAERWI 148
            L   G   RK  +  S ER+I
Sbjct: 125 SLFHTGDDTRKIVLEPSGERYI 146


>gi|57234799|ref|YP_181141.1| hypothetical protein DET0396 [Dehalococcoides ethenogenes 195]
 gi|57225247|gb|AAW40304.1| conserved hypothetical protein TIGR00150 [Dehalococcoides
           ethenogenes 195]
          Length = 163

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 76/142 (53%), Gaps = 6/142 (4%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  LG+ +  +   GD + L G+LG+GK+ L + I + L  D     LSP+F LV+  
Sbjct: 12  RQTQDLGKIIGGLASAGDIIFLVGNLGAGKTNLTQGIAKGL--DVTENALSPSFVLVREM 69

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ-G 134
              +P+ H D YRL   +E+ ELG D+     R+ ++EW +    LLP + + I ++   
Sbjct: 70  YGRLPLYHIDLYRLDLSEEIEELGLDDYFYGSRVTVVEWADKADELLPTENLRIEIAYLD 129

Query: 135 KTGRKATISAERWIISHINQMN 156
           +  RK T+SA  W I +   +N
Sbjct: 130 ENKRKLTLSA--WGIRYEELLN 149


>gi|313905369|ref|ZP_07838735.1| protein of unknown function UPF0079 [Eubacterium cellulosolvens 6]
 gi|313469839|gb|EFR65175.1| protein of unknown function UPF0079 [Eubacterium cellulosolvens 6]
          Length = 143

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 70/126 (55%), Gaps = 4/126 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I   + + T    + L      G   TL GDLG GK+  A+ +   L   +   V SPT
Sbjct: 2   IIETNSPEETFAFAQKLGLEAVPGQIFTLDGDLGVGKTVFAKGLAEGLGITEP--VSSPT 59

Query: 70  FTLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYI 127
           FT+VQ Y D  +P+ HFD YR+   +E+ E+G+DE  N + +C+IEW ++ R LLP+  I
Sbjct: 60  FTIVQEYTDGRLPLYHFDVYRIEEPEEMEEIGYDEYFNGDGVCLIEWADMIRELLPEDVI 119

Query: 128 DIHLSQ 133
            I + +
Sbjct: 120 RIRIRK 125


>gi|227500791|ref|ZP_03930840.1| ATP-binding protein [Anaerococcus tetradius ATCC 35098]
 gi|227217096|gb|EEI82454.1| ATP-binding protein [Anaerococcus tetradius ATCC 35098]
          Length = 148

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 70/136 (51%), Gaps = 6/136 (4%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
                AS+L+ GD + L GD+G+GK+ L   I ++   DD+    SPTF +V +YD    
Sbjct: 12  FADKFASLLKEGDVVNLIGDMGAGKTTLTGYICKYFHIDDSS---SPTFAIVNIYDGDKK 68

Query: 82  VAHFDFYRLSSHQEVVELGFDEIL--NERICIIEWPEIGRSLLPKKYIDIHLSQ-GKTGR 138
           + H D YR     +V+++ F+E     + I I+EW E     LP   I++ + +  +T R
Sbjct: 69  IYHLDLYRFDHPDDVLDIDFEEYFYPQDAITILEWAENVEGYLPNDMINLEIKKIDETSR 128

Query: 139 KATISAERWIISHINQ 154
           +  I  +    S IN+
Sbjct: 129 QLIIDNDTPRGSEINE 144


>gi|289665666|ref|ZP_06487247.1| hypothetical protein XcampvN_21969 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 166

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 71/130 (54%), Gaps = 5/130 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           + + T  LG+ LA++      + L GDLG+GKS LAR+++R L     +   SPT+TLV+
Sbjct: 10  DAQATETLGQALAAVRPASAVVQLHGDLGAGKSTLARALLRALGVTGPIR--SPTYTLVE 67

Query: 75  LY--DASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y   A     H D YR+    E+  LG DE  +  + ++EWPE G  +LP   +D+ L+
Sbjct: 68  RYPLSAGDEAWHLDLYRIGHAGELDFLGLDEG-SASLWLVEWPERGTGVLPPVDLDVELA 126

Query: 133 QGKTGRKATI 142
               GR A +
Sbjct: 127 VDGEGRSARL 136


>gi|257125119|ref|YP_003163233.1| hypothetical protein Lebu_0324 [Leptotrichia buccalis C-1013-b]
 gi|257049058|gb|ACV38242.1| protein of unknown function UPF0079 [Leptotrichia buccalis
           C-1013-b]
          Length = 150

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 70/125 (56%), Gaps = 6/125 (4%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-I 80
           L + LA  LR G CL L GDLG+GK+   + I     ++    V SPTFT V  Y +  +
Sbjct: 14  LAKKLAEKLRNGGCLGLIGDLGAGKTTFTKKICE--CYNVTENVKSPTFTYVIEYSSGDV 71

Query: 81  PVAHFDFYRLSSHQEVVELGFDEILNER--ICIIEWPEIGRSLLPKKYIDIHLSQ-GKTG 137
           PV HFD YR++  +E+ E+GF++ + E   + IIEW +     +P+  + + ++    T 
Sbjct: 72  PVYHFDVYRINDSEEIYEIGFEDYIGEEGSVVIIEWADKILEEMPEDAVFVEINHYSDTA 131

Query: 138 RKATI 142
           R+ ++
Sbjct: 132 REVSV 136


>gi|188576159|ref|YP_001913088.1| hypothetical protein PXO_00412 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188520611|gb|ACD58556.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 166

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 70/127 (55%), Gaps = 5/127 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           + +NT  LG+ LAS+      + L GDLG+GKS LAR+++R L     +   SPT+TLV+
Sbjct: 10  DAQNTETLGQALASLRPASAVVQLHGDLGAGKSTLARALLRALGVTGPIR--SPTYTLVE 67

Query: 75  LYDASI--PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y  S      H D YR+    E+  LG DE  +  + ++EWPE G  +LP   +++ L+
Sbjct: 68  RYPLSTGDEAWHLDLYRIGHAGELDFLGLDEG-SASLWLVEWPERGAGVLPPVDLNVELA 126

Query: 133 QGKTGRK 139
               GR 
Sbjct: 127 VAGEGRS 133


>gi|319896478|ref|YP_004134671.1| atpase [Haemophilus influenzae F3031]
 gi|317431980|emb|CBY80328.1| conserved hypothetical protein, ATPase [Haemophilus influenzae
           F3031]
          Length = 158

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 78/140 (55%), Gaps = 9/140 (6%)

Query: 13  IPNEKNTICLGRHLASIL-----RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E + +  G+  A IL          + L+GDLG+GK+ L R +++ + H     V S
Sbjct: 8   IPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQG--NVKS 65

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+ A   + HFD YRL+  +E+  +G  +  N + IC+IEW E G+ +LP+ 
Sbjct: 66  PTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEA 125

Query: 126 YIDIHLSQGKTGRKATISAE 145
            I +++      R   + A+
Sbjct: 126 DILVNIDYYDDARNIELIAK 145


>gi|145639646|ref|ZP_01795249.1| hypothetical protein CGSHiII_09021 [Haemophilus influenzae PittII]
 gi|145271203|gb|EDK11117.1| hypothetical protein CGSHiII_09021 [Haemophilus influenzae PittII]
 gi|309750616|gb|ADO80600.1| Conserved hypothetical protein [Haemophilus influenzae R2866]
          Length = 158

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 78/140 (55%), Gaps = 9/140 (6%)

Query: 13  IPNEKNTICLGRHLASIL-----RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E + +  G+  A IL          + L+GDLG+GK+ L R +++ + H     V S
Sbjct: 8   IPDEFSMLRFGKKFAEILLDLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQG--NVKS 65

Query: 68  PTFTLVQLYDASIP-VAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+ S   + HFD YRL+  +E+  +G  +  N + IC+IEW E G+ +LP+ 
Sbjct: 66  PTYTLVEEYNISEKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEA 125

Query: 126 YIDIHLSQGKTGRKATISAE 145
            I +++      R   + A+
Sbjct: 126 DILVNIDYYDDARNIELIAQ 145


>gi|328944986|gb|EGG39143.1| ATP/GTP hydrolase [Streptococcus sanguinis SK1087]
          Length = 146

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 74/131 (56%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L  +LR GD L L+GDLG+GK+   + +   L     ++  SPT+T+V+
Sbjct: 5   NEEELIQWGQRLGKLLRAGDVLVLTGDLGAGKTTFTKGLALGLGISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + +IEW E+    LP+ Y+ + L + 
Sbjct: 63  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFLFGEGVTVIEWGELLGENLPEDYLKLRLLKK 121

Query: 135 KTGRKATISAE 145
           + GR+    A+
Sbjct: 122 EDGRELVFEAQ 132


>gi|260582017|ref|ZP_05849812.1| conserved hypothetical protein [Haemophilus influenzae NT127]
 gi|260094907|gb|EEW78800.1| conserved hypothetical protein [Haemophilus influenzae NT127]
          Length = 158

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 77/140 (55%), Gaps = 9/140 (6%)

Query: 13  IPNEKNTICLGRHLASIL-----RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E + +  G+  A IL          + L+GDLG+GK+ L R +++ + H     V S
Sbjct: 8   IPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQG--NVKS 65

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+ A   + HFD YRL+  +E+  +G  +  N   IC+IEW E G+ +LP+ 
Sbjct: 66  PTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTNSICLIEWSEKGQGILPEA 125

Query: 126 YIDIHLSQGKTGRKATISAE 145
            I +++      R   + A+
Sbjct: 126 DILVNIDYYDDARNIELIAQ 145


>gi|95930463|ref|ZP_01313199.1| protein of unknown function UPF0079 [Desulfuromonas acetoxidans DSM
           684]
 gi|95133503|gb|EAT15166.1| protein of unknown function UPF0079 [Desulfuromonas acetoxidans DSM
           684]
          Length = 164

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 71/123 (57%), Gaps = 7/123 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E+ T+ LG  L  +   G  + L GDLG+GK+ LA  I R +  D  + + SPT+TL+ 
Sbjct: 10  SEQQTLRLGEALGKLFPAGSLILLHGDLGAGKTCLASGIARGVGVDPDVPITSPTYTLLN 69

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEI------GRSLLPKKYI 127
            Y+  +P+ HFD YRL   +E+ ELGFDE  + + + ++EWPE       G  L+   Y+
Sbjct: 70  CYEGRLPLYHFDLYRLGGEEELEELGFDEYFHGDGVALVEWPERCPGLEEGAVLVEMAYV 129

Query: 128 DIH 130
           D H
Sbjct: 130 DEH 132


>gi|319778433|ref|YP_004129346.1| ATPase YjeE protein [Taylorella equigenitalis MCE9]
 gi|317108457|gb|ADU91203.1| ATPase YjeE protein [Taylorella equigenitalis MCE9]
          Length = 171

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (58%), Gaps = 4/109 (3%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-IPVAHFDFYRLSSHQEV 96
           LSGDLG+GK+ + R  ++    +  ++  SPT+TL++ Y  S + + HFDFYR S   + 
Sbjct: 50  LSGDLGAGKTTITREFLKAFGVNTRIK--SPTYTLLETYKVSRLYLYHFDFYRFSDPLDW 107

Query: 97  VELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           V+ GF E LN   I ++EWPE+ +  LP   + I LS    GR A I A
Sbjct: 108 VDAGFKETLNSPGISLVEWPEMAQDTLPVPDLHIFLSYDGEGRIAKIKA 156


>gi|238916341|ref|YP_002929858.1| hypothetical protein EUBELI_00375 [Eubacterium eligens ATCC 27750]
 gi|238871701|gb|ACR71411.1| Hypothetical protein EUBELI_00375 [Eubacterium eligens ATCC 27750]
          Length = 143

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 73/137 (53%), Gaps = 8/137 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N K T   G  +      G    L+GDLG GK+   +   + L  ++   V SPTFT++Q
Sbjct: 7   NAKETFEAGYEMGKKALPGQIYCLNGDLGVGKTVFTQGFAKGLGIEEP--VNSPTFTIIQ 64

Query: 75  LY-DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDI--- 129
            Y +  +P+ HFD YR+   +E+ ELG++E   ++ +C+IEW  + + ++P   I+I   
Sbjct: 65  EYHEGRLPLYHFDVYRIGDVEEMDELGYEEYFYSDGVCLIEWSTLIQEIIPDNAIEIVIE 124

Query: 130 -HLSQGKTGRKATISAE 145
             L +G   RK TI  E
Sbjct: 125 KDLEKGFDYRKITIGQE 141


>gi|162456587|ref|YP_001618954.1| hypothetical protein sce8304 [Sorangium cellulosum 'So ce 56']
 gi|161167169|emb|CAN98474.1| Hypothetical UPF0079 protein yjeE [Sorangium cellulosum 'So ce 56']
          Length = 170

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 12/134 (8%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I +P+ ++TI L R LA+ L  GD + L+GDLG+GK+F AR++ R L    AL + SPTF
Sbjct: 3   IELPSRRSTIRLARALAARLAGGDLVVLAGDLGAGKTFFARALCRALGVPPALPITSPTF 62

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQ-----------EVVELGFDEILNE-RICIIEWPEIG 118
           TLV  ++  +P+AH D YRL               E+ +LG  E   E  + ++EW E  
Sbjct: 63  TLVHEHEGRVPIAHADAYRLGGASSADGARDGAAAELAQLGLRERRAEGALVVVEWGEPF 122

Query: 119 RSLLPKKYIDIHLS 132
              L    + IHL+
Sbjct: 123 VEALGGDALLIHLA 136


>gi|148555588|ref|YP_001263170.1| hypothetical protein Swit_2676 [Sphingomonas wittichii RW1]
 gi|148500778|gb|ABQ69032.1| protein of unknown function UPF0079 [Sphingomonas wittichii RW1]
          Length = 157

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 65/117 (55%), Gaps = 7/117 (5%)

Query: 29  ILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS---IPVAHF 85
           +LR GD + L GDLG+GK+  AR ++  L    A EV SP+F +V  Y      +P+ H 
Sbjct: 24  VLRPGDVVALGGDLGAGKTTFARGLLHALGF--AGEVPSPSFPIVIPYAPPELRLPLWHV 81

Query: 86  DFYRLSSHQEVVELGFDEILNERICIIEWPE-IGRSLLPKKY-IDIHLSQGKTGRKA 140
           D YR+   +E+ ELG DE   + + +IEWPE +G  L P    + I  +Q + G  A
Sbjct: 82  DLYRIDDPEEIEELGLDEARADSVLLIEWPERMGARLWPDALRLAIEPAQRRGGPDA 138


>gi|317132651|ref|YP_004091965.1| Uncharacterized protein family UPF0079, ATPase [Ethanoligenens
           harbinense YUAN-3]
 gi|315470630|gb|ADU27234.1| Uncharacterized protein family UPF0079, ATPase [Ethanoligenens
           harbinense YUAN-3]
          Length = 146

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 63/118 (53%), Gaps = 3/118 (2%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
           +T   G  LA  L  GD + L G+LG+GK+   R + R L   D   V SPTF +V  Y 
Sbjct: 11  DTEQAGEQLAQELHPGDVVALFGNLGAGKTQFIRGLARGLGVTDP--VSSPTFAIVHAYR 68

Query: 78  ASIPVAHFDFYRLSSHQEVVELG-FDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
             IP+ HFD YR+S   ++   G FD + ++ +C +EW E   + LP+  + + +  G
Sbjct: 69  GRIPLYHFDMYRISGWADLESTGFFDYLESDGVCAVEWSENIEAALPENTVRVQIEPG 126


>gi|117924268|ref|YP_864885.1| hypothetical protein Mmc1_0961 [Magnetococcus sp. MC-1]
 gi|117608024|gb|ABK43479.1| protein of unknown function UPF0079 [Magnetococcus sp. MC-1]
          Length = 163

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 68/120 (56%), Gaps = 4/120 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  T  L   LA ++     + LSGDLG+GK+  +R  ++ ++ +  + V SPTF ++Q
Sbjct: 11  SEAQTEALAAALAGMVDAPLVIALSGDLGAGKTAFSRGFVQAMLGERVV-VSSPTFAIMQ 69

Query: 75  LY-DASIPVAHFDFYRLSSHQEVVELGFDEILNE--RICIIEWPEIGRSLLPKKYIDIHL 131
            Y   + PV HFD YRL+  +E+  +G DE L E   + ++EW  +    LP+  +D+ L
Sbjct: 70  SYVGGAWPVYHFDLYRLAGPEELEAIGADEALFEPDGVALVEWASLAGDWLPQDRLDVML 129


>gi|126208605|ref|YP_001053830.1| hypothetical protein APL_1135 [Actinobacillus pleuropneumoniae L20]
 gi|165976561|ref|YP_001652154.1| ATP-binding protein [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|190150462|ref|YP_001968987.1| hypothetical protein APP7_1193 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303250116|ref|ZP_07336318.1| ATP-binding protein [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|303253290|ref|ZP_07339439.1| ATP-binding protein [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|307246050|ref|ZP_07528132.1| hypothetical protein appser1_12530 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307248158|ref|ZP_07530186.1| hypothetical protein appser2_11390 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307250391|ref|ZP_07532339.1| hypothetical protein appser4_11710 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307252773|ref|ZP_07534664.1| hypothetical protein appser6_12870 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307255032|ref|ZP_07536850.1| hypothetical protein appser9_12660 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307257188|ref|ZP_07538960.1| hypothetical protein appser10_11880 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307259468|ref|ZP_07541193.1| hypothetical protein appser11_12650 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307261617|ref|ZP_07543285.1| hypothetical protein appser12_11780 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307263806|ref|ZP_07545412.1| hypothetical protein appser13_12170 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|126097397|gb|ABN74225.1| hypothetical protein APL_1135 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|165876662|gb|ABY69710.1| ATP-binding protein [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|189915593|gb|ACE61845.1| hypothetical protein APP7_1193 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302647972|gb|EFL78179.1| ATP-binding protein [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|302651179|gb|EFL81333.1| ATP-binding protein [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306852985|gb|EFM85208.1| hypothetical protein appser1_12530 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306855335|gb|EFM87510.1| hypothetical protein appser2_11390 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306857601|gb|EFM89709.1| hypothetical protein appser4_11710 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306859805|gb|EFM91827.1| hypothetical protein appser6_12870 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306861905|gb|EFM93881.1| hypothetical protein appser9_12660 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306864350|gb|EFM96261.1| hypothetical protein appser10_11880 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306866404|gb|EFM98267.1| hypothetical protein appser11_12650 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306868740|gb|EFN00549.1| hypothetical protein appser12_11780 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306870927|gb|EFN02665.1| hypothetical protein appser13_12170 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 163

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 78/155 (50%), Gaps = 12/155 (7%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRL------GDC--LTLSGDLGSGKSFLARSIIRFLMH 59
           L     P+E   +  G+  A+ +R         C  + L+G+LG+GK+ L RSI+R   H
Sbjct: 4   LVTFYFPDENRMLQFGQQFANAIRTYLEQDSAHCCVIYLNGELGAGKTTLTRSIVRAFGH 63

Query: 60  DDALEVLSPTFTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEI 117
                V SPT+TLV+ Y  +   + HFD YRL+  +E+  +G  D    + +C++EW   
Sbjct: 64  QG--NVKSPTYTLVEEYQLTPFCLYHFDLYRLADPEELEFMGIRDYFRPQTLCLLEWATK 121

Query: 118 GRSLLPKKYIDIHLSQGKTGRKATISAERWIISHI 152
           G+ ++P   I I +   + GR  T+  +  I   I
Sbjct: 122 GKGVIPPADIIIQIDYAELGRNLTLQPQNEIGDQI 156


>gi|332364640|gb|EGJ42409.1| ATP/GTP hydrolase [Streptococcus sanguinis SK1059]
          Length = 146

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 74/131 (56%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L  +LR GD L L+GDLG+GK+   + +   L     ++  SPT+T+V+
Sbjct: 5   NEEELIQWGQRLGKLLRAGDVLVLTGDLGAGKTTFTKGLALGLGISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + +IEW E+    LP+ Y+ + L + 
Sbjct: 63  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFLFGEGVTVIEWGELMGENLPEDYLKLSLLKK 121

Query: 135 KTGRKATISAE 145
           + GR+    A+
Sbjct: 122 EDGRELVFEAK 132


>gi|107023500|ref|YP_621827.1| hypothetical protein Bcen_1951 [Burkholderia cenocepacia AU 1054]
 gi|105893689|gb|ABF76854.1| protein of unknown function UPF0079 [Burkholderia cenocepacia AU
           1054]
          Length = 171

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 74/153 (48%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASIL---RL---------GDCLTLSGDLGSGKSFLARSIIRFL 57
           V+ + +E  T   G   A  L   RL         G  + L GDLG+GK+ L R+I+R L
Sbjct: 9   VVALADEAATEAFGTRFAHALDAARLELDRAHTFDGLQIQLVGDLGAGKTTLVRAILRGL 68

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICI 111
            H+    V SPT+TLV+ Y     D  + V HFD YR +   E  + GF E  N   IC+
Sbjct: 69  GHEG--RVRSPTYTLVEPYALERSDGELEVYHFDLYRFNDPAEWSDAGFREYFNSTAICL 126

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +EWP+   +LL    +   L     GR  T+ A
Sbjct: 127 VEWPQQAGALLGVPDLVFSLDVDGDGRALTVRA 159


>gi|78067363|ref|YP_370132.1| hypothetical protein Bcep18194_A5894 [Burkholderia sp. 383]
 gi|77968108|gb|ABB09488.1| protein of unknown function UPF0079 [Burkholderia sp. 383]
          Length = 184

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 72/153 (47%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASILRL------------GDCLTLSGDLGSGKSFLARSIIRFL 57
           VI + +E  T   G   A  L              G  + L GDLG+GK+ L R+I+R L
Sbjct: 22  VIALADEAATEAFGTRFAHALDAARVELARAHAFDGLQIQLVGDLGAGKTSLVRAILRGL 81

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICI 111
            H  A  V SPT+TLV+ Y     D  + V HFD YR +   E  + GF E  N   IC+
Sbjct: 82  GH--AGRVRSPTYTLVEPYALERDDGELEVYHFDLYRFNDPAEWSDAGFREYFNSSAICL 139

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +EWP+   +LL    +   L     GR  T+ A
Sbjct: 140 VEWPQQAGTLLGVPDLVFSLDVDGDGRALTVRA 172


>gi|325695162|gb|EGD37063.1| ATP/GTP hydrolase [Streptococcus sanguinis SK150]
          Length = 146

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 74/131 (56%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L  +LR GD L L+GDLG+GK+   + +   L     ++  SPT+T+V+
Sbjct: 5   NEEELIQWGQRLGKLLRAGDVLVLTGDLGAGKTTFTKGLALGLGISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + +IEW E+    LP+ Y+ + L + 
Sbjct: 63  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFLFGEGVTVIEWGELLGENLPEDYLKLSLLKK 121

Query: 135 KTGRKATISAE 145
           + GR+    A+
Sbjct: 122 EDGRELVFEAQ 132


>gi|239948429|ref|ZP_04700182.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922705|gb|EER22729.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 206

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 74/154 (48%), Gaps = 41/154 (26%)

Query: 16  EKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQL 75
           ++ T  L + LA  L+  D +  +GDLG+GK+F  R II++   ++   ++SPTF L+Q 
Sbjct: 7   KEETKKLAKLLAQSLKPNDIVLFNGDLGAGKTFFCREIIKYFCGENT-SIISPTFNLLQT 65

Query: 76  YDASIP--------------------------------------VAHFDFYRLSSHQEVV 97
           Y   +P                                      + H+D YRL S +E+ 
Sbjct: 66  Y--QVPNFTIVNSDSFDDRREERSLYTNRRDDEQRSSKRGSIDYIYHYDLYRLKSPEEIY 123

Query: 98  ELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           ELGF+E LN  + +IEW EI + LL    I+++L
Sbjct: 124 ELGFEEALNGNLILIEWYEIIKHLLSPPLIEVNL 157


>gi|187734990|ref|YP_001877102.1| protein of unknown function UPF0079 [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187425042|gb|ACD04321.1| protein of unknown function UPF0079 [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 149

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 63/106 (59%), Gaps = 4/106 (3%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-DASI 80
           LGR +  IL  G+ L + G+LG+GK+ L + I+  L   +A    SPTF+LV  + D  +
Sbjct: 24  LGRQIGKILMPGEILGVVGELGAGKTHLTQGIMEGLGSSEA--AASPTFSLVHEHADGRL 81

Query: 81  PVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKK 125
           P  HFDFYRL    E+  +G++E L+ E + I+EW  +    LP++
Sbjct: 82  PACHFDFYRLKDESELTGIGWEEYLDGETVLIVEWANLFPEALPEE 127


>gi|167718383|ref|ZP_02401619.1| hypothetical protein BpseD_05140 [Burkholderia pseudomallei DM98]
 gi|167823023|ref|ZP_02454494.1| hypothetical protein Bpseu9_05056 [Burkholderia pseudomallei 9]
          Length = 140

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 61/115 (53%), Gaps = 8/115 (6%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRL 90
           + L GDLG+GK+ L R+++R L H  A  V SPT+TLV+ Y     D  + V HFD YR 
Sbjct: 16  IQLYGDLGAGKTTLVRAMLRGLGH--AGRVKSPTYTLVEPYALARSDGELEVYHFDLYRF 73

Query: 91  SSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           S   E  + GF E  N   ICI+EWP+   +LL    +   L     GR  T  A
Sbjct: 74  SDPAEWADAGFREYFNSGAICIVEWPQRAGALLGVPDLVFSLDVAGEGRLLTARA 128


>gi|166711795|ref|ZP_02243002.1| hypothetical protein Xoryp_10155 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 166

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 69/127 (54%), Gaps = 5/127 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           + + T  LG+ LAS+      + L GDLG+GKS LAR+++R L     +   SPT+TLV+
Sbjct: 10  DAQTTETLGQALASLRPASAVVQLHGDLGAGKSTLARALLRALGVTGPIR--SPTYTLVE 67

Query: 75  LYDASI--PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y  S      H D YR+    E+  LG DE  +  + ++EWPE G  +LP   +D+ L+
Sbjct: 68  RYPLSTGDEAWHLDLYRIGHAGELDFLGLDEG-SASLWLVEWPERGAGVLPPVDLDVELA 126

Query: 133 QGKTGRK 139
               GR 
Sbjct: 127 VAGQGRS 133


>gi|171778079|ref|ZP_02919336.1| hypothetical protein STRINF_00171 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171283061|gb|EDT48485.1| hypothetical protein STRINF_00171 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 147

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 73/130 (56%), Gaps = 3/130 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE   +  G  L   L++GD L L+G+LG+GK+ L + I + L  D  ++  SPT+T+V+
Sbjct: 6   NEDELMAYGYRLGRKLQVGDVLVLTGNLGAGKTTLTKGIAKGLDIDQMIK--SPTYTIVR 63

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+ +  + ++L  D +  + + +IEW E+    L   Y++I ++  
Sbjct: 64  EYEGRLPLYHLDVYRIGNDPDSIDLD-DFLYGDGVAVIEWGELLEEDLLGDYLEIIITPS 122

Query: 135 KTGRKATISA 144
             GR   + +
Sbjct: 123 GDGRDIELQS 132


>gi|154249105|ref|YP_001409930.1| hypothetical protein Fnod_0408 [Fervidobacterium nodosum Rt17-B1]
 gi|154153041|gb|ABS60273.1| protein of unknown function UPF0079 [Fervidobacterium nodosum
           Rt17-B1]
          Length = 157

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 80/156 (51%), Gaps = 7/156 (4%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           M  S K    + I NE+  I LG+  AS L  GD L LSG++GSGK+   R I+  L  +
Sbjct: 1   METSGKSCVELGILNEEELINLGKRFASCLENGDILILSGEIGSGKTTFVRGIVHGLGCN 60

Query: 61  DALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQE---VVELGFDEILNERICIIEWPEI 117
             + V SPTFTL+ +Y     V H D YRL+S  E   ++E   +E  ++ I IIEW E 
Sbjct: 61  PIM-VTSPTFTLMNVYSCHKTVYHIDAYRLNSIDEAFYILEAELEE--DDGIFIIEWGET 117

Query: 118 GRSLLPKKYIDIHLSQ-GKTGRKATISAERWIISHI 152
                 ++ I+I      +  RK ++   + I+  +
Sbjct: 118 LNQFFNEETINIRFEHIDENHRKVSLCVSQEILQRL 153


>gi|282858074|ref|ZP_06267269.1| ATPase, YjeE family [Pyramidobacter piscolens W5455]
 gi|282583996|gb|EFB89369.1| ATPase, YjeE family [Pyramidobacter piscolens W5455]
          Length = 164

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/101 (46%), Positives = 60/101 (59%), Gaps = 6/101 (5%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
           +T  LG  +A++LR G  L + G+LG+GK+ L R + R L         SP+F LV  Y 
Sbjct: 21  DTRALGEKIAAVLRPGMTLLMRGELGAGKTTLVRELCRALGWK---RTCSPSFALVNEYA 77

Query: 78  -ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPE 116
            A IPVAH D YRL  H +  +LGFDE L N  + IIEWPE
Sbjct: 78  RARIPVAHADLYRL-EHVDGRDLGFDEYLDNGWVLIIEWPE 117


>gi|145636729|ref|ZP_01792395.1| hypothetical protein CGSHiHH_06430 [Haemophilus influenzae PittHH]
 gi|145270027|gb|EDK09964.1| hypothetical protein CGSHiHH_06430 [Haemophilus influenzae PittHH]
          Length = 158

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 77/140 (55%), Gaps = 9/140 (6%)

Query: 13  IPNEKNTICLGRHLASIL-----RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E + +  G+  A IL          + L+GDLG+GK+ L R +++ + H     V S
Sbjct: 8   IPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQG--NVKS 65

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+ A   + HFD YRL+  +E+  +G  +  N   IC+IEW E G+ +LP+ 
Sbjct: 66  PTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTGSICLIEWSEKGQGILPEA 125

Query: 126 YIDIHLSQGKTGRKATISAE 145
            I +++      R   + A+
Sbjct: 126 DILVNIDYYDDARNIELIAQ 145


>gi|285017883|ref|YP_003375594.1| hypothetical protein XALc_1092 [Xanthomonas albilineans GPE PC73]
 gi|283473101|emb|CBA15606.1| hypothetical protein XALc_1092 [Xanthomonas albilineans]
          Length = 160

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 79/148 (53%), Gaps = 9/148 (6%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+   T  LG+ LA+       + L GDLG+GKS LAR+++R L    A+   SPT+TL
Sbjct: 7   LPDSGATERLGQALAATRPAQAAVHLHGDLGAGKSTLARALLRALGVRGAIR--SPTYTL 64

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           ++ Y  A     H D YR+ +  E+  LG DE  +  + ++EWPE G  +L    +D+ L
Sbjct: 65  LERYPLADGEAWHLDLYRIGASGELDFLGLDET-SATLWLVEWPERGGDVLAPSDLDVLL 123

Query: 132 SQGKTGRKA-----TISAERWIISHINQ 154
           +    GR A     T + + W+   ++Q
Sbjct: 124 ALHDGGRMAQVRAGTAAGKVWLTQIVDQ 151


>gi|145633373|ref|ZP_01789103.1| hypothetical protein CGSHi3655_04055 [Haemophilus influenzae 3655]
 gi|144985936|gb|EDJ92538.1| hypothetical protein CGSHi3655_04055 [Haemophilus influenzae 3655]
 gi|309972801|gb|ADO96002.1| Conserved hypothetical protein [Haemophilus influenzae R2846]
          Length = 158

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 77/140 (55%), Gaps = 9/140 (6%)

Query: 13  IPNEKNTICLGRHLASIL-----RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E + +  G+  A IL          + L+GDLG+GK+ L R +++ + H     V S
Sbjct: 8   IPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQG--NVKS 65

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+ A   + HFD YRL+  +E+  +G  +  N   IC+IEW E G+ +LP+ 
Sbjct: 66  PTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTGSICLIEWSEKGQGILPES 125

Query: 126 YIDIHLSQGKTGRKATISAE 145
            I +++      R   + A+
Sbjct: 126 DILVNIDYYDDARNIELIAQ 145


>gi|227529581|ref|ZP_03959630.1| ATP-binding protein [Lactobacillus vaginalis ATCC 49540]
 gi|227350504|gb|EEJ40795.1| ATP-binding protein [Lactobacillus vaginalis ATCC 49540]
          Length = 150

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 70/125 (56%), Gaps = 5/125 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + + + K TI LG  +  +L+ GD L L GDLG+GK+   + + + L   D ++  SPTF
Sbjct: 4   VKLTDRKKTIELGEKVGQLLKAGDVLVLDGDLGAGKTTFTKGLAKGLDIPDLIK--SPTF 61

Query: 71  TLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYID 128
           T+++ Y D  +P+ H D YRL +     +LG +E  + + + ++EW +     LP  ++ 
Sbjct: 62  TIIREYHDGRLPLYHMDAYRLENGG-AEDLGLEEYFDSDGVSVVEWAQFVEDELPADFLA 120

Query: 129 IHLSQ 133
           IH  +
Sbjct: 121 IHFKR 125


>gi|262199283|ref|YP_003270492.1| hypothetical protein Hoch_6124 [Haliangium ochraceum DSM 14365]
 gi|262082630|gb|ACY18599.1| protein of unknown function UPF0079 [Haliangium ochraceum DSM
           14365]
          Length = 161

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 64/118 (54%), Gaps = 8/118 (6%)

Query: 23  GRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-DASIP 81
           G  LAS LR GD + L GDLG+GK+   + + R L     L V+SPTFTLV  Y    + 
Sbjct: 19  GEALASCLRDGDLIGLDGDLGAGKTLFVQGVARGLRVPPELRVVSPTFTLVNEYHGGRLS 78

Query: 82  VAHFDFYRLSSHQEVVELGFDEIL--NERICIIEW----PEIGRSLLPKKYIDIHLSQ 133
           + H D YR+   +E+ ELG DE+    E +  IEW    P +GR  L  + IDI  S 
Sbjct: 79  LYHADLYRIEQARELDELGLDEMCGAGEGVVCIEWSERFPVLGRRFLALR-IDIPASD 135


>gi|238028462|ref|YP_002912693.1| hypothetical protein bglu_1g29260 [Burkholderia glumae BGR1]
 gi|237877656|gb|ACR29989.1| Hypothetical protein bglu_1g29260 [Burkholderia glumae BGR1]
          Length = 184

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/128 (37%), Positives = 64/128 (50%), Gaps = 20/128 (15%)

Query: 13  IPNEKNTICLGRHLASILRL------------GDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           +P+E  T   G   A  L              G  + L+GDLG+GK+ L R+I+R L H 
Sbjct: 25  LPDEAATAAFGERFAHALEAVRAQAVARHAFAGLQIQLAGDLGAGKTTLVRAILRGLGH- 83

Query: 61  DALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEW 114
            A  V SPT+TLV+ Y        + V HFD YR S   E  + GF E  N   IC++EW
Sbjct: 84  -AGRVRSPTYTLVEPYVLARDGGELMVHHFDLYRFSDPAEWADAGFREYFNAGAICLVEW 142

Query: 115 PEIGRSLL 122
           P+   +LL
Sbjct: 143 PQQAGTLL 150


>gi|329121204|ref|ZP_08249832.1| nucleotide-binding protein [Dialister micraerophilus DSM 19965]
 gi|327470286|gb|EGF15747.1| nucleotide-binding protein [Dialister micraerophilus DSM 19965]
          Length = 158

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 61/107 (57%), Gaps = 2/107 (1%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + TI LG  +         + +SGDLG+GK+   + I + +   D   V SPTFT++  Y
Sbjct: 13  EETITLGNIIGENAVDDLFIAMSGDLGAGKTHFVQGIAKGMKIQDV--VTSPTFTIMNYY 70

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLP 123
           +  +P+ HFDFYRL S  ++  +G++E     + ++EW E+  SL+P
Sbjct: 71  EGKLPLKHFDFYRLESEYDLYNIGWEEYSVGGVTVVEWSELFPSLIP 117


>gi|116690582|ref|YP_836205.1| hypothetical protein Bcen2424_2562 [Burkholderia cenocepacia
           HI2424]
 gi|116648671|gb|ABK09312.1| protein of unknown function UPF0079 [Burkholderia cenocepacia
           HI2424]
          Length = 198

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 74/153 (48%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASIL---RL---------GDCLTLSGDLGSGKSFLARSIIRFL 57
           V+ + +E  T   G   A  L   RL         G  + L GDLG+GK+ L R+I+R L
Sbjct: 36  VVALADEAATEAFGTRFAHALDAARLELDRAHTFDGLQIQLVGDLGAGKTTLVRAILRGL 95

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICI 111
            H+    V SPT+TLV+ Y     D  + V HFD YR +   E  + GF E  N   IC+
Sbjct: 96  GHEG--RVRSPTYTLVEPYALERSDGELEVYHFDLYRFNDPAEWSDAGFREYFNSTAICL 153

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +EWP+   +LL    +   L     GR  T+ A
Sbjct: 154 VEWPQQAGALLGVPDLVFSLDVDGDGRALTVRA 186


>gi|310779207|ref|YP_003967540.1| protein of unknown function UPF0079 [Ilyobacter polytropus DSM
           2926]
 gi|309748530|gb|ADO83192.1| protein of unknown function UPF0079 [Ilyobacter polytropus DSM
           2926]
          Length = 154

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 69/112 (61%), Gaps = 4/112 (3%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV-QLYDASI 80
           L   LA   +  D + L GDLG+GK+   +++ + L  ++ ++  SPTF  V + +   +
Sbjct: 13  LAVDLADFSKENDVIALIGDLGTGKTTFIKTLAKELGIEENIK--SPTFNYVLEHHGGRL 70

Query: 81  PVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHL 131
           P+ HFD YRL+  +EV E+G+++ LN   + +IEW +I  S LPK+YI+I L
Sbjct: 71  PLYHFDVYRLTDPEEVYEVGYEDYLNNGGLVVIEWADIIESELPKEYIEIKL 122


>gi|15602767|ref|NP_245839.1| hypothetical protein PM0902 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12721218|gb|AAK02986.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 165

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 68/119 (57%), Gaps = 9/119 (7%)

Query: 13  IPNEKNTICLGRHLASILR---LGDCLT--LSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IPNE      GRH+   +      + +T  L+GDLG+GK+ L+R II+ L H     V S
Sbjct: 11  IPNETAMCQFGRHIVEAINNIYTNNAITVYLNGDLGAGKTTLSRGIIQALGHRG--NVKS 68

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPK 124
           PT+TLV+ Y   +  V HFD YRLS  +E+  +G  +  N   +C+IEW E G+ +L +
Sbjct: 69  PTYTLVEEYHLPTKTVYHFDLYRLSDPEELEFMGIRDYFNANCLCLIEWAEKGQGILSE 127


>gi|259502767|ref|ZP_05745669.1| ATP/GTP hydrolase [Lactobacillus antri DSM 16041]
 gi|259169270|gb|EEW53765.1| ATP/GTP hydrolase [Lactobacillus antri DSM 16041]
          Length = 152

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 70/128 (54%), Gaps = 5/128 (3%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +  + + + + TI LG+ + + L  GD L L GDLG+GK+   + + R L   D ++  S
Sbjct: 1   MQTVEMDSREATIALGKAVGTQLAAGDVLVLDGDLGAGKTTFTKGLARGLAIPDIIK--S 58

Query: 68  PTFTLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKK 125
           PTFT++  Y D  +P+ H D YRL +     +LG +E  + + + ++EW E     LP  
Sbjct: 59  PTFTIIHEYHDGRLPLYHMDAYRLENGGG-EDLGLEEYFDSDGVSVVEWAEFVEDELPAD 117

Query: 126 YIDIHLSQ 133
           ++ IH  +
Sbjct: 118 FLAIHFKR 125


>gi|301168658|emb|CBW28249.1| ATPase with strong ADP affinity [Haemophilus influenzae 10810]
          Length = 158

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 78/140 (55%), Gaps = 9/140 (6%)

Query: 13  IPNEKNTICLGRHLASIL-----RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E + +  G+  A IL          + L+GDLG+GK+ L R +++ + H     V S
Sbjct: 8   IPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQG--NVKS 65

Query: 68  PTFTLVQLYDASIP-VAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+ +   + HFD YRL+  +E+  +G  +  N + IC+IEW E G+ +LP+ 
Sbjct: 66  PTYTLVEEYNITGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEA 125

Query: 126 YIDIHLSQGKTGRKATISAE 145
            I +++      R   + A+
Sbjct: 126 DILVNIDYYDDARNIELIAQ 145


>gi|145629070|ref|ZP_01784869.1| hypothetical protein CGSHi22121_09720 [Haemophilus influenzae
           22.1-21]
 gi|144978573|gb|EDJ88296.1| hypothetical protein CGSHi22121_09720 [Haemophilus influenzae
           22.1-21]
          Length = 155

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 78/140 (55%), Gaps = 9/140 (6%)

Query: 13  IPNEKNTICLGRHLASIL-----RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           IP+E + +  G+  A IL          + L+GDLG+GK+ L R +++ + H     V S
Sbjct: 5   IPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQG--NVKS 62

Query: 68  PTFTLVQLYDASIP-VAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y+ +   + HFD YRL+  +E+  +G  +  N + IC+IEW E G+ +LP+ 
Sbjct: 63  PTYTLVEEYNITGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEA 122

Query: 126 YIDIHLSQGKTGRKATISAE 145
            I +++      R   + A+
Sbjct: 123 DILVNIDYYDDARNIELIAQ 142


>gi|325519698|gb|EGC99022.1| hypothetical protein B1M_38681 [Burkholderia sp. TJI49]
          Length = 184

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 62/115 (53%), Gaps = 8/115 (6%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRL 90
           + L GDLG+GK+ L R+I+R L H  A  V SPT+TLV+ Y     D  + V HFD YR 
Sbjct: 60  IQLVGDLGAGKTSLVRAILRGLGH--AGRVRSPTYTLVEPYALERDDGELEVYHFDLYRF 117

Query: 91  SSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +   E  + GF E  N   IC++EWP+   +LL    +   L     GR  T+ A
Sbjct: 118 NDPAEWSDAGFREYFNSSAICLVEWPQQAGTLLGVPDLVFSLDVDGDGRALTVRA 172


>gi|309776983|ref|ZP_07671952.1| ATP/GTP hydrolase [Erysipelotrichaceae bacterium 3_1_53]
 gi|308915193|gb|EFP60964.1| ATP/GTP hydrolase [Erysipelotrichaceae bacterium 3_1_53]
          Length = 150

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 78/130 (60%), Gaps = 9/130 (6%)

Query: 6   KHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEV 65
           K +TV  +   ++T  LG  +A +++ G  LTLSGDLG+GK+   + + + L     +  
Sbjct: 2   KQITVYSL---EDTARLGLKVAEMIKPGMLLTLSGDLGAGKTTFTKYLGKGLGVKKTIN- 57

Query: 66  LSPTFTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLP 123
            SPTFT++++Y  S +P+ H D YRL    +  +LGF+E   ++ +C+IEWP    + LP
Sbjct: 58  -SPTFTILKIYQGSKMPMYHMDAYRLEGISQ--DLGFEEYFEDDGLCVIEWPHFIENQLP 114

Query: 124 KKYIDIHLSQ 133
            + +DI +++
Sbjct: 115 NERLDIVITR 124


>gi|313667841|ref|YP_004048125.1| hypothetical protein NLA_4960 [Neisseria lactamica ST-640]
 gi|313005303|emb|CBN86736.1| conserved hypothetical protein [Neisseria lactamica 020-06]
          Length = 153

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 69/134 (51%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E  T+ LG   +S L     + L GDLG+GK+ L R I+R L H  A  V SPT+ +
Sbjct: 11  LADEAATLDLGAAWSSRLNAPLVIYLEGDLGAGKTTLTRGILRGLGHLGA--VKSPTYAI 68

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      + HFD YR S  +E  + G DE+     +C+IEW + G    P   I   
Sbjct: 69  VESYPLERFTLHHFDLYRFSFPEEWEDAGLDELFAANSVCLIEWSQQGGEFTPPADITAT 128

Query: 131 LSQGKTGRKATISA 144
           L+    GRK  ++A
Sbjct: 129 LTHDGGGRKCLLTA 142


>gi|325923185|ref|ZP_08184870.1| conserved hypothetical nucleotide-binding protein [Xanthomonas
           gardneri ATCC 19865]
 gi|325546330|gb|EGD17499.1| conserved hypothetical nucleotide-binding protein [Xanthomonas
           gardneri ATCC 19865]
          Length = 166

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 70/130 (53%), Gaps = 5/130 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           + + T  LG+ LA++      + L GDLG+GKS LAR+++R L     +   SPT+TLV+
Sbjct: 10  DAQATETLGQALAAVRPTTAMVQLHGDLGAGKSTLARALLRALGVTGPIR--SPTYTLVE 67

Query: 75  LYDASI--PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y  S      H D YR+    E+  LG DE  +  + ++EWPE G   LP   +D+ L+
Sbjct: 68  RYPLSTGDEAWHLDLYRIGHAGELDFLGLDEG-SASLWLVEWPERGAGALPPVDLDVELA 126

Query: 133 QGKTGRKATI 142
               GR  T+
Sbjct: 127 VEGEGRSVTL 136


>gi|170733922|ref|YP_001765869.1| hypothetical protein Bcenmc03_2586 [Burkholderia cenocepacia MC0-3]
 gi|169817164|gb|ACA91747.1| protein of unknown function UPF0079 [Burkholderia cenocepacia
           MC0-3]
          Length = 171

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 73/153 (47%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASIL---RL---------GDCLTLSGDLGSGKSFLARSIIRFL 57
           V+ + +E  T   G   A  L   RL         G  + L GDLG+GK+ L R+I+R L
Sbjct: 9   VVALADEAATEAFGTRFAHALDAARLELDRAHAFDGLQIQLVGDLGAGKTTLVRAILRGL 68

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICI 111
            H     V SPT+TLV+ Y     D  + V HFD YR +   E  + GF E  N   IC+
Sbjct: 69  GHQG--RVRSPTYTLVEPYALERSDGELEVYHFDLYRFNDPAEWSDAGFREYFNSTAICL 126

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +EWP+   +LL    +   L     GR  T+ A
Sbjct: 127 VEWPQQAGALLGVPDLVFSLDVDGDGRALTVRA 159


>gi|254251584|ref|ZP_04944902.1| hypothetical protein BDAG_00774 [Burkholderia dolosa AUO158]
 gi|124894193|gb|EAY68073.1| hypothetical protein BDAG_00774 [Burkholderia dolosa AUO158]
          Length = 199

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 71/153 (46%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASILRL------------GDCLTLSGDLGSGKSFLARSIIRFL 57
           VI + +E  T   G   A  L              G  + L GDLG+GK+ L R+I+R L
Sbjct: 37  VIALADEAATEAFGERFAHALDAARVELTRAHAFDGLQIQLVGDLGAGKTTLVRAILRGL 96

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICI 111
            H     V SPT+TLV+ Y     D  + V HFD YR +   E  + GF E  N   IC+
Sbjct: 97  GHRG--RVRSPTYTLVEPYALERDDGELEVYHFDLYRFNDPAEWSDAGFREYFNSSAICV 154

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +EWP+   +LL    +   L     GR  T+ A
Sbjct: 155 VEWPQQAGALLGVPDLVFSLDVDGDGRTLTVRA 187


>gi|289424944|ref|ZP_06426723.1| ATPase, YjeE family [Propionibacterium acnes SK187]
 gi|289427683|ref|ZP_06429395.1| ATPase, YjeE family [Propionibacterium acnes J165]
 gi|289154643|gb|EFD03329.1| ATPase, YjeE family [Propionibacterium acnes SK187]
 gi|289159174|gb|EFD07366.1| ATPase, YjeE family [Propionibacterium acnes J165]
 gi|313793336|gb|EFS41394.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL110PA1]
 gi|313801021|gb|EFS42289.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL110PA2]
 gi|313808761|gb|EFS47215.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL087PA2]
 gi|313812222|gb|EFS49936.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL025PA1]
 gi|313817942|gb|EFS55656.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL046PA2]
 gi|313819853|gb|EFS57567.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL036PA1]
 gi|313823344|gb|EFS61058.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL036PA2]
 gi|313824818|gb|EFS62532.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL063PA1]
 gi|313828337|gb|EFS66051.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL063PA2]
 gi|313838026|gb|EFS75740.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL086PA1]
 gi|314925847|gb|EFS89678.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL036PA3]
 gi|314960791|gb|EFT04892.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL002PA2]
 gi|314963465|gb|EFT07565.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL082PA1]
 gi|314969952|gb|EFT14050.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL037PA1]
 gi|314979834|gb|EFT23928.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL072PA2]
 gi|314986132|gb|EFT30224.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL005PA2]
 gi|314988745|gb|EFT32836.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL005PA3]
 gi|315077194|gb|EFT49259.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL053PA2]
 gi|315083321|gb|EFT55297.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL027PA2]
 gi|315089997|gb|EFT61973.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL072PA1]
 gi|315109153|gb|EFT81129.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL030PA2]
 gi|327325096|gb|EGE66902.1| hypothetical protein HMPREF9337_02554 [Propionibacterium acnes
           HL096PA3]
 gi|327449295|gb|EGE95949.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL013PA2]
 gi|327451527|gb|EGE98181.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL092PA1]
 gi|328756360|gb|EGF69976.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL020PA1]
 gi|332676185|gb|AEE73001.1| ATP-binding protein [Propionibacterium acnes 266]
          Length = 297

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 5/109 (4%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           T + +P  +     G  LA+ LR GD +  SGDLG+GK+ LA+ I R L  D    V+SP
Sbjct: 127 TRVVVPTAEAMHAFGAALAAQLRAGDIVLASGDLGAGKTTLAQGIGRGLGVDG--PVISP 184

Query: 69  TFTLVQLYDAS---IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEW 114
           TF L + +  S     + H D YRL S  E+++L  DE +++ + +IEW
Sbjct: 185 TFVLARRHAGSEGRPGLVHVDAYRLGSAAELIDLDLDETMDQAVTLIEW 233


>gi|269119244|ref|YP_003307421.1| hypothetical protein Sterm_0617 [Sebaldella termitidis ATCC 33386]
 gi|268613122|gb|ACZ07490.1| protein of unknown function UPF0079 [Sebaldella termitidis ATCC
           33386]
          Length = 150

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 72/129 (55%), Gaps = 5/129 (3%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-I 80
           L  ++A IL+ GD L L GDLG+GK+   ++I ++    +   V SPTF  V  Y++  I
Sbjct: 14  LAENIARILKRGDSLALIGDLGTGKTTFTKNICKYFNITE--NVKSPTFNYVIEYNSGDI 71

Query: 81  PVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRK 139
           P+ HFD YRL    E+ ++G+++ L  E I IIEW +     LP+  + + L+   T R 
Sbjct: 72  PIYHFDVYRLEEASEIYDIGYEDYLGGEGISIIEWADKISDELPEDTLFLELAY-DTERT 130

Query: 140 ATISAERWI 148
             +S  + I
Sbjct: 131 RKVSVYKLI 139


>gi|327332292|gb|EGE74028.1| hypothetical protein HMPREF9344_01566 [Propionibacterium acnes
           HL097PA1]
          Length = 297

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 5/109 (4%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           T + +P  +     G  LA+ LR GD +  SGDLG+GK+ LA+ I R L  D    V+SP
Sbjct: 127 TRVVVPTAEAMHAFGAALAAQLRAGDIVLASGDLGAGKTTLAQGIGRGLGVDG--PVISP 184

Query: 69  TFTLVQLYDAS---IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEW 114
           TF L + +  S     + H D YRL S  E+++L  DE +++ + +IEW
Sbjct: 185 TFVLARRHAGSGGRPGLVHVDAYRLGSAAELIDLDLDETMDQAVTLIEW 233


>gi|295131312|ref|YP_003581975.1| ATPase, YjeE family [Propionibacterium acnes SK137]
 gi|291377305|gb|ADE01160.1| ATPase, YjeE family [Propionibacterium acnes SK137]
 gi|313773197|gb|EFS39163.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL074PA1]
 gi|313810445|gb|EFS48159.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL083PA1]
 gi|313830058|gb|EFS67772.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL007PA1]
 gi|313832669|gb|EFS70383.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL056PA1]
 gi|314973093|gb|EFT17189.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL053PA1]
 gi|314975589|gb|EFT19684.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL045PA1]
 gi|314984873|gb|EFT28965.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL005PA1]
 gi|315096681|gb|EFT68657.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL038PA1]
 gi|327325277|gb|EGE67082.1| hypothetical protein HMPREF9338_02507 [Propionibacterium acnes
           HL096PA2]
 gi|327444079|gb|EGE90733.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL043PA1]
 gi|327449477|gb|EGE96131.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL043PA2]
 gi|328761306|gb|EGF74833.1| hypothetical protein HMPREF9343_00938 [Propionibacterium acnes
           HL099PA1]
          Length = 297

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 5/109 (4%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           T + +P  +     G  LA+ LR GD +  SGDLG+GK+ LA+ I R L  D    V+SP
Sbjct: 127 TRVVVPTAEAMHAFGAALAAQLRAGDIVLASGDLGAGKTTLAQGIGRGLGVDG--PVISP 184

Query: 69  TFTLVQLYDAS---IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEW 114
           TF L + +  S     + H D YRL S  E+++L  DE +++ + +IEW
Sbjct: 185 TFVLARRHAGSEGRPGLVHVDAYRLGSAAELIDLDLDETMDQAVTLIEW 233


>gi|256848057|ref|ZP_05553501.1| conserved hypothetical protein [Lactobacillus coleohominis
           101-4-CHN]
 gi|256715117|gb|EEU30094.1| conserved hypothetical protein [Lactobacillus coleohominis
           101-4-CHN]
          Length = 150

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 70/121 (57%), Gaps = 5/121 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I + + ++TI LG  +A  L  GD + L+GDLG+GK+   + I + L   + ++  SPTF
Sbjct: 4   ITLNSREDTIALGDKMAPFLHAGDVIVLNGDLGAGKTTFTKGIAKGLGVSEVIK--SPTF 61

Query: 71  TLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYID 128
           T+++ Y D  +P+ H D YRL +     +LG DE  + + + ++EW +     LP +++ 
Sbjct: 62  TIIREYQDGRLPLYHMDAYRLENGG-AEDLGLDEYFDGDGVSVVEWAQFAEEELPDEFLA 120

Query: 129 I 129
           I
Sbjct: 121 I 121


>gi|73540289|ref|YP_294809.1| hypothetical protein Reut_A0583 [Ralstonia eutropha JMP134]
 gi|72117702|gb|AAZ59965.1| Protein of unknown function UPF0079 [Ralstonia eutropha JMP134]
          Length = 176

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 85/162 (52%), Gaps = 21/162 (12%)

Query: 3   FSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLT----LSGDLGSGKSFLARSIIRFLM 58
             E+ LT+    +E  T  LG  LA ++R     T    LSGDLG+GK+ L+R+I+R L 
Sbjct: 7   LEERSLTLT---DEAATARLGAALAGVVRELPPTTVHVQLSGDLGAGKTTLSRAILRALG 63

Query: 59  HDDALEVLSPTFTLVQLYDAS------IPVAHFDFYRLSSHQEVVELGFDEILNE-RICI 111
           H  A +V SPT+TL + YD +      + V HFD YR +  +E ++ GF +   E    +
Sbjct: 64  H--AGKVRSPTYTLCEPYDVARADGSPLTVYHFDLYRFADPEEWIDAGFRDCFAEPAFNL 121

Query: 112 IEWPEIGRSLLPKKYIDIHL---SQGKTGRKATISAERWIIS 150
           +EWPE    LL +   D+H+   S       +  +AER I +
Sbjct: 122 VEWPEKAGRLLGEP--DLHVLLQSDMPAADMSDTAAERRIAT 161


>gi|229827330|ref|ZP_04453399.1| hypothetical protein GCWU000182_02718 [Abiotrophia defectiva ATCC
           49176]
 gi|229788268|gb|EEP24382.1| hypothetical protein GCWU000182_02718 [Abiotrophia defectiva ATCC
           49176]
          Length = 141

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 74/142 (52%), Gaps = 8/142 (5%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +TV    +E+ T  +G+ L      G+ + L GDLG GK+   +     L  ++ ++  S
Sbjct: 1   MTVYDSFSEEMTFEIGKKLGEKADKGEIICLEGDLGVGKTVFTKGFAEGLNIEENID--S 58

Query: 68  PTFTLVQLY-DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKK 125
           PTFT+VQ Y +  +P+ HFD YR+    E+ E+GF D    E +C+IEW      L+P+ 
Sbjct: 59  PTFTIVQEYTEGRLPLYHFDVYRIGDISEMDEIGFEDYFFGEGVCLIEWASRIEELIPES 118

Query: 126 YIDI----HLSQGKTGRKATIS 143
            I I     +S+G   R+  + 
Sbjct: 119 AIHIIIEKDMSKGFEYRRVVVE 140


>gi|315079876|gb|EFT51852.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL078PA1]
          Length = 297

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 5/109 (4%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           T + +P  +     G  LA+ LR GD +  SGDLG+GK+ LA+ I R L  D    V+SP
Sbjct: 127 TRVVVPTAEAMHAFGAALAAQLRAGDIVLASGDLGAGKTTLAQGIGRGLGVDG--PVISP 184

Query: 69  TFTLVQLYDAS---IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEW 114
           TF L + +  S     + H D YRL S  E+++L  DE +++ + +IEW
Sbjct: 185 TFVLARRHAGSEGRPGLVHVDAYRLGSAAELIDLDLDETMDQAVTLIEW 233


>gi|313763159|gb|EFS34523.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL013PA1]
 gi|313816498|gb|EFS54212.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL059PA1]
 gi|314914411|gb|EFS78242.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL005PA4]
 gi|314917734|gb|EFS81565.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL050PA1]
 gi|314919539|gb|EFS83370.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL050PA3]
 gi|314930130|gb|EFS93961.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL067PA1]
 gi|314957127|gb|EFT01231.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL027PA1]
 gi|314957733|gb|EFT01836.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL002PA1]
 gi|315097908|gb|EFT69884.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL059PA2]
 gi|315100673|gb|EFT72649.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL046PA1]
 gi|327451500|gb|EGE98154.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL087PA3]
 gi|327451809|gb|EGE98463.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL083PA2]
 gi|328752026|gb|EGF65642.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL087PA1]
 gi|328755442|gb|EGF69058.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL025PA2]
          Length = 297

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 5/109 (4%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           T + +P  +     G  LA+ LR GD +  SGDLG+GK+ LA+ I R L  D    V+SP
Sbjct: 127 TRVVVPTAEAMHAFGAALAAQLRAGDIVLASGDLGAGKTTLAQGIGRGLGVDG--PVISP 184

Query: 69  TFTLVQLYDAS---IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEW 114
           TF L + +  S     + H D YRL S  E+++L  DE +++ + +IEW
Sbjct: 185 TFVLARRHAGSEGRPGLVHVDAYRLGSAAELIDLDLDETMDQAVTLIEW 233


>gi|21243141|ref|NP_642723.1| hypothetical protein XAC2407 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21108661|gb|AAM37259.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 166

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 78/147 (53%), Gaps = 7/147 (4%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  LG+ LA+   +   + L GDLG+GKS LAR+++R L    A  + SPT+TLV+ Y
Sbjct: 12  QATETLGQALAAARPVSAVVQLHGDLGAGKSTLARALLRAL--GVAGPIRSPTYTLVERY 69

Query: 77  DASI--PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
             S      H D YR+    E+  LG DE  +  + ++EWPE G  +LP   +D+ L+  
Sbjct: 70  PLSTGDEAWHLDLYRIGHAGELDFLGLDEG-SASLWLVEWPERGAGVLPPVDLDVELAVA 128

Query: 135 KTGRKATISAERWIISHINQMNRSTSQ 161
             GR   +   R  I H   M+R + Q
Sbjct: 129 GEGRSVRLLG-RSAIGH-AWMDRLSRQ 153


>gi|206561113|ref|YP_002231878.1| putative hydrolase [Burkholderia cenocepacia J2315]
 gi|198037155|emb|CAR53076.1| putative hydrolase [Burkholderia cenocepacia J2315]
          Length = 184

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 73/153 (47%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASIL---RL---------GDCLTLSGDLGSGKSFLARSIIRFL 57
           VI + +E  T   G   A  L   RL         G  + L GDLG+GK+ L R+I+R L
Sbjct: 22  VIALADEAATEAFGTRFAHALDAARLELDRAHVFDGLQIQLVGDLGAGKTTLVRAILRGL 81

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICI 111
            H     V SPT+TLV+ Y     D  + V HFD YR +   E  + GF E  N   IC+
Sbjct: 82  GHQG--RVRSPTYTLVEPYALERSDGELEVYHFDLYRFNDPAEWSDAGFREYFNSSAICL 139

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +EWP+   +LL    +   L     GR  T+ A
Sbjct: 140 VEWPQQAGALLGVPDLVFSLDVDGDGRALTVRA 172


>gi|17547259|ref|NP_520661.1| hypothetical protein RSc2540 [Ralstonia solanacearum GMI1000]
 gi|17429561|emb|CAD16247.1| putative atpase or kinase protein [Ralstonia solanacearum GMI1000]
          Length = 198

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 73/133 (54%), Gaps = 14/133 (10%)

Query: 10  VIPIPNEKNTICLGRHLASILR-LGD---CLTLSGDLGSGKSFLARSIIRFLMHDDALEV 65
            +P+ +E  T   G   A  +R LG     + LSGDLG+GK+ L+R+I+  L H     V
Sbjct: 30  TVPLVDEAATAVFGAAFAQAVRALGPRPLQVQLSGDLGAGKTTLSRAILHGLGHTG--RV 87

Query: 66  LSPTFTLVQLYD-----ASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGR 119
            SPT+TLV+ Y+      +  V HFD YR    +E  + GF +   E  +C++EWPE  +
Sbjct: 88  RSPTYTLVEPYEVPGASGTQKVYHFDLYRFVDPEEWTDAGFRDCFAEPALCLVEWPEKAQ 147

Query: 120 SLLPKKYIDIHLS 132
           +LL     D+H++
Sbjct: 148 ALLGTP--DLHIA 158


>gi|293392161|ref|ZP_06636495.1| ATPase with strong ADP affinity [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952695|gb|EFE02814.1| ATPase with strong ADP affinity [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 164

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 85/151 (56%), Gaps = 14/151 (9%)

Query: 15  NEKNTICL-GRHLASIL-----RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           +++N +C+ G  L + +     + G  L L+GDLG+GK+ L+R II+ L +    +V SP
Sbjct: 10  SDENAMCVFGAKLINAISHVPNKQGIALYLNGDLGAGKTTLSRGIIQALGYQG--KVKSP 67

Query: 69  TFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKY 126
           T+TLV+ Y      V HFD YRL+  +E+  +G  +  NE  +C+IEW E G  +L    
Sbjct: 68  TYTLVEEYRFRDKTVYHFDLYRLADPEELEFMGIRDYFNENTLCLIEWAEKGTGMLMAAD 127

Query: 127 IDIHLSQGKTGRKATISAE----RWIISHIN 153
           + ++++  +T R   + A+    R II  +N
Sbjct: 128 LLVNIAYTETARHIELVAQSPIGRQIIEQLN 158


>gi|228995620|ref|ZP_04155285.1| ATP/GTP hydrolase [Bacillus mycoides Rock3-17]
 gi|229003248|ref|ZP_04161083.1| ATP/GTP hydrolase [Bacillus mycoides Rock1-4]
 gi|228757999|gb|EEM07209.1| ATP/GTP hydrolase [Bacillus mycoides Rock1-4]
 gi|228764116|gb|EEM12998.1| ATP/GTP hydrolase [Bacillus mycoides Rock3-17]
          Length = 160

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 72/142 (50%), Gaps = 8/142 (5%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I   + + T  L   L  ++R  D L L GDLG+GK+   + + + L       V SPTF
Sbjct: 9   ITTTSSEETQNLSERLGQLVREQDVLVLEGDLGAGKTTFTKGLAKGLGVKRV--VNSPTF 66

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDI 129
            +++ Y   +P+ H D YRL+  +E  +LGFDE    E I ++EW  +  S LP + + I
Sbjct: 67  NIIKEYKGRLPLYHMDVYRLAESEE--DLGFDEYFYGEGITVVEWAHLIESFLPNEKLKI 124

Query: 130 HL-SQGKTGRKATI--SAERWI 148
            L   G   RK  +    ER+I
Sbjct: 125 SLFHTGDDTRKIVLEPGGERYI 146


>gi|167561797|ref|ZP_02354713.1| hypothetical protein BoklE_04478 [Burkholderia oklahomensis EO147]
 gi|167569020|ref|ZP_02361894.1| hypothetical protein BoklC_04183 [Burkholderia oklahomensis C6786]
          Length = 184

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 71/153 (46%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASILRL------------GDCLTLSGDLGSGKSFLARSIIRFL 57
            + + +E  T+  G   A  L              G  + L GDLG+GK+ L R+++R L
Sbjct: 22  TLALADEAATLAFGERFAHALDAVRGERAAAHAFDGLQIQLYGDLGAGKTTLVRAMLRGL 81

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICI 111
            H  A  V SPT+TLV+ Y     D  + V HFD YR S   E  + GF E  N   IC+
Sbjct: 82  GH--AGRVKSPTYTLVEPYALARSDGELEVYHFDLYRFSDPAEWADAGFREYFNSGAICV 139

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +EWP+   +LL    +   L     GR  T  A
Sbjct: 140 VEWPQRAGALLGVPDLVFSLDVDGEGRLLTARA 172


>gi|114568636|ref|YP_755316.1| hypothetical protein Mmar10_0082 [Maricaulis maris MCS10]
 gi|114339098|gb|ABI64378.1| protein of unknown function UPF0079 [Maricaulis maris MCS10]
          Length = 158

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 62/115 (53%), Gaps = 3/115 (2%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLS 91
           GD + L+GDLG+GK+  AR++I  L   D  +  SPT+T++Q YD     + H D YR+ 
Sbjct: 29  GDTVFLTGDLGAGKTTFARTVIATLCGVD--DAPSPTYTIIQTYDWGRGELWHADLYRIE 86

Query: 92  SHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAER 146
           S  E+ ELG D+   +   +IEWP+    L+P   +++ L        A +   R
Sbjct: 87  SPDELDELGLDDAFGDATMLIEWPDRLFGLIPDDRLEVQLEMAGESPGAAMDTPR 141


>gi|254247396|ref|ZP_04940717.1| hypothetical protein BCPG_02188 [Burkholderia cenocepacia PC184]
 gi|124872172|gb|EAY63888.1| hypothetical protein BCPG_02188 [Burkholderia cenocepacia PC184]
          Length = 198

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 73/153 (47%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASIL---RL---------GDCLTLSGDLGSGKSFLARSIIRFL 57
           V+ + +E  T   G   A  L   RL         G  + L GDLG+GK+ L R+I+R L
Sbjct: 36  VVALADEAATEAFGTRFAHALDAARLELDRAHAFDGLQIQLVGDLGAGKTTLVRAILRGL 95

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICI 111
            H     V SPT+TLV+ Y     D  + V HFD YR +   E  + GF E  N   IC+
Sbjct: 96  GHQG--RVRSPTYTLVEPYALERSDGELEVYHFDLYRFNDPAEWSDAGFREYFNSTAICL 153

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +EWP+   +LL    +   L     GR  T+ A
Sbjct: 154 VEWPQQAGALLGVPDLVFSLDVDGDGRALTVRA 186


>gi|254787460|ref|YP_003074889.1| hypothetical protein TERTU_3562 [Teredinibacter turnerae T7901]
 gi|237684274|gb|ACR11538.1| conserved hypothetical protein [Teredinibacter turnerae T7901]
          Length = 168

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 76/154 (49%), Gaps = 5/154 (3%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           T + + +E  T+  GR L   L  G  + L G LG+GK+   R ++    H  A++  SP
Sbjct: 16  TAVYLADEAATVAAGRALGECLTPGVVVYLDGVLGAGKTTFCRGVLSAFGHSGAVK--SP 73

Query: 69  TFTLVQLYDASIP-VAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKK- 125
           T+TLV+ Y  S   + HFD YRL+  +E+  LG  D   ++ I +IEWP  G   LP   
Sbjct: 74  TYTLVEPYAFSAANIYHFDLYRLADPEELEYLGIRDYFSSDAISLIEWPVRGEGFLPSAD 133

Query: 126 YIDIHLSQGKTGRKATISAERWIISHINQMNRST 159
           +I   L +G   R   I+  +  +S +      T
Sbjct: 134 FIAKVLPEGHGRRLELIALSKKGMSVVQTFTDKT 167


>gi|291278924|ref|YP_003495759.1| hypothetical protein DEFDS_0509 [Deferribacter desulfuricans SSM1]
 gi|290753626|dbj|BAI80003.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 144

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 68/114 (59%), Gaps = 8/114 (7%)

Query: 6   KHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEV 65
           KH++  P     +T+ + ++ A  L+  + + L G+LG+GK+   +S+ + L  +DA  V
Sbjct: 4   KHISNSP----NDTVEIAKNFAKNLQGSETILLQGELGAGKTLFVKSVAKSLGCNDA--V 57

Query: 66  LSPTFTLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEI 117
            SPTFT++Q Y D   P+ HFD YR+ +  E+  +GF + + E  I  IEWPEI
Sbjct: 58  SSPTFTIMQTYSDGKFPLYHFDLYRIKNILELDNIGFFDYIEETGIKFIEWPEI 111


>gi|319654662|ref|ZP_08008742.1| hypothetical protein HMPREF1013_05364 [Bacillus sp. 2_A_57_CT2]
 gi|317393656|gb|EFV74414.1| hypothetical protein HMPREF1013_05364 [Bacillus sp. 2_A_57_CT2]
          Length = 151

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 66/116 (56%), Gaps = 5/116 (4%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           ++T+     L S+L+ GD L L GDLG+GK+   + + + L  +    V SPTFT+++ Y
Sbjct: 12  EDTMAFSERLGSLLQPGDVLALEGDLGAGKTTFTKGLAKGL--NITRNVNSPTFTIIKEY 69

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL 131
              +P+ H D YR+    E  +LGFDE      + ++EW  + +  LP++ + I+L
Sbjct: 70  QGRLPLYHMDVYRVEDSFE--DLGFDEYFEGNGVTVVEWAHLVKEQLPEELLTIYL 123


>gi|251792376|ref|YP_003007102.1| hypothetical protein NT05HA_0611 [Aggregatibacter aphrophilus
           NJ8700]
 gi|247533769|gb|ACS97015.1| conserved hypothetical protein [Aggregatibacter aphrophilus NJ8700]
          Length = 144

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 69/124 (55%), Gaps = 8/124 (6%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQ 94
           L L+GDLG+GK+ L+R +I+ L H     V SPT+TLV+ Y      + HFD YRL+  +
Sbjct: 23  LYLNGDLGAGKTTLSRGMIQGLGHSG--NVKSPTYTLVEEYKIGGKIIYHFDLYRLADPE 80

Query: 95  EVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAE----RWII 149
           E+  +G  +   E  IC+IEW E G  LL    + ++++  +  R   + AE    R II
Sbjct: 81  ELEFMGIRDYFAENTICLIEWAEKGAGLLASADLLVNIAYAENARNIELLAESETGRQII 140

Query: 150 SHIN 153
             +N
Sbjct: 141 QQLN 144


>gi|167835675|ref|ZP_02462558.1| hypothetical protein Bpse38_04223 [Burkholderia thailandensis
           MSMB43]
          Length = 140

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 8/93 (8%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRL 90
           + L GDLG+GK+ L R+++R L H  A  V SPT+TLV+ Y     D  + V HFD YR 
Sbjct: 16  IQLYGDLGAGKTTLVRAMLRGLGH--AGRVKSPTYTLVEPYALARSDGELEVYHFDLYRF 73

Query: 91  SSHQEVVELGFDEILNE-RICIIEWPEIGRSLL 122
           S   E  + GF E  N   IC++EWP+   +LL
Sbjct: 74  SDPAEWADAGFREYFNSGAICVVEWPQRAGALL 106


>gi|295397023|ref|ZP_06807137.1| ATP/GTP hydrolase [Aerococcus viridans ATCC 11563]
 gi|294974714|gb|EFG50427.1| ATP/GTP hydrolase [Aerococcus viridans ATCC 11563]
          Length = 155

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 77/139 (55%), Gaps = 6/139 (4%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
            I   +E +T    + LA+ +  GD + L G+LG+GK+   +   + L  D A++  SPT
Sbjct: 4   TIEWASEADTDVFAQKLANQVEAGDIICLEGNLGAGKTTFTKYFAKALGIDQAIK--SPT 61

Query: 70  FTLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYI 127
           +T+++ Y D  IP+ H D YRL        +G ++ LN + + IIEWP+     LPK Y+
Sbjct: 62  YTIIREYEDNDIPLYHMDAYRLEETGS-DSVGLEDYLNGDGVTIIEWPQFVAEDLPKDYL 120

Query: 128 DIHLS-QGKTGRKATISAE 145
            I L+   +T R+ T++ E
Sbjct: 121 WITLTASSETSREVTLTYE 139


>gi|240947962|ref|ZP_04752388.1| hypothetical protein AM305_04278 [Actinobacillus minor NM305]
 gi|240297718|gb|EER48179.1| hypothetical protein AM305_04278 [Actinobacillus minor NM305]
          Length = 148

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 71/131 (54%), Gaps = 12/131 (9%)

Query: 22  LGRHLASILR--------LGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV 73
            G+ LA+ ++        +G  + L GDLG+GK+ L RSI+R   +     V SPT+TLV
Sbjct: 4   FGQQLATAVKEVLINHPDMGVVIYLKGDLGAGKTTLTRSIVRSFGYQG--NVKSPTYTLV 61

Query: 74  QLYDAS-IPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           + Y  S   + HFD YRL+  +E+  +G  D    + +C++EWP  G+ ++P+  + + L
Sbjct: 62  EEYQLSPFTLYHFDLYRLADPEELEFMGIKDYFRPQTLCLLEWPSKGQGMIPEADLVLEL 121

Query: 132 SQGKTGRKATI 142
                GR   +
Sbjct: 122 EYANLGRNLKV 132


>gi|87311477|ref|ZP_01093597.1| hypothetical protein DSM3645_25577 [Blastopirellula marina DSM
           3645]
 gi|87285889|gb|EAQ77803.1| hypothetical protein DSM3645_25577 [Blastopirellula marina DSM
           3645]
          Length = 166

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 65/115 (56%), Gaps = 3/115 (2%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSS 92
           G  + L G LG+GK+ L ++I       D   V+SPTF LVQ YDA   + H D YR+  
Sbjct: 33  GTTIALLGTLGAGKTRLVKAIAA-ACEIDPQTVISPTFVLVQEYDAKRQLYHMDAYRIKD 91

Query: 93  HQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHL-SQGKTGRKATISAE 145
             E +ELG +E  N E +  +EW +     +P+ Y++I +   G+T R+ TI+A+
Sbjct: 92  DDEFLELGPEEYFNSEGLTFVEWADRVVGCMPRSYVEIEIFVTGETERRVTIAAQ 146


>gi|296333076|ref|ZP_06875532.1| putative ATPase or kinase UPF0079 [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305673298|ref|YP_003864970.1| putative ATPase or kinase [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296149801|gb|EFG90694.1| putative ATPase or kinase UPF0079 [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305411542|gb|ADM36661.1| putative ATPase or kinase [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 158

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 71/133 (53%), Gaps = 7/133 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N + T  + +  AS  + GD LTL GDLG+GK+   +     L       V SPTFT+++
Sbjct: 10  NPEETKAIAKLTASFAKPGDVLTLEGDLGAGKTTFTKGFAEGLGITRV--VNSPTFTIIK 67

Query: 75  LY-DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y D S+P+ H D YR+    E  +LG DE    + +C++EW  +    LP++ + I + 
Sbjct: 68  EYNDGSLPLYHMDVYRMEDESE--DLGLDEYFHGQGVCLVEWAHLIEEQLPQERLQIVIK 125

Query: 133 Q-GKTGRKATISA 144
           + G   R+ T +A
Sbjct: 126 RAGDDEREVTFTA 138


>gi|269796205|ref|YP_003315660.1| hypothetical protein Sked_29240 [Sanguibacter keddieii DSM 10542]
 gi|269098390|gb|ACZ22826.1| conserved hypothetical nucleotide-binding protein [Sanguibacter
           keddieii DSM 10542]
          Length = 196

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 84/163 (51%), Gaps = 12/163 (7%)

Query: 6   KHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEV 65
            HLT   +P+  +T  LGR LA +L+ GD + L+GDLG+GK+ L + I   L  D   +V
Sbjct: 5   SHLTT-DLPDADSTRALGRALAGLLQPGDLVMLTGDLGAGKTTLTQGIGSGL--DVRGQV 61

Query: 66  LSPTFTLVQLYDA---SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSL- 121
            SPTF + +++        + H D YRL S +EV  L  D  L E + ++EW   GR L 
Sbjct: 62  ASPTFVIARVHPPLGDGPALVHVDAYRLGSLEEVDALDLDASLEESVTVVEW---GRGLV 118

Query: 122 --LPKKYIDIHLSQGKTGRKATISAERWIISHINQMNRSTSQQ 162
             + +  +++ +S+ +     T  A    +  I +   + ++Q
Sbjct: 119 ESIARDRLEVTISRPRGTGDGTAEASAEALDAILEDAETGTRQ 161


>gi|160941600|ref|ZP_02088931.1| hypothetical protein CLOBOL_06500 [Clostridium bolteae ATCC
           BAA-613]
 gi|158435494|gb|EDP13261.1| hypothetical protein CLOBOL_06500 [Clostridium bolteae ATCC
           BAA-613]
          Length = 142

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 64/118 (54%), Gaps = 4/118 (3%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI     + T  LGR +      G  + LSGDLG GK+   +     L  +    V SPT
Sbjct: 2   VIETRKPEETYELGRKMGREAEPGQIVCLSGDLGVGKTVFTQGFAAGLGIEGP--VNSPT 59

Query: 70  FTLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKK 125
           FT++Q Y D  +P+ HFD YR+    E+ E+G+++    + +C+IEWP +   +LP+K
Sbjct: 60  FTILQQYEDGRLPLYHFDVYRIGDVSEMDEIGYEDCFFGDGVCLIEWPGLIEEILPEK 117


>gi|15613108|ref|NP_241411.1| hypothetical protein BH0545 [Bacillus halodurans C-125]
 gi|10173158|dbj|BAB04264.1| BH0545 [Bacillus halodurans C-125]
          Length = 157

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 72/133 (54%), Gaps = 8/133 (6%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           T+   + LA  L  GD +TL GDLG+GK+   + +   L       V SPTFT+++ Y  
Sbjct: 14  TMAFAQKLADKLLAGDVITLEGDLGAGKTSFTKGLALGLGIKRV--VKSPTFTIIREYKG 71

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ-GKT 136
            +P+ H D YRL+  +E  +LGFDE    + + ++EW  +    LP   + I ++  G+ 
Sbjct: 72  RLPLYHMDVYRLNEEEE--DLGFDEYFHGDGVTVVEWASLIEGRLPPVRLAITITHAGEN 129

Query: 137 GRKATISA--ERW 147
            R+ + +A  ERW
Sbjct: 130 ERQLSFTAYGERW 142


>gi|293374424|ref|ZP_06620749.1| ATPase, YjeE family [Turicibacter sanguinis PC909]
 gi|325837116|ref|ZP_08166287.1| hydrolase, P-loop family [Turicibacter sp. HGF1]
 gi|292646984|gb|EFF64969.1| ATPase, YjeE family [Turicibacter sanguinis PC909]
 gi|325491066|gb|EGC93360.1| hydrolase, P-loop family [Turicibacter sp. HGF1]
          Length = 149

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 68/123 (55%), Gaps = 5/123 (4%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI   + + T  +   +   ++ G  LTL GDLG+GK+   + + + L  D    V SPT
Sbjct: 4   VIKTQSVEETQKVAYAIGKWVKSGMILTLEGDLGAGKTTFTKGLAKGL--DIKRNVNSPT 61

Query: 70  FTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYID 128
           FT+++ Y   +P+ H D YRL +  +  E+G D+ L  E +C+IEW  +   LLP + +D
Sbjct: 62  FTIIKEYQGRLPLYHMDVYRLENGAD--EIGLDDYLYGEGVCVIEWASMIEDLLPNERLD 119

Query: 129 IHL 131
           I +
Sbjct: 120 IKI 122


>gi|314982203|gb|EFT26296.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL110PA3]
 gi|315090518|gb|EFT62494.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL110PA4]
          Length = 297

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 5/109 (4%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           T + +P  +     G  LA+ LR GD +  SGDLG+GK+ LA+ I R L  D    V+SP
Sbjct: 127 TRVVVPTAEAMHAFGAALAAQLRAGDIVLASGDLGAGKTTLAQGIGRGLGVDG--PVISP 184

Query: 69  TFTLVQLYDAS---IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEW 114
           TF L + +  S     + H D YRL S  E+++L  DE +++ + +IEW
Sbjct: 185 TFVLARRHVGSEGRPGLVHVDAYRLGSAAELIDLDLDETMDQAVTLIEW 233


>gi|255088155|ref|XP_002506000.1| predicted protein [Micromonas sp. RCC299]
 gi|226521271|gb|ACO67258.1| predicted protein [Micromonas sp. RCC299]
          Length = 255

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 58/107 (54%), Gaps = 8/107 (7%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD--------ASIPVAH 84
           GD L L GD+G+GKS L+R+ +R ++ D  ++V SPTF L Q+YD           PV H
Sbjct: 72  GDVLCLHGDVGAGKSALSRAYVRAVVGDPHVDVPSPTFLLQQVYDDHCDGDDAGPPPVHH 131

Query: 85  FDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           FD YRL    +   LG +E       +IEW E      P + +D+++
Sbjct: 132 FDLYRLKGPGDCDRLGLEESFATASSLIEWAERLGERCPGERLDVYI 178


>gi|221194970|ref|ZP_03568026.1| conserved hypothetical protein [Atopobium rimae ATCC 49626]
 gi|221184873|gb|EEE17264.1| conserved hypothetical protein [Atopobium rimae ATCC 49626]
          Length = 191

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 60/100 (60%), Gaps = 4/100 (4%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           TI LG     +L  GD L L+GDLG+GK+   + I R +      +V SPTFT+  +Y+ 
Sbjct: 21  TIALGEKCGELLAAGDVLVLTGDLGAGKTQFTKGIARGMGI--TADVTSPTFTIEMVYEG 78

Query: 79  SI-PVAHFDFYRLSSHQEVVELG-FDEILNERICIIEWPE 116
           S+ P+ HFD YRL+   ++ ++G FD + ++   +IEW E
Sbjct: 79  SVMPLYHFDLYRLNDSSQLDDIGLFDAMESDGPTVIEWGE 118


>gi|282855129|ref|ZP_06264461.1| ATPase, YjeE family [Propionibacterium acnes J139]
 gi|282581717|gb|EFB87102.1| ATPase, YjeE family [Propionibacterium acnes J139]
 gi|314924106|gb|EFS87937.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL001PA1]
 gi|314964945|gb|EFT09044.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL082PA2]
 gi|327325574|gb|EGE67373.1| hypothetical protein HMPREF9341_02387 [Propionibacterium acnes
           HL103PA1]
          Length = 297

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 5/109 (4%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           T + +P  +     G  LA+ LR GD +  SGDLG+GK+ LA+ I R L  D    V+SP
Sbjct: 127 TRVVVPTAEAMHAFGAALAAQLRAGDIVLASGDLGAGKTTLAQGIGRGLGVDG--PVISP 184

Query: 69  TFTLVQLYDAS---IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEW 114
           TF L + +  S     + H D YRL S  E+++L  DE +++ + +IEW
Sbjct: 185 TFVLARRHVGSEGRPGLVHVDAYRLGSAAELIDLDLDETMDQAVTLIEW 233


>gi|260881055|ref|ZP_05893294.1| ATPase with strong ADP affinity [Mitsuokella multacida DSM 20544]
 gi|260849842|gb|EEX69849.1| ATPase with strong ADP affinity [Mitsuokella multacida DSM 20544]
          Length = 159

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 73/133 (54%), Gaps = 12/133 (9%)

Query: 25  HLASI----LRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASI 80
           HLA +    +R G  L L GDLG+GK+   +S+   L  +   EV SPTF L+ +Y+   
Sbjct: 14  HLAELVGQKIREGTVLCLEGDLGAGKTLFVQSLAHTLGVEG--EVTSPTFNLMNVYEGIC 71

Query: 81  PVAHFDFYRLSSHQEVVELGFDEILN--ERICIIEWPEIGRSLLPKK--YIDIHLSQGKT 136
           P+ HFD YRL + +E+ ++GF E     E I +IEW +     +P++   + I  S    
Sbjct: 72  PIYHFDLYRLETEEELEDIGFYEYTEDPEGIVVIEWSDKFPQCMPEERVVVRIEKSDDGD 131

Query: 137 GRKATISA--ERW 147
           GR  T+++  ER+
Sbjct: 132 GRHITLASVGERY 144


>gi|134296747|ref|YP_001120482.1| hypothetical protein Bcep1808_2655 [Burkholderia vietnamiensis G4]
 gi|134139904|gb|ABO55647.1| protein of unknown function UPF0079 [Burkholderia vietnamiensis G4]
          Length = 183

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 71/153 (46%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASILRL------------GDCLTLSGDLGSGKSFLARSIIRFL 57
           VI + +E  T   G   A  L              G  + L GDLG+GK+ L R+I+R L
Sbjct: 21  VIALADEAATEAFGARFAHALDAARTELARTHAFAGLQIQLIGDLGAGKTTLVRAILRGL 80

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICI 111
            H     V SPT+TLV+ Y     D  + V HFD YR +   E  + GF E  N   IC+
Sbjct: 81  GHTG--RVRSPTYTLVEPYAFARDDGELEVYHFDLYRFNDPAEWSDAGFREYFNSSAICL 138

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           IEWP+   +LL    +   L     GR  T+ A
Sbjct: 139 IEWPQQAGALLGVPDLVFSLDVDGDGRALTVRA 171


>gi|324992040|gb|EGC23962.1| ATP/GTP hydrolase [Streptococcus sanguinis SK405]
 gi|324994133|gb|EGC26047.1| ATP/GTP hydrolase [Streptococcus sanguinis SK678]
 gi|327459342|gb|EGF05688.1| ATP/GTP hydrolase [Streptococcus sanguinis SK1]
 gi|327490557|gb|EGF22338.1| ATP/GTP hydrolase [Streptococcus sanguinis SK1058]
          Length = 146

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 74/131 (56%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L  +L+ GD L L+GDLG+GK+   + +   L     ++  SPT+T+V+
Sbjct: 5   NEEELIQWGQRLGKLLQAGDVLVLTGDLGAGKTTFTKGLALGLGISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + +IEW E+    LP+ Y+ + L + 
Sbjct: 63  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFLFGEGVTVIEWGELMGENLPEDYLKLSLLKK 121

Query: 135 KTGRKATISAE 145
           + GR+    A+
Sbjct: 122 EDGRELVFEAK 132


>gi|50843245|ref|YP_056472.1| nucleotide-binding protein (P-loop hydrolase) [Propionibacterium
           acnes KPA171202]
 gi|50840847|gb|AAT83514.1| predicted nucleotide-binding protein (P-loop hydrolase)
           [Propionibacterium acnes KPA171202]
 gi|315103939|gb|EFT75915.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL050PA2]
 gi|315106116|gb|EFT78092.1| conserved hypothetical protein TIGR00150 [Propionibacterium acnes
           HL030PA1]
          Length = 297

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 5/109 (4%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           T + +P  +     G  LA+ LR GD +  SGDLG+GK+ LA+ I R L  D    V+SP
Sbjct: 127 TRVVVPTAEAMHAFGAALAAQLRAGDIVLASGDLGAGKTTLAQGIGRGLGVDG--PVISP 184

Query: 69  TFTLVQLYDAS---IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEW 114
           TF L + +  S     + H D YRL S  E+++L  DE +++ + +IEW
Sbjct: 185 TFVLARRHVGSEGRPGLVHVDAYRLGSAAELIDLDLDETMDQAVTLIEW 233


>gi|324991715|gb|EGC23647.1| ATP/GTP hydrolase [Streptococcus sanguinis SK353]
          Length = 146

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 74/131 (56%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L  +L+ GD L L+GDLG+GK+   + +   L     ++  SPT+T+V+
Sbjct: 5   NEEELIQWGQRLGKLLQAGDVLVLTGDLGAGKTTFTKGLALGLGISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + +IEW E+    LP+ Y+ + L + 
Sbjct: 63  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFLFGEGVTVIEWGELLGENLPEDYLKLSLLKK 121

Query: 135 KTGRKATISAE 145
           + GR+    A+
Sbjct: 122 EDGRELVFEAQ 132


>gi|86157928|ref|YP_464713.1| hypothetical protein Adeh_1503 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774439|gb|ABC81276.1| protein of unknown function UPF0079 [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 188

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 60/116 (51%), Gaps = 2/116 (1%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           LG  L ++LR GD + L GDLG+GK+ L R            EV SPTF +V  Y   IP
Sbjct: 24  LGARLGALLRPGDVVALEGDLGAGKTQLVRGACEGAEVPPG-EVSSPTFAIVATYGGRIP 82

Query: 82  VAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQGKT 136
           V H D YR++   E+   GF +++  E   ++EW +     LP + + + LS   T
Sbjct: 83  VHHADLYRIADEDELYGTGFGDLVGGEGALLVEWADRIPGALPAERLTLRLSHDAT 138


>gi|171320437|ref|ZP_02909471.1| protein of unknown function UPF0079 [Burkholderia ambifaria MEX-5]
 gi|171094322|gb|EDT39395.1| protein of unknown function UPF0079 [Burkholderia ambifaria MEX-5]
          Length = 183

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 71/153 (46%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASILRL------------GDCLTLSGDLGSGKSFLARSIIRFL 57
           VI + +E  T   G   A  L              G  + L GDLG+GK+ L R+I+R L
Sbjct: 21  VIALADEAATEAFGARFAHALDAARGELARAHAFDGLQIQLIGDLGAGKTTLVRAILRGL 80

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICI 111
            H     V SPT+TLV+ Y     D  + V HFD YR +   E  + GF E  N   IC+
Sbjct: 81  GHPG--RVRSPTYTLVEPYAFARDDGELEVYHFDLYRFNDPAEWSDAGFREYFNSSAICL 138

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +EWP+   +LL    +   L     GR  T+ A
Sbjct: 139 VEWPQQAGTLLGVPDLVFSLDVDGGGRALTVRA 171


>gi|323488869|ref|ZP_08094108.1| ATP/GTP binding protein [Planococcus donghaensis MPA1U2]
 gi|323397432|gb|EGA90239.1| ATP/GTP binding protein [Planococcus donghaensis MPA1U2]
          Length = 150

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 72/132 (54%), Gaps = 8/132 (6%)

Query: 14  PNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV 73
           P E  +  +   LA  L  GD LTL GDLG+GK+   + + + L       V SPTFT++
Sbjct: 10  PEETESFAI--DLAERLEPGDLLTLEGDLGAGKTTFTKGLAKGLGIKRM--VNSPTFTIL 65

Query: 74  QLYDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLS 132
           + Y   + + HFD YRL +  E  ++GF+E  N E + ++EW       LP + ++I ++
Sbjct: 66  KQYSGRLDLNHFDVYRLENSDE--DIGFEEFFNSEAVSVVEWARFIEEYLPTERLEITIN 123

Query: 133 -QGKTGRKATIS 143
            Q +  RK T++
Sbjct: 124 RQSEQERKMTLN 135


>gi|221199200|ref|ZP_03572244.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221180485|gb|EEE12888.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 184

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 61/115 (53%), Gaps = 8/115 (6%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRL 90
           + L GDLG+GK+ L R+I+R L H     V SPT+TLV+ Y     D  + V HFD YR 
Sbjct: 60  IQLVGDLGAGKTTLVRAILRGLGHRG--RVRSPTYTLVEPYALERDDGELEVYHFDLYRF 117

Query: 91  SSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +   E  + GF E  N   IC++EWP+   +LL    +   L     GR  T+ A
Sbjct: 118 NDPAEWSDAGFREYFNSSAICLVEWPQQAGTLLGVPDLVFSLDVDGDGRALTVRA 172


>gi|302342380|ref|YP_003806909.1| hypothetical protein Deba_0945 [Desulfarculus baarsii DSM 2075]
 gi|301638993|gb|ADK84315.1| protein of unknown function UPF0079 [Desulfarculus baarsii DSM
           2075]
          Length = 158

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 68/132 (51%), Gaps = 4/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E+ T+ LG  L  +L  G  + L G LG+GK+ LAR + R L   D   V+SPTFTL+ 
Sbjct: 12  GEEQTLRLGLALGRVLGPGAVVLLRGGLGAGKTTLARGLARGLGVGDDYNVVSPTFTLLN 71

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
           +Y    P  H D YRL     +     +E   E +  +EW E+     P+  +D+ L+ G
Sbjct: 72  VYPGPTPFFHADLYRLDLGGALDLGLLEES-AEGVLAVEWAEVMDGRWPETAVDVWLT-G 129

Query: 135 KTG--RKATISA 144
           + G  R+A IS 
Sbjct: 130 EAGHERQARISG 141


>gi|284037873|ref|YP_003387803.1| hypothetical protein Slin_2993 [Spirosoma linguale DSM 74]
 gi|283817166|gb|ADB39004.1| protein of unknown function UPF0079 [Spirosoma linguale DSM 74]
          Length = 140

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 63/123 (51%), Gaps = 7/123 (5%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALE-VLSPTFTLVQLYDA-- 78
           + R L +  R        GD+G+GK+   +SI R L     L  V SPTF++V  Y    
Sbjct: 14  MARKLLAEGREHPVWLFEGDMGAGKTTFIKSICRSL---GVLSMVQSPTFSIVNEYTTHE 70

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHLSQGKTG 137
             PV HFD YRL +  E +++G +E ++    C IEWPE   SL P  Y  IH+S    G
Sbjct: 71  GHPVYHFDCYRLRNEAEALDIGLEEYMDSGNYCFIEWPERIASLWPATYYQIHISADTVG 130

Query: 138 RKA 140
           R+ 
Sbjct: 131 RRT 133


>gi|221206603|ref|ZP_03579615.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221173258|gb|EEE05693.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
          Length = 226

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 61/115 (53%), Gaps = 8/115 (6%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRL 90
           + L GDLG+GK+ L R+I+R L H     V SPT+TLV+ Y     D  + V HFD YR 
Sbjct: 102 IQLVGDLGAGKTTLVRAILRGLGHRG--RVRSPTYTLVEPYALERDDGELEVYHFDLYRF 159

Query: 91  SSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +   E  + GF E  N   IC++EWP+   +LL    +   L     GR  T+ A
Sbjct: 160 NDPAEWSDAGFREYFNSSAICLVEWPQQAGTLLGVPDLVFSLDVDGDGRALTVRA 214


>gi|161523914|ref|YP_001578926.1| hypothetical protein Bmul_0734 [Burkholderia multivorans ATCC
           17616]
 gi|189351325|ref|YP_001946953.1| putative hydrolase [Burkholderia multivorans ATCC 17616]
 gi|221211423|ref|ZP_03584402.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|160341343|gb|ABX14429.1| protein of unknown function UPF0079 [Burkholderia multivorans ATCC
           17616]
 gi|189335347|dbj|BAG44417.1| putative hydrolase [Burkholderia multivorans ATCC 17616]
 gi|221168784|gb|EEE01252.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
          Length = 184

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 61/115 (53%), Gaps = 8/115 (6%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRL 90
           + L GDLG+GK+ L R+I+R L H     V SPT+TLV+ Y     D  + V HFD YR 
Sbjct: 60  IQLVGDLGAGKTTLVRAILRGLGHRG--RVRSPTYTLVEPYALERDDGELEVYHFDLYRF 117

Query: 91  SSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +   E  + GF E  N   IC++EWP+   +LL    +   L     GR  T+ A
Sbjct: 118 NDPAEWSDAGFREYFNSSAICLVEWPQQAGTLLGVPDLVFSLDVDGDGRALTVRA 172


>gi|325697648|gb|EGD39533.1| ATP/GTP hydrolase [Streptococcus sanguinis SK160]
          Length = 146

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 73/131 (55%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L  +LR GD L L+GDLG+GK+   + +   L     ++  SPT+T+V+
Sbjct: 5   NEEELIQWGQRLGKLLRAGDVLVLTGDLGAGKTTFTKGLALGLGISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y   +P+ H D YR+    + ++L  D +  E + +IEW E+    LP  Y+ ++L + 
Sbjct: 63  EYVGRLPLYHLDVYRIGDDPDSIDL-DDFLFGEGVTVIEWGELLGENLPDNYLKLNLLKK 121

Query: 135 KTGRKATISAE 145
           + GR+    A+
Sbjct: 122 EDGRELVFEAK 132


>gi|325928075|ref|ZP_08189288.1| hypothetical nucleotide-binding protein [Xanthomonas perforans
           91-118]
 gi|325541573|gb|EGD13102.1| hypothetical nucleotide-binding protein [Xanthomonas perforans
           91-118]
          Length = 166

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 70/128 (54%), Gaps = 13/128 (10%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  LG+ LA++      + L GDLG+GKS LAR+++R L     +   SPT+TLV+ Y
Sbjct: 12  QATETLGQALAAVRPASAVVQLHGDLGAGKSTLARALLRALGVTGPIR--SPTYTLVERY 69

Query: 77  DASIPVA------HFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIH 130
               P+A      H D YR+    E+  LG DE  +  + ++EWPE G  +LP   +D+ 
Sbjct: 70  ----PLATGDEAWHLDLYRIGHAGELDFLGLDEG-SASLWLVEWPERGAGVLPPVDLDVE 124

Query: 131 LSQGKTGR 138
           L+    GR
Sbjct: 125 LAVAGEGR 132


>gi|167585649|ref|ZP_02378037.1| hypothetical protein BuboB_09951 [Burkholderia ubonensis Bu]
          Length = 163

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 61/115 (53%), Gaps = 8/115 (6%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRL 90
           + L GDLG+GK+ L R+I+R L H     V SPT+TLV+ Y     D  + V HFD YR 
Sbjct: 39  IQLVGDLGAGKTSLVRAILRGLGHRG--RVRSPTYTLVEPYALERDDGELEVYHFDLYRF 96

Query: 91  SSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +   E  + GF E  N   IC++EWP+   +LL    +   L     GR  T+ A
Sbjct: 97  NDPAEWSDAGFREYFNSSAICLVEWPQQAGTLLGVPDLVFSLDVDGDGRALTVRA 151


>gi|254424355|ref|ZP_05038073.1| uncharacterised P-loop hydrolase UPF0079 [Synechococcus sp. PCC
           7335]
 gi|196191844|gb|EDX86808.1| uncharacterised P-loop hydrolase UPF0079 [Synechococcus sp. PCC
           7335]
          Length = 147

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 73/138 (52%), Gaps = 9/138 (6%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I +PN + T  LGR L   L  G  L L GDLGSGK+ L + +   L      E+ SPT
Sbjct: 2   IIELPNSQATQALGRSLGDQLPAGSILLLKGDLGSGKTTLVQGVGTSL---GIKEIDSPT 58

Query: 70  FTLVQLY-DASIPVAHFDFYRLSSHQE---VVELGFDEI-LNERICIIEWPEIGRSLLPK 124
           FTL+  Y    +P+ H D YRLS  +     +E  ++ I +   I  IEW E   S LP 
Sbjct: 59  FTLINEYTKGRVPLYHIDLYRLSVAEADSLYLETYWEGIEVEPGIVAIEWAE-RLSNLPP 117

Query: 125 KYIDIHLSQGKTGRKATI 142
           K I++ LS    GR+A+I
Sbjct: 118 KPIELELSYSDEGRQASI 135


>gi|319947595|ref|ZP_08021825.1| bifunctional ATP-binding protein/phosphotransferase [Streptococcus
           australis ATCC 700641]
 gi|319746283|gb|EFV98546.1| bifunctional ATP-binding protein/phosphotransferase [Streptococcus
           australis ATCC 700641]
          Length = 149

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 73/130 (56%), Gaps = 3/130 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  + LG+ L   L   D + L+GDLG+GK+   + + + L  D    + SPT+T+V+
Sbjct: 5   NEQELMALGKQLGQRLEKQDVVILTGDLGAGKTTFTKGLAQGL--DIRQMIKSPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + +IEW E+  + LP  Y+ + L + 
Sbjct: 63  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFLFGEGVTVIEWGELLETSLPAGYLKVELLKD 121

Query: 135 KTGRKATISA 144
             GR+  +SA
Sbjct: 122 GDGREIRLSA 131


>gi|184154851|ref|YP_001843191.1| hypothetical protein LAF_0375 [Lactobacillus fermentum IFO 3956]
 gi|227514418|ref|ZP_03944467.1| ATP-binding protein [Lactobacillus fermentum ATCC 14931]
 gi|260663119|ref|ZP_05864011.1| conserved hypothetical protein [Lactobacillus fermentum 28-3-CHN]
 gi|183226195|dbj|BAG26711.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956]
 gi|227087284|gb|EEI22596.1| ATP-binding protein [Lactobacillus fermentum ATCC 14931]
 gi|260552311|gb|EEX25362.1| conserved hypothetical protein [Lactobacillus fermentum 28-3-CHN]
          Length = 150

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 69/119 (57%), Gaps = 5/119 (4%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  LG+ +AS LR GD L L+GDLG+GK+   + + + L  D+ ++  SPTFT+++ Y
Sbjct: 10  EQTKELGQIIASGLRAGDVLVLNGDLGAGKTTFTKGLAKGLGIDEVIK--SPTFTIIREY 67

Query: 77  DAS-IPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQ 133
               +P+ H D YRL +     +LG DE  + + + ++EW +     LP  Y+ +  ++
Sbjct: 68  QGGRLPLYHMDVYRLENGG-AEDLGLDEYFDGDGVSVVEWAQFAADELPADYLALTFTR 125


>gi|172061523|ref|YP_001809175.1| hypothetical protein BamMC406_2481 [Burkholderia ambifaria MC40-6]
 gi|171994040|gb|ACB64959.1| protein of unknown function UPF0079 [Burkholderia ambifaria MC40-6]
          Length = 183

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 71/153 (46%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASILRL------------GDCLTLSGDLGSGKSFLARSIIRFL 57
           VI + +E  T   G   A  L              G  + L GDLG+GK+ L R+I+R L
Sbjct: 21  VIALADEAATEAFGARFAHALDAARGELARAHAFDGLQIQLIGDLGAGKTTLVRAILRGL 80

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICI 111
            H     V SPT+TLV+ Y     D  + V HFD YR +   E  + GF E  N   IC+
Sbjct: 81  GHPG--RVRSPTYTLVEPYAFARDDGELEVYHFDLYRFNDPAEWSDAGFREYFNSSAICL 138

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +EWP+   +LL    +   L     GR  T+ A
Sbjct: 139 VEWPQQAGTLLGVPDLVFSLDVDGDGRALTVRA 171


>gi|58582357|ref|YP_201373.1| hypothetical protein XOO2734 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624236|ref|YP_451608.1| hypothetical protein XOO_2579 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|58426951|gb|AAW75988.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84368176|dbj|BAE69334.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 166

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 69/127 (54%), Gaps = 5/127 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           + + T  LG+ LAS+      + L GDLG+GKS LAR+++R L     +   SPT+TLV+
Sbjct: 10  DAQTTETLGQALASLRPASAVVQLHGDLGAGKSTLARALLRALGVTGPIR--SPTYTLVE 67

Query: 75  LYDASI--PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y  S      H D YR+    E+  LG DE  +  + ++EWPE G  +LP   +++ L+
Sbjct: 68  RYPLSTGDEAWHLDLYRIGHAGELDFLGLDEG-SASLWLVEWPERGAGVLPPVDLNVELA 126

Query: 133 QGKTGRK 139
               GR 
Sbjct: 127 VAGEGRS 133


>gi|294670140|ref|ZP_06735065.1| P-loop hydrolase/phosphotransferase [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308067|gb|EFE49310.1| P-loop hydrolase/phosphotransferase [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 161

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 62/110 (56%), Gaps = 4/110 (3%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEV 96
           L G LG+GK+   RS++R L  + A  V SPT+ +V+ Y      + HFD YR S+ +E 
Sbjct: 35  LEGGLGAGKTTFTRSLLRALGFEGA--VKSPTYAIVESYPLPRFTLHHFDLYRFSAPEEW 92

Query: 97  VELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAE 145
            + G D++     +C+IEWP+ G +  P   + + L+    GR A +SA+
Sbjct: 93  EDAGLDDLTGGNTVCLIEWPQKGGNFTPPADLTLTLTHCANGRNAALSAQ 142


>gi|170698620|ref|ZP_02889688.1| protein of unknown function UPF0079 [Burkholderia ambifaria
           IOP40-10]
 gi|170136473|gb|EDT04733.1| protein of unknown function UPF0079 [Burkholderia ambifaria
           IOP40-10]
          Length = 183

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 71/153 (46%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASILRL------------GDCLTLSGDLGSGKSFLARSIIRFL 57
           VI + +E  T   G   A  L              G  + L GDLG+GK+ L R+I+R L
Sbjct: 21  VIALADEAATEAFGTRFAHALDAARGELARAHMFDGLQIQLIGDLGAGKTTLVRAILRGL 80

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICI 111
            H     V SPT+TLV+ Y     D  + V HFD YR +   E  + GF E  N   IC+
Sbjct: 81  GHPG--RVRSPTYTLVEPYAFARDDGELEVYHFDLYRFNDPAEWSDAGFREYFNSSAICL 138

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +EWP+   +LL    +   L     GR  T+ A
Sbjct: 139 VEWPQQAGTLLGVPDLVFSLDVDGDGRALTVRA 171


>gi|297182547|gb|ADI18708.1| predicted ATPase or kinase [uncultured Chloroflexi bacterium
           HF4000_28F02]
          Length = 181

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 70/137 (51%), Gaps = 3/137 (2%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           LGR +      GD + L+G+LG+GK+ L + I   L  +    V SPTF L+  +   + 
Sbjct: 18  LGRTIGENASAGDVILLTGELGAGKTCLTQGIALGLGIEGY--VRSPTFVLMTRHHGRLT 75

Query: 82  VAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKA 140
           + H D YR+    E  +LG DE +  + IC+IEW +    L P+  + IHL  G+     
Sbjct: 76  LHHVDLYRMGCAAEAWDLGLDEQLFGDGICVIEWADRATELFPEDCLWIHLDYGQDPETR 135

Query: 141 TISAERWIISHINQMNR 157
            I+ E  + +  ++ N+
Sbjct: 136 EITLEPGVETEYSRFNK 152


>gi|292670614|ref|ZP_06604040.1| nucleotide-binding protein [Selenomonas noxia ATCC 43541]
 gi|292647780|gb|EFF65752.1| nucleotide-binding protein [Selenomonas noxia ATCC 43541]
          Length = 158

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 77/146 (52%), Gaps = 9/146 (6%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  L   +  I+  G  + L G+LG GK+   R++ R L  +   +V SPTF L+ +Y
Sbjct: 10  EETAHLAGTIGKIIHEGTVICLDGELGVGKTLFVRALARTLGVES--DVTSPTFNLMNIY 67

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEI--LNERICIIEWPEIGRSLLPKKYIDIHLSQ- 133
           +   P+ HFD YR++S +E+ ++GF E    +E I +IEW E     +P+  + + +   
Sbjct: 68  EGVCPIVHFDLYRIASEEELEDIGFYEYAEASEGIILIEWAEKFPDAMPEDRLQVRIDAL 127

Query: 134 GKTGRKATISAE----RWIISHINQM 155
               R+ T +AE    R ++  +N +
Sbjct: 128 DGEDRQFTFAAEGEKSRCLLGELNNI 153


>gi|300088224|ref|YP_003758746.1| hypothetical protein Dehly_1127 [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527957|gb|ADJ26425.1| protein of unknown function UPF0079 [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 159

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 72/135 (53%), Gaps = 8/135 (5%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
            T  LG  L  IL  GD L L+G LG+GK+ L + I R L    + EV+SPTF L++   
Sbjct: 13  GTRRLGYLLGEILEPGDVLFLTGPLGAGKTTLTQGIARGL--GISAEVMSPTFVLMRELQ 70

Query: 78  ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKK----YIDIHLS 132
             + + H D YRL    E+ +LG D+    + + ++EW +   +LLP++     ID H  
Sbjct: 71  GRLALYHIDLYRLDDLSEIADLGLDDYFYGDGVTVVEWADRAEALLPEERLAIVIDYHGE 130

Query: 133 QGKTGRKATISAERW 147
           Q ++  K +   ER+
Sbjct: 131 QSRS-FKHSARGERY 144


>gi|115352661|ref|YP_774500.1| hypothetical protein Bamb_2610 [Burkholderia ambifaria AMMD]
 gi|115282649|gb|ABI88166.1| protein of unknown function UPF0079 [Burkholderia ambifaria AMMD]
          Length = 198

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 71/153 (46%), Gaps = 20/153 (13%)

Query: 10  VIPIPNEKNTICLGRHLASILRL------------GDCLTLSGDLGSGKSFLARSIIRFL 57
           VI + +E  T   G   A  L              G  + L GDLG+GK+ L R+I+R L
Sbjct: 36  VIALADEAATEAFGTRFAHALDAARGELARAHAFDGLQIQLIGDLGAGKTTLVRAILRGL 95

Query: 58  MHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICI 111
            H     V SPT+TLV+ Y     D  + V HFD YR +   E  + GF E  N   IC+
Sbjct: 96  GHPG--RVRSPTYTLVEPYAFARDDGELEVYHFDLYRFNDPAEWSDAGFREYFNSSAICL 153

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
           +EWP+   +LL    +   L     GR  T+ A
Sbjct: 154 VEWPQQAGTLLGVPDLVFSLDVDGDGRALTVRA 186


>gi|78048160|ref|YP_364335.1| hypothetical protein XCV2604 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78036590|emb|CAJ24281.1| conserved hypothetical protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 173

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 70/128 (54%), Gaps = 13/128 (10%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  LG+ LA++      + L GDLG+GKS LAR+++R L     +   SPT+TLV+ Y
Sbjct: 12  QATETLGQALAAVRPASAVVQLHGDLGAGKSTLARALLRALGVTGPIR--SPTYTLVERY 69

Query: 77  DASIPVA------HFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIH 130
               P+A      H D YR+    E+  LG DE  +  + ++EWPE G  +LP   +D+ 
Sbjct: 70  ----PLATGDEAWHLDLYRIGHAGELDFLGLDEG-SASLWLVEWPERGAGVLPPVDLDVE 124

Query: 131 LSQGKTGR 138
           L+    GR
Sbjct: 125 LAVAGEGR 132


>gi|322514991|ref|ZP_08068003.1| ATPase with strong ADP affinity [Actinobacillus ureae ATCC 25976]
 gi|322119044|gb|EFX91208.1| ATPase with strong ADP affinity [Actinobacillus ureae ATCC 25976]
          Length = 163

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 73/140 (52%), Gaps = 12/140 (8%)

Query: 13  IPNEKNTICLGRHLASILR--------LGDCLTLSGDLGSGKSFLARSIIRFLMHDDALE 64
            P E+  +  G+ LA  ++            + L+G+LG+GK+ L RSI+R   H     
Sbjct: 9   FPTEQQMLQFGQTLAKHMQAYLNRSPQYALVVYLNGELGAGKTTLTRSIVREFGHIG--N 66

Query: 65  VLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLL 122
           V SPT+TLV+ Y      + HFD YRLS  +E+  +G  D    + +C++EW   G+ ++
Sbjct: 67  VKSPTYTLVEEYQLPPYAIYHFDLYRLSDPEELEFMGIRDYFRPQTVCLLEWASRGKGMI 126

Query: 123 PKKYIDIHLSQGKTGRKATI 142
           P+  I I +   + GR  T+
Sbjct: 127 PEADIIIQIDYAEEGRNITL 146


>gi|317121115|ref|YP_004101118.1| hypothetical protein Tmar_0266 [Thermaerobacter marianensis DSM
           12885]
 gi|315591095|gb|ADU50391.1| Uncharacterized protein family UPF0079, ATPase [Thermaerobacter
           marianensis DSM 12885]
          Length = 197

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 70/137 (51%), Gaps = 9/137 (6%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           IP+ +    LG  LA+ L+ GD + L+G LG+GK+ L R + R L       V SPTFTL
Sbjct: 10  IPSAEAMERLGERLAAALQPGDWIALTGPLGAGKTTLVRGLARGLGFRG--RVASPTFTL 67

Query: 73  VQLYDASIPVAHFDFYRLSSH---QEVVELGFDEILNERICIIEWPEIGRSLLPKK--YI 127
           V +Y   +P+ H D YRL      ++VV+ G  E+      ++EW +     +P    ++
Sbjct: 68  VHVYRGRLPLYHLDLYRLEGEDALRDVVDPG--EMEAAGAVVVEWADRAPRWIPADALWL 125

Query: 128 DIHLSQGKTGRKATISA 144
           D+ +     GR+    A
Sbjct: 126 DLAVDPAGDGRRVAARA 142


>gi|197122769|ref|YP_002134720.1| hypothetical protein AnaeK_2364 [Anaeromyxobacter sp. K]
 gi|196172618|gb|ACG73591.1| protein of unknown function UPF0079 [Anaeromyxobacter sp. K]
          Length = 183

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 60/115 (52%), Gaps = 2/115 (1%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           T  LG  L  +LR GD + L GDLG+GK+ L R       +    EV SPTF +V  Y  
Sbjct: 21  TRRLGARLGGLLRPGDVVALEGDLGAGKTQLVRGACEG-ANVPPGEVSSPTFAIVATYGG 79

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
            IPV H D YR++   E+   GF +++  E   ++EW +     LP + + + LS
Sbjct: 80  RIPVHHADLYRIADEDELYGTGFGDLVGGEGALLVEWADRIPGALPAERLTLRLS 134


>gi|260891153|ref|ZP_05902416.1| P-loop hydrolase family protein [Leptotrichia hofstadii F0254]
 gi|260859180|gb|EEX73680.1| P-loop hydrolase family protein [Leptotrichia hofstadii F0254]
          Length = 150

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 65/115 (56%), Gaps = 5/115 (4%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-I 80
           L + LA  L+ G CL L GDLG+GK+   + I     ++    V SPTFT V  Y +  +
Sbjct: 14  LAKKLAEKLKNGGCLGLIGDLGAGKTTFTKKICE--CYNVTENVKSPTFTYVIEYSSGDV 71

Query: 81  PVAHFDFYRLSSHQEVVELGFDEILNE--RICIIEWPEIGRSLLPKKYIDIHLSQ 133
           PV HFD YR++  +E+ E+GF++ + E   + IIEW +     +P+  + + ++ 
Sbjct: 72  PVYHFDVYRINDSEEIYEIGFEDYIGEDGSVVIIEWADKILEEMPEDAVFVEINH 126


>gi|227432022|ref|ZP_03914041.1| ATP-binding protein [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
 gi|227352220|gb|EEJ42427.1| ATP-binding protein [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
          Length = 149

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 68/131 (51%), Gaps = 5/131 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N + T  L   +AS +  G  +TL+GDLG+GK+   +   R L       V SPTF ++ 
Sbjct: 8   NFEQTQSLASRIASFVYPGLVITLNGDLGAGKTTFTQGFSRALGVKS--RVKSPTFNIMN 65

Query: 75  LYDA-SIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y A   P+ HFD YRL         GF++ +  + + +IEWP+    LLP   +DI  +
Sbjct: 66  TYTARDFPIYHFDAYRLE-MTGAANQGFEDFIGTDGVTLIEWPQYMNDLLPNNRLDITFT 124

Query: 133 QGKTGRKATIS 143
           +G+   + TIS
Sbjct: 125 RGEDDNERTIS 135


>gi|85058311|ref|YP_454013.1| hypothetical protein SG0333 [Sodalis glossinidius str. 'morsitans']
 gi|84778831|dbj|BAE73608.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 161

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 75/133 (56%), Gaps = 8/133 (6%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VIP+P+E  T+ LG  +A+  R    + L GDLG+GK+   R  +R L H     V SPT
Sbjct: 5   VIPLPDETATVALGAAVAAACRQACVIYLYGDLGAGKTTFCRGFLRALGH--VGNVKSPT 62

Query: 70  FTLVQLYDASIP---VAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKK 125
           +TLV+ Y  ++P   V HFD YRL+  +E+  +G  +  ++  +C++EWP+ G  +LP  
Sbjct: 63  YTLVEPY--ALPRWTVYHFDLYRLADPEELEFMGVRDYFDDTALCLVEWPQRGEDVLPAA 120

Query: 126 YIDIHLSQGKTGR 138
            I + L      R
Sbjct: 121 DITLTLQYQGDAR 133


>gi|325688723|gb|EGD30732.1| ATP/GTP hydrolase [Streptococcus sanguinis SK115]
          Length = 146

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 73/131 (55%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L  +L+ GD L L+GDLG+GK+   + +   L     ++  SPT+T+V+
Sbjct: 5   NEEELIQWGQRLGKLLQAGDVLVLTGDLGAGKTTFTKGLALGLGISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + +IEW E+    LP  Y+ + L + 
Sbjct: 63  EYEGRLPLYHLDVYRVGDDPDSIDL-DDFLFGEGVTVIEWGELLGENLPDNYLKLSLLKK 121

Query: 135 KTGRKATISAE 145
           + GR+    A+
Sbjct: 122 EDGRELVFEAQ 132


>gi|320547953|ref|ZP_08042235.1| ATP/GTP hydrolase [Streptococcus equinus ATCC 9812]
 gi|320447377|gb|EFW88138.1| ATP/GTP hydrolase [Streptococcus equinus ATCC 9812]
          Length = 165

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 70/125 (56%), Gaps = 3/125 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE   +  G  L   L+ GD L L+G+LG+GK+ L + I + L  D    + SPT+T+V+
Sbjct: 24  NEDELMAYGYRLGQKLQAGDVLVLTGNLGAGKTTLTKGIAKGL--DINQMIKSPTYTIVR 81

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+ +  + ++L  D +  + + +IEW E+    L   Y+++ ++  
Sbjct: 82  EYEGRLPLYHLDVYRIGNDPDSIDLD-DFLYGDGVSVIEWGELLEEDLLGDYLEVVITPS 140

Query: 135 KTGRK 139
             GR+
Sbjct: 141 GDGRQ 145


>gi|312870271|ref|ZP_07730399.1| hydrolase, P-loop family [Lactobacillus oris PB013-T2-3]
 gi|311094155|gb|EFQ52471.1| hydrolase, P-loop family [Lactobacillus oris PB013-T2-3]
          Length = 152

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 70/128 (54%), Gaps = 5/128 (3%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +  + + + + TI LG+ + + L  GD L L GDLG+GK+   + + + L   D ++  S
Sbjct: 1   MQTVEMDSREATIALGKAIGAQLAAGDVLVLDGDLGAGKTTFTKGLAQGLAIPDIIK--S 58

Query: 68  PTFTLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKK 125
           PTFT++  Y D  +P+ H D YRL +     +LG +E  + + + ++EW E     LP  
Sbjct: 59  PTFTIIHEYHDGRLPLYHMDAYRLENGGG-EDLGLEEYFDSDGVSVVEWAEFVEDELPDD 117

Query: 126 YIDIHLSQ 133
           ++ IH  +
Sbjct: 118 FLAIHFKR 125


>gi|332366418|gb|EGJ44169.1| ATP/GTP hydrolase [Streptococcus sanguinis SK355]
          Length = 146

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 74/131 (56%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L  +L+ GD L L+GDLG+GK+   + +   L     ++  SPT+T+V+
Sbjct: 5   NEEELIQWGQRLGKLLQAGDVLVLTGDLGAGKTTFTKGLALGLGISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + +IEW E+    LP+ Y+ + L + 
Sbjct: 63  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFLFGEGVTVIEWGELLGENLPEDYLKLGLLKK 121

Query: 135 KTGRKATISAE 145
           + GR+    A+
Sbjct: 122 EDGRELVFEAK 132


>gi|319942519|ref|ZP_08016829.1| TriP hydrolase domain-containing protein [Sutterella wadsworthensis
           3_1_45B]
 gi|319803922|gb|EFW00840.1| TriP hydrolase domain-containing protein [Sutterella wadsworthensis
           3_1_45B]
          Length = 172

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 74/153 (48%), Gaps = 14/153 (9%)

Query: 4   SEKHLTVIPIPNEKNTICLGRHLASIL----------RLGDCLTLSGDLGSGKSFLARSI 53
           S   L  + +P   +T  LG  LA +L            G  + L GDLG+GK+ L R++
Sbjct: 2   STPSLFTVELPLPDDTDRLGAALADVLIALRPQIDASESGLAMRLEGDLGAGKTSLVRAM 61

Query: 54  IRFLMHDDALEVLSPTFTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNE-RICI 111
           +R L    A  V SPTFTL++ Y+A  + V HFDFYR  + +E  + GF ++     +C 
Sbjct: 62  LRRLGWTGA--VKSPTFTLLETYEAGGLKVNHFDFYRFETPEEFEDAGFADLYAAGTVCA 119

Query: 112 IEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
            EW       +P   + + L+    GR   + A
Sbjct: 120 SEWSSKAAPFVPAADLTVSLAVEGYGRAVQVEA 152


>gi|163816078|ref|ZP_02207448.1| hypothetical protein COPEUT_02258 [Coprococcus eutactus ATCC 27759]
 gi|158448888|gb|EDP25883.1| hypothetical protein COPEUT_02258 [Coprococcus eutactus ATCC 27759]
          Length = 145

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 8/140 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +I   + + T  +G  L      G    + GDLG GK+ +++ +   L   +   V SPT
Sbjct: 2   IIESNSREETYKVGIQLGKDAVSGQVYCIYGDLGVGKTIISQGVAAGLGITEV--VNSPT 59

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKY- 126
           FT+V+ YD   +P+ HFD YR+    E+ E+G++E I  E +C+IEW  +   +LP  Y 
Sbjct: 60  FTIVKEYDEGRLPLYHFDVYRIGDVDEMDEVGYNEMIYGEGVCLIEWANLIEEILPDDYT 119

Query: 127 -IDIH--LSQGKTGRKATIS 143
            IDI   L++G   R+ TI 
Sbjct: 120 RIDIEKDLNKGLDYRRITIE 139


>gi|295093724|emb|CBK82815.1| conserved hypothetical nucleotide-binding protein [Coprococcus sp.
           ART55/1]
          Length = 145

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 75/140 (53%), Gaps = 8/140 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           VI   +++ T   G  L      G    + GDLG GK+ +++ +   L   +   V SPT
Sbjct: 2   VIESNSKEETYNAGVQLGQNAAPGQVYCIYGDLGVGKTIISQGVAAGLGITEV--VNSPT 59

Query: 70  FTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKY- 126
           FT+V+ YD   +P+ HFD YR+    E+ E+G++E++  + +C+IEW  +   +LP  Y 
Sbjct: 60  FTIVKEYDEGRLPLYHFDVYRIGDVDEMDEIGYNEMVYGDGVCLIEWANLIEEILPGTYT 119

Query: 127 ---IDIHLSQGKTGRKATIS 143
              I+  LS+G   R+ TI 
Sbjct: 120 RINIEKDLSKGLDYRRITIE 139


>gi|172038981|ref|YP_001805482.1| putative ATPase, cell wall biosynthesis [Cyanothece sp. ATCC 51142]
 gi|171700435|gb|ACB53416.1| putative ATPase, cell wall biosynthesis [Cyanothece sp. ATCC 51142]
          Length = 156

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 55/139 (39%), Positives = 75/139 (53%), Gaps = 15/139 (10%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFL-MHDDALEVLSPTFT 71
           +PN + T  LG+ L   L  G  L L GDLG+GK+ L + I   L +HD    ++SPTFT
Sbjct: 10  LPNFEATKALGKKLGQNLPKGSVLLLKGDLGAGKTTLVQGIGEGLGIHDP---IVSPTFT 66

Query: 72  LVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILNE-----RICIIEWPEIGRSLLPKK 125
           L+  Y +  +P+ H D YRL     V EL  ++   E      I  IEWPE   S LP  
Sbjct: 67  LINEYQEGRLPLYHLDLYRLEP-DAVSELYLEQYWEEGERLPGITAIEWPE-KLSYLPLN 124

Query: 126 YIDIHLS--QGKTGRKATI 142
           Y++I LS  +G TGR+  +
Sbjct: 125 YLEIQLSYIEG-TGRQVIL 142


>gi|16331109|ref|NP_441837.1| hypothetical protein sll0257 [Synechocystis sp. PCC 6803]
 gi|6226350|sp|P74415|Y257_SYNY3 RecName: Full=UPF0079 ATP-binding protein sll0257
 gi|1653602|dbj|BAA18515.1| sll0257 [Synechocystis sp. PCC 6803]
          Length = 157

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 74/144 (51%), Gaps = 12/144 (8%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+   T   G+ LA  L LG  + L GDLG+GK+ L + + R L      E++SPTFT+
Sbjct: 10  LPDLNATDQWGQQLAQQLPLGTIILLQGDLGAGKTSLVQGLGRGLGITG--EIVSPTFTI 67

Query: 73  VQLY-DASIPVAHFDFYRLSS------HQEVVELGFDEILNERICIIEWPEIGRSLLPKK 125
           V  Y +  +P+ H D YRL++      + E    G D  L   I  +EWPE     LP +
Sbjct: 68  VNEYREGKMPLYHLDLYRLNTLEVEYLYPEQYWQGEDFPLG--ITAVEWPER-LPQLPSQ 124

Query: 126 YIDIHLSQGKTGRKATISAERWII 149
           Y+ I L     GR   ++A+ W +
Sbjct: 125 YLQIQLCHQGEGRSIALTAQDWAM 148


>gi|291542704|emb|CBL15814.1| conserved hypothetical nucleotide-binding protein [Ruminococcus
           bromii L2-63]
          Length = 140

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 60/115 (52%), Gaps = 2/115 (1%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           +G  +A  L   + + L G LG GK+   R + R L  DD   V SPTF LV  Y     
Sbjct: 15  IGEKIAKKLHGSEVIALFGGLGMGKTAFTRGLARALGVDDG--VSSPTFALVNEYSGKYN 72

Query: 82  VAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKT 136
           + HFD YR++S  ++   GF + ++  I +IEW E     LP+  I I + +G++
Sbjct: 73  IYHFDMYRVNSWDDLYSTGFFDYIDNGILVIEWSENIEGALPENAIRITIEKGES 127


>gi|23098100|ref|NP_691566.1| hypothetical protein OB0645 [Oceanobacillus iheyensis HTE831]
 gi|22776325|dbj|BAC12601.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831]
          Length = 149

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 7/131 (5%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I + + + T   G  LA  LR GD +TL G LGSGK+   + I   L  +    + SPTF
Sbjct: 3   IQLGSPEETKSFGERLAKSLRPGDVITLEGQLGSGKTTFTKGIASGL--EVKRHITSPTF 60

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLP--KKYI 127
           T+V+ Y   +P+ H D YRL    E  ++GFDE  +   + ++EW       LP  +  I
Sbjct: 61  TIVKEYRGKMPLYHMDVYRLEDSLE--DIGFDEYFHGNGVSVVEWAGFIEPFLPVDRLEI 118

Query: 128 DIHLSQGKTGR 138
            IH ++ K  R
Sbjct: 119 SIHYTENKDMR 129


>gi|229083537|ref|ZP_04215872.1| ATP/GTP hydrolase [Bacillus cereus Rock3-44]
 gi|228699769|gb|EEL52419.1| ATP/GTP hydrolase [Bacillus cereus Rock3-44]
          Length = 151

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 8/136 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  L   L  +++  D L L GDLG+GK+   + + R L       V SPTF +++ Y
Sbjct: 6   EETQNLSEKLGQLVKAQDVLILEGDLGAGKTTFTKGLARGLGVKRV--VNSPTFNIIKEY 63

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL-SQG 134
              +P+ H D YRL+  +E  +LGFDE    E + ++EW  +  + LP + + I L   G
Sbjct: 64  KGRLPLYHMDVYRLAESEE--DLGFDEYFYGEGVTVVEWAHLIEAFLPNEKLKISLFHTG 121

Query: 135 KTGRKATI--SAERWI 148
              R+  +  S ER+I
Sbjct: 122 DDTRRIVLEPSGERYI 137


>gi|227545080|ref|ZP_03975129.1| ATP-binding protein [Lactobacillus reuteri CF48-3A]
 gi|300909250|ref|ZP_07126711.1| ATP/GTP hydrolase [Lactobacillus reuteri SD2112]
 gi|227184929|gb|EEI65000.1| ATP-binding protein [Lactobacillus reuteri CF48-3A]
 gi|300893115|gb|EFK86474.1| ATP/GTP hydrolase [Lactobacillus reuteri SD2112]
          Length = 159

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 69/133 (51%), Gaps = 7/133 (5%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + + N   TI LG+ +   L  GD L L GDLG+GK+   + +   L   D ++  SPTF
Sbjct: 4   LTLTNRDATIALGKKIGQQLVAGDVLVLDGDLGAGKTTFTKGLAAGLEIPDIIK--SPTF 61

Query: 71  TLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYID 128
           T++  Y D  +P+ H D YRL +     +LG +E  + + + ++EW E     LP  ++ 
Sbjct: 62  TIIHEYQDGRLPLYHMDAYRLENGG-AEDLGLEEYFDGDGVSVVEWAEFVEDELPADFLA 120

Query: 129 IHLSQGKTGRKAT 141
           IH    +TG   T
Sbjct: 121 IHFK--RTGDDNT 131


>gi|226326654|ref|ZP_03802172.1| hypothetical protein PROPEN_00504 [Proteus penneri ATCC 35198]
 gi|225204875|gb|EEG87229.1| hypothetical protein PROPEN_00504 [Proteus penneri ATCC 35198]
          Length = 122

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 66/115 (57%), Gaps = 5/115 (4%)

Query: 10  VIPIPNEKNTICLGRHLA-SILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           V+ + +E  T+ LGR +A +    G  + L GDLG+GK+  +R  ++ L H     V SP
Sbjct: 5   VVTLEDEAATVELGRTVAMATEHHGLIIYLYGDLGAGKTTFSRGFLQALGHQG--HVKSP 62

Query: 69  TFTLVQLYDASI-PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSL 121
           T+TLV+ Y  S  PV HFD YRL+S +E+  +G  D    + +C+IEWP  G   
Sbjct: 63  TYTLVEPYMLSPNPVYHFDLYRLASAEELEFMGIRDYFEQDALCLIEWPSQGEGF 117


>gi|325686975|gb|EGD28999.1| ATP/GTP hydrolase [Streptococcus sanguinis SK72]
          Length = 146

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 74/131 (56%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L  +LR GD L L+GDLG+GK+   + +   L     ++  SPT+T+V+
Sbjct: 5   NEEELIQWGQCLGKLLRAGDTLVLTGDLGAGKTTFTKGLALGLGISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + +IEW E+    LP+ Y+ + L + 
Sbjct: 63  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFLFGEGVTVIEWGELLGENLPEDYLKLSLLKM 121

Query: 135 KTGRKATISAE 145
           + GR+    A+
Sbjct: 122 EDGRELVFEAK 132


>gi|207721737|ref|YP_002252176.1| atpase or kinase protein [Ralstonia solanacearum MolK2]
 gi|207742500|ref|YP_002258892.1| atpase or kinase protein [Ralstonia solanacearum IPO1609]
 gi|206586900|emb|CAQ17485.1| atpase or kinase protein [Ralstonia solanacearum MolK2]
 gi|206593891|emb|CAQ60818.1| atpase or kinase protein [Ralstonia solanacearum IPO1609]
          Length = 192

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 61/101 (60%), Gaps = 10/101 (9%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-----ASIPVAHFDFYRLSS 92
           LSGDLG+GK+ L+R+I+  L H     V SPT+TLV+ YD      ++ V HFD YR   
Sbjct: 56  LSGDLGAGKTTLSRAILHGLGHTG--RVRSPTYTLVEPYDVPGTSGTLKVYHFDLYRFVD 113

Query: 93  HQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHLS 132
            +E  + GF +   E  +C++EWPE  ++LL     D+H++
Sbjct: 114 PEEWTDAGFRDCFAEPALCLVEWPEKAQALL--GTPDLHIA 152


>gi|224370651|ref|YP_002604815.1| hypothetical protein HRM2_35860 [Desulfobacterium autotrophicum
           HRM2]
 gi|223693368|gb|ACN16651.1| conserved hypothetical protein [Desulfobacterium autotrophicum
           HRM2]
          Length = 154

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 65/112 (58%), Gaps = 2/112 (1%)

Query: 7   HLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
            LT+I   + + T+ LG  L  +L  G  ++L+G LG+GK+   + + + L    +  V 
Sbjct: 2   ELTIIS-RSGRQTLGLGEKLGRLLDRGITISLTGGLGAGKTTFVKGLAKGLEVPASFYVT 60

Query: 67  SPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEI 117
           SPT+T++  Y   + + H D YRL S  E+  +GF E++  +R+ +IEWP+I
Sbjct: 61  SPTYTIMNEYPGRLDLCHMDLYRLGSSDELDYIGFYEMITLDRVTVIEWPQI 112


>gi|322373932|ref|ZP_08048467.1| ATP/GTP hydrolase [Streptococcus sp. C150]
 gi|321277304|gb|EFX54374.1| ATP/GTP hydrolase [Streptococcus sp. C150]
          Length = 147

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 75/130 (57%), Gaps = 3/130 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I +G+++ S+L  GD + LSGDLG+GK+ L + I + L     ++  SPT+T+V+
Sbjct: 6   NEEELISIGQNIGSLLNSGDIIVLSGDLGAGKTTLTKGIAKGLNISQMIK--SPTYTIVR 63

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  + + IIEW E+    L   Y+ I ++  
Sbjct: 64  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFLYGDGVTIIEWGELLDEDLLGDYLLISIAHH 122

Query: 135 KTGRKATISA 144
             GR+ T  A
Sbjct: 123 GDGRQLTFEA 132


>gi|228476591|ref|ZP_04061273.1| conserved hypothetical protein [Streptococcus salivarius SK126]
 gi|228251786|gb|EEK10851.1| conserved hypothetical protein [Streptococcus salivarius SK126]
          Length = 147

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 72/125 (57%), Gaps = 3/125 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I +G+ L  +L  GD + LSGDLG+GK+ L + I + L  D +  + SPT+T+V+
Sbjct: 6   NEEELISIGQKLGRLLDSGDIIVLSGDLGAGKTTLTKGIAKGL--DISQMIKSPTYTIVR 63

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + IIEW E+    L   Y+ I +S  
Sbjct: 64  EYEGRVPLYHLDVYRIGDDPDSIDL-DDFLYGEGVTIIEWGELLDESLLGDYLLISISHH 122

Query: 135 KTGRK 139
             GR+
Sbjct: 123 GDGRQ 127


>gi|332358002|gb|EGJ35835.1| ATP/GTP hydrolase [Streptococcus sanguinis SK1056]
          Length = 146

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 74/131 (56%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L  +LR GD L L+GDLG+GK+   + +   L     ++  SPT+T+V+
Sbjct: 5   NEEELIQWGQCLGKLLRAGDILVLTGDLGAGKTTFTKGLALGLGISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + +IEW E+    LP+ Y+ + L + 
Sbjct: 63  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFLFGEGVTVIEWGELLGENLPEDYLKLSLLKM 121

Query: 135 KTGRKATISAE 145
           + GR+    A+
Sbjct: 122 EDGRELVFEAK 132


>gi|322377174|ref|ZP_08051666.1| ATP/GTP hydrolase [Streptococcus sp. M334]
 gi|321281887|gb|EFX58895.1| ATP/GTP hydrolase [Streptococcus sp. M334]
          Length = 147

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 71/132 (53%), Gaps = 5/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+    LG  L  +L   D L L+G+LG+GK+   + + + L     ++  SPT+T+V+
Sbjct: 5   NEEELQALGERLGHLLEKNDVLILTGELGAGKTTFTKGLAKGLQISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE L    + +IEW  +    LP  Y+++ + +
Sbjct: 63  EYEGRLPLYHLDVYRIEGDADSIDL--DEFLFGGGVTVIEWGNLLGDALPDTYLELEILK 120

Query: 134 GKTGRKATISAE 145
            + GR+    A+
Sbjct: 121 EEDGRRLNFQAK 132


>gi|330719281|ref|ZP_08313881.1| ATPase or kinase [Leuconostoc fallax KCTC 3537]
          Length = 148

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 63/115 (54%), Gaps = 5/115 (4%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           K+T  L   +AS  + G  LTL+GDLG+GK+   + + R L    A  V SPTF ++  Y
Sbjct: 10  KDTQTLASQIASYTQPGMILTLTGDLGAGKTTFTQGMAREL--GVASRVKSPTFNILNTY 67

Query: 77  DAS-IPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDI 129
             +  P+ HFD YRL       + GF D I  + + IIEWP+  R LLP   +++
Sbjct: 68  QGTDFPIYHFDAYRL-EMTGAADQGFEDYIGTDGLTIIEWPQFMRDLLPNDRVEL 121


>gi|307709971|ref|ZP_07646418.1| hypothetical protein SMSK564_0831 [Streptococcus mitis SK564]
 gi|307619342|gb|EFN98471.1| hypothetical protein SMSK564_0831 [Streptococcus mitis SK564]
          Length = 147

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 71/132 (53%), Gaps = 5/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+    LG  L  +L   D L L+G+LG+GK+   + + + L     ++  SPT+T+V+
Sbjct: 5   NEEELQALGERLGHLLEKNDVLILTGELGAGKTTFTKGLAKGLQISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE L    + +IEW  +    LP  Y+++ + +
Sbjct: 63  EYEGRLPLYHLDVYRIEGDADSIDL--DEFLFGGGVTVIEWGNLLGDALPDTYLELEILK 120

Query: 134 GKTGRKATISAE 145
            + GR+    A+
Sbjct: 121 EEDGRRLNFKAK 132


>gi|325265687|ref|ZP_08132376.1| P-loop hydrolase/phosphotransferase [Kingella denitrificans ATCC
           33394]
 gi|324982818|gb|EGC18441.1| P-loop hydrolase/phosphotransferase [Kingella denitrificans ATCC
           33394]
          Length = 149

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 68/132 (51%), Gaps = 4/132 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           +P+E  T+  G  LA  L     + L+G LG+GK+  AR +++ L +   ++  SPT+ +
Sbjct: 7   LPDEAATLAFGASLAGSLHAPLVIYLNGSLGAGKTTFARGLLKGLGYTGTVK--SPTYAI 64

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y      V HFD YR +  +E  + G D++     IC+IEW E G   +P   I + 
Sbjct: 65  VESYGLPQCTVHHFDLYRFAEPEEWHDAGLDDLTGAGCICLIEWAEKGGGNVPAADIYLD 124

Query: 131 LSQGKTGRKATI 142
            +    GR  T+
Sbjct: 125 FTAKDNGRCCTV 136


>gi|260888264|ref|ZP_05899527.1| hypothetical protein SELSPUOL_02125 [Selenomonas sputigena ATCC
           35185]
 gi|330838401|ref|YP_004412981.1| Uncharacterized protein family UPF0079, ATPase [Selenomonas
           sputigena ATCC 35185]
 gi|260861800|gb|EEX76300.1| hypothetical protein SELSPUOL_02125 [Selenomonas sputigena ATCC
           35185]
 gi|329746165|gb|AEB99521.1| Uncharacterized protein family UPF0079, ATPase [Selenomonas
           sputigena ATCC 35185]
          Length = 200

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 65/125 (52%), Gaps = 4/125 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           +   + + T  L   + ++   G    L+GDLG+GK+   + + R L      EV SPTF
Sbjct: 35  VETASPEETAALAERIGALCPAGTVFALAGDLGAGKTLFVQGLARGLGFSG--EVTSPTF 92

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILN--ERICIIEWPEIGRSLLPKKYID 128
            L+ +Y+  + + HFD YRL   +E+ ++GF E  +  E + ++EW +     +P  Y+ 
Sbjct: 93  NLMNVYEGKMRLTHFDVYRLERAEELYDIGFYEYADDSEGVVVVEWFDKFSEEMPADYVR 152

Query: 129 IHLSQ 133
           + + +
Sbjct: 153 VTIER 157


>gi|239623426|ref|ZP_04666457.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239522392|gb|EEQ62258.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 142

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 73/142 (51%), Gaps = 8/142 (5%)

Query: 8   LTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           +TV      + T  LGR +      G  + L+GDLG GK+   +     L  +    V S
Sbjct: 1   MTVFETWKPEETYELGRKMGEEAAPGQIVCLNGDLGVGKTVFTQGFAAGLGIEGP--VNS 58

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLP-- 123
           PTFT+VQ Y+   +P+ HFD YR+    E+ E+G+++    + +C+IEW  +   +LP  
Sbjct: 59  PTFTIVQQYEEGRLPLYHFDVYRIGDISEMEEIGYEDCFFGDGVCLIEWSGLIEEILPEH 118

Query: 124 --KKYIDIHLSQGKTGRKATIS 143
             K  I+ +L QG   R+ T+ 
Sbjct: 119 VVKVVIEKNLEQGFDYRRITVE 140


>gi|291562739|emb|CBL41555.1| conserved hypothetical nucleotide-binding protein
           [butyrate-producing bacterium SS3/4]
          Length = 141

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 71/133 (53%), Gaps = 8/133 (6%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T   G+ L    + G+ + L+GDLG GK+   +     L   +   V SPTFT+VQ Y
Sbjct: 9   EETFAFGKMLGEQAKPGEVICLNGDLGVGKTVFTKGFAEGLGITEP--VNSPTFTIVQQY 66

Query: 77  DAS-IPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKY----IDIH 130
           D+  +P+ HFD YR+    E+ E+G+++    E + +IEW  +   +LP+      I+ +
Sbjct: 67  DSGRMPLYHFDVYRIGDISEMDEVGYEDCFYGEGVTLIEWSNMIEEILPEHVKTVTIEKN 126

Query: 131 LSQGKTGRKATIS 143
           L +G   RK T+ 
Sbjct: 127 LEKGFDYRKITVE 139


>gi|239906426|ref|YP_002953167.1| hypothetical protein DMR_17900 [Desulfovibrio magneticus RS-1]
 gi|239796292|dbj|BAH75281.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 169

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 69/137 (50%), Gaps = 5/137 (3%)

Query: 13  IPNEKNTICLGRHLASILR---LGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           +P+E  T+ LGR LA IL        L L GDLGSGK+ L R +   L   D  EV SP+
Sbjct: 11  LPDEAATLELGRILAEILANPATRAALLLRGDLGSGKTTLVRGLAGALPGGDEAEVASPS 70

Query: 70  FTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPE-IGRSLLPKKYI 127
           F +V +Y     V H D YR+      VE   +  L N+ + ++EW + + R+L P   +
Sbjct: 71  FNIVNVYPTRPEVFHVDLYRIPGGDPCVEEHLEAALENQAVAVVEWAQHLSRALAPPDRL 130

Query: 128 DIHLSQGKTGRKATISA 144
           +       +GR   ++A
Sbjct: 131 ECDWLPVPSGRLCELTA 147


>gi|312128421|ref|YP_003993295.1| hypothetical protein Calhy_2221 [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311778440|gb|ADQ07926.1| protein of unknown function UPF0079 [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 157

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 67/119 (56%), Gaps = 7/119 (5%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
            T+ +G  +   L  G  +TL GDLGSGK+ L R I +    +D   + SPTFT+  +Y+
Sbjct: 11  ETVSIGYKIGKNLFKGAIVTLEGDLGSGKTALTRGIAKAFGIED---ISSPTFTIFHVYE 67

Query: 78  A--SIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
               I V HFD YR+    E+ ++G++E    + I IIEW +  + L PK+Y+ + + +
Sbjct: 68  GKDGILVYHFDIYRI-EETELEDIGYEEYFYGDGIVIIEWADKLKRLHPKEYLKVEIQK 125


>gi|154685091|ref|YP_001420252.1| YdiB [Bacillus amyloliquefaciens FZB42]
 gi|154350942|gb|ABS73021.1| YdiB [Bacillus amyloliquefaciens FZB42]
          Length = 158

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 72/133 (54%), Gaps = 7/133 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N + T  + +  AS+ + GD LTL GDLG+GK+   +     L       V SPTFT+++
Sbjct: 10  NPEETKAVAKLAASLAKPGDILTLEGDLGAGKTTFTKGFAEGLGITRV--VNSPTFTIIK 67

Query: 75  LY-DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y D S+P+ H D YR+    E  +LG +E    + +C+IEW  + +  LP + + I ++
Sbjct: 68  EYHDGSLPLYHMDVYRMEDESE--DLGLEEYFEGQGVCLIEWAHLIQDQLPAERLQIVIT 125

Query: 133 Q-GKTGRKATISA 144
           + G   R  T +A
Sbjct: 126 RAGDEARDITFTA 138


>gi|300119520|ref|ZP_07057072.1| ATP/GTP hydrolase [Bacillus cereus SJ1]
 gi|298723110|gb|EFI64000.1| ATP/GTP hydrolase [Bacillus cereus SJ1]
          Length = 157

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 65/122 (53%), Gaps = 5/122 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I   + + T  L   L  ++R  D + L GDLG+GK+   + + + L       V SPTF
Sbjct: 6   ITTKSSEETQKLSEKLGELVRAQDVIILEGDLGAGKTTFTKGLAKGLGVKRV--VNSPTF 63

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDI 129
            +++ Y   +P+ H D YRL+  +E  +LGFDE    E I ++EW  +  + LPK+ + I
Sbjct: 64  NIIKEYKGRLPLYHMDVYRLAESEE--DLGFDEYFYGEGITVVEWAHLIEAYLPKEKLQI 121

Query: 130 HL 131
            L
Sbjct: 122 SL 123


>gi|332304703|ref|YP_004432554.1| hypothetical protein Glaag_0317 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172032|gb|AEE21286.1| Uncharacterized protein family UPF0079, ATPase [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 152

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + +E+ T  L   LA++      + L GDLG+GK+   R  I  L +     V SPT+TL
Sbjct: 7   LADEQATTELAAQLANLCNRATVIYLEGDLGAGKTSFCRGFIHGLGYKG--RVKSPTYTL 64

Query: 73  VQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIH 130
           V+ Y+  S  + HFD YRLS  +E+  +G  +  ++  IC+IEWP+ G  LL    + I 
Sbjct: 65  VEPYEIDSWRIFHFDLYRLSDPEELEFIGIRDYFDDDCICLIEWPDKGEGLLAGADLHIS 124

Query: 131 LSQGKTGRKATISA 144
           +   +  R  T+ A
Sbjct: 125 IEFIENSRSLTVQA 138


>gi|309799365|ref|ZP_07693608.1| conserved hypothetical protein [Streptococcus infantis SK1302]
 gi|308117032|gb|EFO54465.1| conserved hypothetical protein [Streptococcus infantis SK1302]
          Length = 163

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 69/127 (54%), Gaps = 5/127 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE   I LG  L  +L   D L L+G+LG+GK+ L + + + L  D    + SPT+T+V+
Sbjct: 21  NEDELIELGEKLGHLLEKNDVLILTGELGAGKTTLTKGLAKGL--DIHQMIKSPTYTIVR 78

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE L    + +IEW  +    LP  Y+++ + +
Sbjct: 79  EYEGRLPLYHLDVYRIEGDADSIDL--DEFLFGSGVTVIEWGHLLGEDLPADYLELEILK 136

Query: 134 GKTGRKA 140
              GR+ 
Sbjct: 137 DDEGREV 143


>gi|313903539|ref|ZP_07836929.1| uncharacterized protein family UPF0079, ATPase [Thermaerobacter
           subterraneus DSM 13965]
 gi|313466092|gb|EFR61616.1| uncharacterized protein family UPF0079, ATPase [Thermaerobacter
           subterraneus DSM 13965]
          Length = 161

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 71/140 (50%), Gaps = 7/140 (5%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
            + IP+ +    LG  LA+ L  GD + L+G LG+GK+ L R + R L +     V SPT
Sbjct: 6   TVTIPSAEAMERLGEGLAAALAPGDWIALTGPLGAGKTTLVRGLARGLGYRG--RVASPT 63

Query: 70  FTLVQLYDASIPVAHFDFYRLSSHQEVVELGFD--EILNERICIIEWPEIGRSLLPKKYI 127
           FTLV LY   +P+ H D YRL   + + ++  D  E+      ++EW +     +P   +
Sbjct: 64  FTLVHLYRGRLPLYHLDLYRLEGEEALRDV-VDPAEMEASGAVVVEWADRAPGWIPAGAL 122

Query: 128 DIHLS--QGKTGRKATISAE 145
            + L+      GR+ T  A+
Sbjct: 123 WLELAPLPAGEGRRVTARAQ 142


>gi|255994760|ref|ZP_05427895.1| ATP/GTP hydrolase [Eubacterium saphenum ATCC 49989]
 gi|255993473|gb|EEU03562.1| ATP/GTP hydrolase [Eubacterium saphenum ATCC 49989]
          Length = 154

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 66/132 (50%), Gaps = 4/132 (3%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
           +T  L   +A  L +GD + L GDLG+GK+   ++++  L  D+A  V+SPT+++V  Y 
Sbjct: 24  DTQKLATDIAKQLIIGDVVALKGDLGTGKTTFTKALLDTLGVDEA--VVSPTYSIVNTYR 81

Query: 78  AS-IPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQGK 135
                + HFD YRL    E  ++G DE  N E I IIEW E     LP   I + +    
Sbjct: 82  GDRCIINHFDVYRLHGSDEFYDIGGDEYFNDESISIIEWAEKIEDALPSDAIYLEMKYSD 141

Query: 136 TGRKATISAERW 147
              +   S   W
Sbjct: 142 DDNERICSCGYW 153


>gi|91762675|ref|ZP_01264640.1| possible cell division control protein 6 [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91718477|gb|EAS85127.1| possible cell division control protein 6 [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 152

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 5/125 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDAL---EVLS 67
           I I  E  T  L +  +  L+ GD     G++G GK+   R +I  L   + +   EV S
Sbjct: 10  IDISLEDKTSELAKSFSRTLQKGDVAYFHGEIGVGKTTFIRHLINNLQQLNKINLTEVTS 69

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKY 126
           PTF LV  YD  +  + H+D YRL+ + E+  +G  E   E + +IEWPE  +  +  K 
Sbjct: 70  PTFNLVNEYDVGNFIIQHYDLYRLTDYSEIKNIGLFENREEVVTLIEWPEKIKETIDSK- 128

Query: 127 IDIHL 131
           ID+H 
Sbjct: 129 IDLHF 133


>gi|88803202|ref|ZP_01118728.1| putative ATPase/GTPase [Polaribacter irgensii 23-P]
 gi|88780768|gb|EAR11947.1| putative ATPase/GTPase [Polaribacter irgensii 23-P]
          Length = 135

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 5/107 (4%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASI--PVAHFDFYRLSSH 93
           L   G++G GK+ L + I + L   DA+   SPT++LV  Y  S    V HFDFYR+++ 
Sbjct: 26  LLFYGEMGVGKTTLIKEICKQLKVTDAIS--SPTYSLVNEYQTSKGETVFHFDFYRITNE 83

Query: 94  QEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRK 139
            E +++G ++ L N   C+IEWP+   +LLP   + IHL+  ++G++
Sbjct: 84  IEALDMGIEDYLDNNHWCLIEWPQNIENLLPITAVKIHLTLLESGQR 130


>gi|116618625|ref|YP_818996.1| ATPase or kinase [Leuconostoc mesenteroides subsp. mesenteroides
           ATCC 8293]
 gi|116097472|gb|ABJ62623.1| Predicted ATPase or kinase [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
          Length = 149

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 68/131 (51%), Gaps = 5/131 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N + T  L   +AS +  G  +TL+GDLG+GK+   +   R L       V SPTF ++ 
Sbjct: 8   NFEQTQSLASRIASFVYPGLVITLNGDLGAGKTTFTQGFSRALGVKS--RVKSPTFNIMN 65

Query: 75  LYDA-SIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y A   P+ HFD YRL         GF++ +  + + +IEWP+    LLP   +DI  +
Sbjct: 66  TYMARDFPIYHFDAYRLE-MTGAANQGFEDFIGTDGVTLIEWPQYMNDLLPNNRLDITFT 124

Query: 133 QGKTGRKATIS 143
           +G+   + TIS
Sbjct: 125 RGEDDNERTIS 135


>gi|193213785|ref|YP_001994984.1| hypothetical protein Ctha_0066 [Chloroherpeton thalassium ATCC
           35110]
 gi|193087262|gb|ACF12537.1| protein of unknown function UPF0079 [Chloroherpeton thalassium ATCC
           35110]
          Length = 147

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 69/128 (53%), Gaps = 9/128 (7%)

Query: 24  RHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-----A 78
           R  A  L+ GD + L G LG+GK+   R I   + H  A  V SPTFTL+ +Y+     +
Sbjct: 17  REFAETLQRGDIVLLVGTLGAGKTEFVRGICD-VFHCTA-SVSSPTFTLLNIYEGVSKGS 74

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ-GKT 136
           +I + HFD YR+ S  E+  +GFDE L  + + I+EW +      PK+ I + +   G+ 
Sbjct: 75  AISLYHFDLYRIESETELPAIGFDEYLFGDGVSIVEWADRFPRFFPKQAITVQIEPCGEN 134

Query: 137 GRKATISA 144
            R+  IS 
Sbjct: 135 ERRVVISG 142


>gi|289207677|ref|YP_003459743.1| hypothetical protein TK90_0492 [Thioalkalivibrio sp. K90mix]
 gi|288943308|gb|ADC71007.1| protein of unknown function UPF0079 [Thioalkalivibrio sp. K90mix]
          Length = 155

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 69/124 (55%), Gaps = 5/124 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I +P+   T   G  LA +  L   + L GDLG+GK+  AR +++ L H  A  V SPT+
Sbjct: 5   IRLPDAAATERAGAVLAGMEGL-RIVYLEGDLGAGKTTWARGLLQALGH--AGNVRSPTY 61

Query: 71  TLVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYID 128
           TLV+ Y+     V HFD YRL+  +E+  LG  E   E+ + ++EWPE G   LP+  + 
Sbjct: 62  TLVEPYELQGRGVLHFDLYRLADPEELEYLGVREAFGEQALWLVEWPERGAGWLPEPDLR 121

Query: 129 IHLS 132
           + L 
Sbjct: 122 VRLE 125


>gi|148543635|ref|YP_001271005.1| hypothetical protein Lreu_0399 [Lactobacillus reuteri DSM 20016]
 gi|184153049|ref|YP_001841390.1| hypothetical protein LAR_0394 [Lactobacillus reuteri JCM 1112]
 gi|227363394|ref|ZP_03847520.1| ATP-binding protein [Lactobacillus reuteri MM2-3]
 gi|325681998|ref|ZP_08161516.1| ATP/GTP hydrolase [Lactobacillus reuteri MM4-1A]
 gi|148530669|gb|ABQ82668.1| protein of unknown function UPF0079 [Lactobacillus reuteri DSM
           20016]
 gi|183224393|dbj|BAG24910.1| conserved hypothetical protein [Lactobacillus reuteri JCM 1112]
 gi|227071583|gb|EEI09880.1| ATP-binding protein [Lactobacillus reuteri MM2-3]
 gi|324978642|gb|EGC15591.1| ATP/GTP hydrolase [Lactobacillus reuteri MM4-1A]
          Length = 152

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 66/125 (52%), Gaps = 5/125 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + + N   TI LG+ +   L  GD L L GDLG+GK+   + +   L   D ++  SPTF
Sbjct: 4   LTLTNRDATIALGKKIGQQLVAGDVLVLDGDLGAGKTTFTKGLAAGLEIPDIIK--SPTF 61

Query: 71  TLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYID 128
           T++  Y D  +P+ H D YRL +     +LG +E  + + + ++EW E     LP  ++ 
Sbjct: 62  TIIHEYQDGRLPLYHMDAYRLENGG-AEDLGLEEYFDGDGVSVVEWAEFVEDELPADFLA 120

Query: 129 IHLSQ 133
           IH  +
Sbjct: 121 IHFKR 125


>gi|261867648|ref|YP_003255570.1| hypothetical protein D11S_0963 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412980|gb|ACX82351.1| hypothetical protein D11S_0963 [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 150

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 74/127 (58%), Gaps = 8/127 (6%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLS 91
           G  L L+GDLG+GK+ L+R +I+ L +    +V SPT+TLV+ Y   +  V HFD YRL+
Sbjct: 20  GIALYLNGDLGAGKTTLSRGMIQALGYQG--KVKSPTYTLVEEYRFRNKTVYHFDLYRLA 77

Query: 92  SHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAE----R 146
             +E+  +G  +  +E  +C+IEW E G  +L    + ++++  +T R   + A+    R
Sbjct: 78  DPEELEFMGIRDYFSENTLCLIEWAEKGTGMLMAADLLVNIAYAETARHIELVAQSPIGR 137

Query: 147 WIISHIN 153
            II  +N
Sbjct: 138 QIIEQLN 144


>gi|194468193|ref|ZP_03074179.1| protein of unknown function UPF0079 [Lactobacillus reuteri 100-23]
 gi|194453046|gb|EDX41944.1| protein of unknown function UPF0079 [Lactobacillus reuteri 100-23]
          Length = 152

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 66/125 (52%), Gaps = 5/125 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           + + N   TI LG+ +   L  GD L L GDLG+GK+   + +   L   D ++  SPTF
Sbjct: 4   LTLTNRDATIALGKKIGQQLVAGDVLVLDGDLGAGKTTFTKGLAAGLEIPDIIK--SPTF 61

Query: 71  TLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYID 128
           T++  Y D  +P+ H D YRL +     +LG +E  + + + ++EW E     LP  ++ 
Sbjct: 62  TIIHEYQDGRLPLYHMDAYRLENGG-AEDLGLEEYFDGDGVSVVEWAEFVEDELPADFLA 120

Query: 129 IHLSQ 133
           IH  +
Sbjct: 121 IHFKR 125


>gi|261414738|ref|YP_003248421.1| protein of unknown function UPF0079 [Fibrobacter succinogenes
           subsp. succinogenes S85]
 gi|261371194|gb|ACX73939.1| protein of unknown function UPF0079 [Fibrobacter succinogenes
           subsp. succinogenes S85]
 gi|302325800|gb|ADL25001.1| ATPase, YjeE family [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 137

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 59/103 (57%), Gaps = 3/103 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E  T       A  L++GD + L G+LG+GK+ ++R I + L  +    V SPT+T++ 
Sbjct: 5   SEDETYNWALEFAKELKVGDKVALYGNLGAGKTVISRGICKGLGFEGT--VCSPTYTILH 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFD-EILNERICIIEWPE 116
            Y  + P+ HFD YRL    ++ E+G D + L   I +IEWPE
Sbjct: 63  EYPNNPPIFHFDLYRLEGGADLYEVGMDPDYLERGISLIEWPE 105


>gi|300767628|ref|ZP_07077538.1| ATP/GTP hydrolase [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
 gi|300494613|gb|EFK29771.1| ATP/GTP hydrolase [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
          Length = 159

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 73/132 (55%), Gaps = 5/132 (3%)

Query: 4   SEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDAL 63
           S K++  I + + + T+ +G  L  +++ GD + L GDLG+GK+   + + + L   +  
Sbjct: 3   SWKNMESITVTSPEATMAIGAKLGQLVQPGDLILLDGDLGAGKTTFTKGLAKSLGIPN-- 60

Query: 64  EVLSPTFTLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSL 121
            V SPTFTL++ Y    +P+ H D YRL       +LG DE  + + + ++EW +    L
Sbjct: 61  NVKSPTFTLIREYRQGRLPLYHMDVYRLEDGG-AEDLGLDEYFDGDGVSVVEWSQFIADL 119

Query: 122 LPKKYIDIHLSQ 133
           LP  Y+ I +S+
Sbjct: 120 LPTTYLRIAISR 131


>gi|169832157|ref|YP_001718139.1| hypothetical protein Daud_2016 [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169639001|gb|ACA60507.1| protein of unknown function UPF0079 [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 158

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 68/124 (54%), Gaps = 3/124 (2%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  +G  L  +L  GD + + G LG+GK+ LA+ + R L   +A  V+SPTF L++ Y
Sbjct: 15  EKTRQVGEELGRLLEPGDLICIYGPLGAGKTALAQGVARGLGVTEA--VVSPTFILIREY 72

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQGK 135
              +P  HFD YRL    ++  LG +E L  + + ++EW +     LP + +DI L  G 
Sbjct: 73  RGRVPFYHFDAYRLHGPADLNLLGAEEYLAGDGVVLVEWADRVDPALPAERLDIVLDYGG 132

Query: 136 TGRK 139
             ++
Sbjct: 133 ENKR 136


>gi|154500216|ref|ZP_02038254.1| hypothetical protein BACCAP_03880 [Bacteroides capillosus ATCC
           29799]
 gi|150270948|gb|EDM98222.1| hypothetical protein BACCAP_03880 [Bacteroides capillosus ATCC
           29799]
          Length = 142

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 63/115 (54%), Gaps = 4/115 (3%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-I 80
           LG  LA  L+ G  +  SGDLG+GK+   R + R L   +   V SPTFT+V  Y+   +
Sbjct: 14  LGAALAERLKPGTVVAFSGDLGAGKTAFVRGMARGLGISE--RVTSPTFTIVNEYEGGRL 71

Query: 81  PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
           P+ HFD YRL S  E+ ++G+ D ++   +C +EW E     +    I + + +G
Sbjct: 72  PLFHFDMYRLGSSDELFDIGWEDYLVRGGVCAVEWSENVSDAMEGDCIRVDIRRG 126


>gi|260892072|ref|YP_003238169.1| protein of unknown function UPF0079 [Ammonifex degensii KC4]
 gi|260864213|gb|ACX51319.1| protein of unknown function UPF0079 [Ammonifex degensii KC4]
          Length = 160

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 63/116 (54%), Gaps = 3/116 (2%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  +G  L  ILR GD + L G+LG+GK+   R + R L   +   V SP+F LV+ Y
Sbjct: 11  EETQAIGEKLGGILRPGDIVALEGELGAGKTCFVRGLARALGVREP--VASPSFVLVREY 68

Query: 77  DAS-IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHL 131
                 + HFD YRL   +   +LG +E     I +IEW E   ++LP++ +++ L
Sbjct: 69  RGERFLLYHFDAYRLEDPRAFWDLGVEEYFASGISVIEWAEKVAAVLPEERLEVRL 124


>gi|28199767|ref|NP_780081.1| hypothetical protein PD1899 [Xylella fastidiosa Temecula1]
 gi|182682517|ref|YP_001830677.1| hypothetical protein XfasM23_2004 [Xylella fastidiosa M23]
 gi|28057888|gb|AAO29730.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|182632627|gb|ACB93403.1| protein of unknown function UPF0079 [Xylella fastidiosa M23]
 gi|307578794|gb|ADN62763.1| hypothetical protein XFLM_03965 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 162

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 77/144 (53%), Gaps = 14/144 (9%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY---DA 78
           LG  LA    L   L+L GD+G+GKS LAR+++R L    A+   SPT+TLV+ Y   D 
Sbjct: 15  LGMVLAHSRPLPAVLSLQGDIGAGKSTLARALLRALGVTGAIR--SPTYTLVERYVLADG 72

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEILNERIC-IIEWPEIGRSLLPKKYIDIHLSQGKTG 137
                H D YR+ +  E+  LG DE  +E +  ++EWPE G   LP   +++ L+    G
Sbjct: 73  G-EAWHLDLYRIGNASELDFLGLDE--DEVVLWLVEWPERGAGALPSLDLEVALAIEGAG 129

Query: 138 RKATISA-----ERWIISHINQMN 156
           R+  + A     E W+ + + +M 
Sbjct: 130 RRVRLRAGSTQGEAWLAAAVIKMQ 153


>gi|306828844|ref|ZP_07462036.1| ATP/GTP hydrolase [Streptococcus mitis ATCC 6249]
 gi|304429022|gb|EFM32110.1| ATP/GTP hydrolase [Streptococcus mitis ATCC 6249]
          Length = 147

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 70/125 (56%), Gaps = 5/125 (4%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  + LG  L  IL+  D L L+G+LG+GK+   + + + L  D    + SPT+T+V+
Sbjct: 5   NEEELLALGERLGRILQKDDVLILTGELGAGKTTFTKGLAKGL--DIRQMIKSPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+  + + ++L  DE L    + +IEW  +    LP  Y+++ + +
Sbjct: 63  EYEGRLPLYHLDVYRIEGNTDSIDL--DEFLFGGGVTVIEWGHLLGEDLPDSYLELEILK 120

Query: 134 GKTGR 138
              GR
Sbjct: 121 EADGR 125


>gi|210631732|ref|ZP_03296974.1| hypothetical protein COLSTE_00859 [Collinsella stercoris DSM 13279]
 gi|210159852|gb|EEA90823.1| hypothetical protein COLSTE_00859 [Collinsella stercoris DSM 13279]
          Length = 166

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 68/119 (57%), Gaps = 4/119 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
            +T+ LG  +AS L+ GD L L+G LG GK+   + + R L   D   V SPTF L+ ++
Sbjct: 15  DDTVELGELVASCLQDGDVLVLTGGLGVGKTHFTKGVSRGL--GDERPVTSPTFALMAVH 72

Query: 77  DAS-IPVAHFDFYRLSSHQEVVELG-FDEILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
           D   IP+ HFD YRL    ++ + G FD +  E  C++EW E  +  L  +Y+ + +++
Sbjct: 73  DGGRIPLFHFDLYRLEHAYQLEDTGIFDVLGYEGACLLEWGEQFQDDLTDEYLGVVIAR 131


>gi|138893887|ref|YP_001124340.1| ATP/GTP hydrolase [Geobacillus thermodenitrificans NG80-2]
 gi|196251111|ref|ZP_03149791.1| protein of unknown function UPF0079 [Geobacillus sp. G11MC16]
 gi|134265400|gb|ABO65595.1| ATP/GTP hydrolase [Geobacillus thermodenitrificans NG80-2]
 gi|196209405|gb|EDY04184.1| protein of unknown function UPF0079 [Geobacillus sp. G11MC16]
          Length = 152

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 65/125 (52%), Gaps = 6/125 (4%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           K T  + R LA  L  G  + L GDLG+GK+   + I   L       V SPTFT+++ Y
Sbjct: 12  KETKEIARRLAEQLEPGMVIALEGDLGAGKTTFTKGIAEGL--GITQNVNSPTFTIIKQY 69

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL-SQG 134
           +  +P+ H D YRL    E  +LGFDE    + + ++EW  +    LP + + +HL   G
Sbjct: 70  EGRLPLYHMDVYRLEDEWE--DLGFDEYFAGDGVTVVEWAHLIAGQLPNERLTVHLYHHG 127

Query: 135 KTGRK 139
            + RK
Sbjct: 128 DSERK 132


>gi|56962642|ref|YP_174368.1| ATP/GTP hydrolase [Bacillus clausii KSM-K16]
 gi|56908880|dbj|BAD63407.1| ATP/GTP hydrolase [Bacillus clausii KSM-K16]
          Length = 155

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 77/145 (53%), Gaps = 15/145 (10%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + TI L   L S+L+ GD +TL GDLG+GK+  A+ I   L  +    V SPTFT+++ Y
Sbjct: 12  EETIELAAALGSMLKPGDVVTLDGDLGAGKTHFAKGIAVALGVNGV--VNSPTFTIIKEY 69

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYI--DIHLSQ 133
           + ++P  H D YR  +  +V +LG +E    + + ++EW  +    LP       IHL  
Sbjct: 70  EGNMPFYHMDVYR--AEGQVQDLGLEEYFYGDGVTVVEWASLLEEALPNNRFACSIHL-L 126

Query: 134 GKTGRKATISAERWIISHINQMNRS 158
           G+T R+        I+  + + NR+
Sbjct: 127 GETKREL-------ILKPVGEENRT 144


>gi|307703975|ref|ZP_07640909.1| conserved hypothetical protein [Streptococcus mitis SK597]
 gi|307622441|gb|EFO01444.1| conserved hypothetical protein [Streptococcus mitis SK597]
          Length = 147

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 70/132 (53%), Gaps = 5/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+    LG  L  +L   D L L+G+LG+GK+   + + + L     ++  SPT+T+V+
Sbjct: 5   NEEELQALGERLGHLLEKNDVLILTGELGAGKTTFTKGLAKGLQISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE L    + +IEW  +    LP  Y+++ + +
Sbjct: 63  EYEGRLPLYHLDVYRIEGDADSIDL--DEFLFGGGVTVIEWGNLLGDALPDTYLELEILK 120

Query: 134 GKTGRKATISAE 145
              GR+    A+
Sbjct: 121 EADGRRLNFQAK 132


>gi|237736521|ref|ZP_04567002.1| ATP/GTP hydrolase [Fusobacterium mortiferum ATCC 9817]
 gi|229421563|gb|EEO36610.1| ATP/GTP hydrolase [Fusobacterium mortiferum ATCC 9817]
          Length = 154

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 69/124 (55%), Gaps = 5/124 (4%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-DASI 80
           L   LA        + L GDLG+GK+  ++   + L  D+ ++  SPTF  V  Y    +
Sbjct: 13  LAEKLADYSCENTVIALIGDLGTGKTTFSQHFAKRLGIDENIK--SPTFNYVLEYLSGRL 70

Query: 81  PVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLS-QGKTGR 138
           P+ HFD YRL   +E+ E+G+++ LN   I +IEW  I  S LPK+YI++ L+  G+  R
Sbjct: 71  PLYHFDVYRLGEAEEIYEVGYEDYLNSNGILLIEWANIIESELPKEYIEVKLNYHGEDTR 130

Query: 139 KATI 142
           +  +
Sbjct: 131 EVEL 134


>gi|73667549|ref|YP_303565.1| hypothetical protein Ecaj_0936 [Ehrlichia canis str. Jake]
 gi|72394690|gb|AAZ68967.1| protein of unknown function UPF0079 [Ehrlichia canis str. Jake]
          Length = 155

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (59%), Gaps = 3/102 (2%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-I 80
           L   +A  L+  D ++L GDLG GK+   R ++  L+  +  +V SPTF+++  Y +S  
Sbjct: 16  LAHFVALNLKKCDSVSLVGDLGVGKTAFVRFLVNTLIPSE--DVSSPTFSIINEYHSSEF 73

Query: 81  PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLL 122
            + H D YR++S  EV +LG D I N  ICI+EWP +  S+L
Sbjct: 74  IIYHVDLYRINSLSEVYDLGLDCICNNGICIVEWPNLLDSIL 115


>gi|332669570|ref|YP_004452578.1| hypothetical protein Celf_1054 [Cellulomonas fimi ATCC 484]
 gi|332338608|gb|AEE45191.1| Uncharacterized protein family UPF0079, ATPase [Cellulomonas fimi
           ATCC 484]
          Length = 192

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 71/138 (51%), Gaps = 12/138 (8%)

Query: 9   TVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSP 68
           T + +P+   T   GR LA +LR GD + L+GDLG+GK+ L + I   L      +V SP
Sbjct: 21  TSVTLPDADATRAFGRALARVLRAGDLVVLTGDLGAGKTTLTQGIGAGLGVRG--QVASP 78

Query: 69  TFTLVQLYDASIP---------VAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGR 119
           TF + + +   +P         + H D YRLSS  EV  L  D  L+E + ++EW E   
Sbjct: 79  TFIIAREH-PPVPGPDGVRGPGLVHVDAYRLSSLDEVDALDLDASLDESVTVVEWGEGWV 137

Query: 120 SLLPKKYIDIHLSQGKTG 137
             L    +++ L++ + G
Sbjct: 138 EGLAADRLEVSLTRPRGG 155


>gi|288926045|ref|ZP_06419974.1| ATPase [Prevotella buccae D17]
 gi|315606341|ref|ZP_07881357.1| ATPase [Prevotella buccae ATCC 33574]
 gi|288337265|gb|EFC75622.1| ATPase [Prevotella buccae D17]
 gi|315252032|gb|EFU32005.1| ATPase [Prevotella buccae ATCC 33574]
          Length = 137

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 65/132 (49%), Gaps = 5/132 (3%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I I +  N     +     +         G +G+GK+   ++I      DD   + SPTF
Sbjct: 3   IKIDSLDNIHAAAKQFVDNMGTSKVFAFYGKMGAGKTTFIKAICEVFGVDDV--ITSPTF 60

Query: 71  TLVQLYDAS--IPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYI 127
            +V  Y A+   P+ HFDFYR+   +EV ++G+ D   +  +C +EWPE+  +LLP   +
Sbjct: 61  AIVNEYTAASGTPIYHFDFYRIKKIEEVYDMGYEDYFYSNNLCFLEWPELIENLLPGDAV 120

Query: 128 DIHLSQGKTGRK 139
            + + + + G +
Sbjct: 121 RVTIREEEDGTR 132


>gi|282878976|ref|ZP_06287740.1| ATPase, YjeE family [Prevotella buccalis ATCC 35310]
 gi|281298975|gb|EFA91380.1| ATPase, YjeE family [Prevotella buccalis ATCC 35310]
          Length = 137

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 63/111 (56%), Gaps = 6/111 (5%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASI---PVAHFDFYR 89
           G+     G +G+GK+   ++I   L  +D   + SPTF +V  Y ++     + HFDFYR
Sbjct: 25  GNVFAFYGKMGAGKTTFIKAICECLDVEDV--ITSPTFAIVNEYYSNKLQDSIYHFDFYR 82

Query: 90  LSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRK 139
           +   +EV ++G+ D   + R+C +EWPE+   LLPK  + + +++ + G +
Sbjct: 83  IKKLEEVYDMGYEDYFYSHRLCFLEWPELVEELLPKDAVKVTIAEQEDGSR 133


>gi|15901768|ref|NP_346372.1| hypothetical protein SP_1944 [Streptococcus pneumoniae TIGR4]
 gi|15903803|ref|NP_359353.1| hypothetical protein spr1761 [Streptococcus pneumoniae R6]
 gi|111658834|ref|ZP_01409455.1| hypothetical protein SpneT_02000005 [Streptococcus pneumoniae
           TIGR4]
 gi|116515913|ref|YP_817166.1| hypothetical protein SPD_1743 [Streptococcus pneumoniae D39]
 gi|148985530|ref|ZP_01818719.1| hypothetical protein CGSSp3BS71_11178 [Streptococcus pneumoniae
           SP3-BS71]
 gi|148990155|ref|ZP_01821395.1| hypothetical protein CGSSp6BS73_02023 [Streptococcus pneumoniae
           SP6-BS73]
 gi|148993190|ref|ZP_01822756.1| hypothetical protein CGSSp9BS68_09746 [Streptococcus pneumoniae
           SP9-BS68]
 gi|148998482|ref|ZP_01825923.1| hypothetical protein CGSSp11BS70_11271 [Streptococcus pneumoniae
           SP11-BS70]
 gi|149007426|ref|ZP_01831069.1| hypothetical protein CGSSp18BS74_06422 [Streptococcus pneumoniae
           SP18-BS74]
 gi|149012467|ref|ZP_01833498.1| hypothetical protein CGSSp19BS75_00861 [Streptococcus pneumoniae
           SP19-BS75]
 gi|168484243|ref|ZP_02709195.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1873-00]
 gi|168487421|ref|ZP_02711929.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1087-00]
 gi|168490067|ref|ZP_02714266.1| conserved hypothetical protein [Streptococcus pneumoniae SP195]
 gi|168492080|ref|ZP_02716223.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC0288-04]
 gi|168576646|ref|ZP_02722512.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016]
 gi|182684888|ref|YP_001836635.1| hypothetical protein SPCG_1917 [Streptococcus pneumoniae CGSP14]
 gi|221232672|ref|YP_002511826.1| P-loop hydrolase [Streptococcus pneumoniae ATCC 700669]
 gi|225859708|ref|YP_002741218.1| hypothetical protein SP70585_2023 [Streptococcus pneumoniae 70585]
 gi|237650973|ref|ZP_04525225.1| hypothetical protein SpneC1_09709 [Streptococcus pneumoniae CCRI
           1974]
 gi|237821642|ref|ZP_04597487.1| hypothetical protein SpneC19_04930 [Streptococcus pneumoniae CCRI
           1974M2]
 gi|303260326|ref|ZP_07346296.1| hypothetical protein CGSSp9vBS293_00532 [Streptococcus pneumoniae
           SP-BS293]
 gi|303262474|ref|ZP_07348416.1| hypothetical protein CGSSp14BS292_11667 [Streptococcus pneumoniae
           SP14-BS292]
 gi|303265104|ref|ZP_07351017.1| hypothetical protein CGSSpBS397_00622 [Streptococcus pneumoniae
           BS397]
 gi|303266034|ref|ZP_07351929.1| hypothetical protein CGSSpBS457_10357 [Streptococcus pneumoniae
           BS457]
 gi|303268034|ref|ZP_07353835.1| hypothetical protein CGSSpBS458_05082 [Streptococcus pneumoniae
           BS458]
 gi|307068562|ref|YP_003877528.1| putative ATPase [Streptococcus pneumoniae AP200]
 gi|307128151|ref|YP_003880182.1| hypothetical protein SP670_2030 [Streptococcus pneumoniae 670-6B]
 gi|14973449|gb|AAK76012.1| conserved hypothetical protein TIGR00150 [Streptococcus pneumoniae
           TIGR4]
 gi|15459442|gb|AAL00564.1| Conserved hypothetical protein [Streptococcus pneumoniae R6]
 gi|116076489|gb|ABJ54209.1| conserved hypothetical protein [Streptococcus pneumoniae D39]
 gi|147755675|gb|EDK62721.1| hypothetical protein CGSSp11BS70_11271 [Streptococcus pneumoniae
           SP11-BS70]
 gi|147760998|gb|EDK67967.1| hypothetical protein CGSSp18BS74_06422 [Streptococcus pneumoniae
           SP18-BS74]
 gi|147763523|gb|EDK70459.1| hypothetical protein CGSSp19BS75_00861 [Streptococcus pneumoniae
           SP19-BS75]
 gi|147922250|gb|EDK73371.1| hypothetical protein CGSSp3BS71_11178 [Streptococcus pneumoniae
           SP3-BS71]
 gi|147924549|gb|EDK75637.1| hypothetical protein CGSSp6BS73_02023 [Streptococcus pneumoniae
           SP6-BS73]
 gi|147928164|gb|EDK79182.1| hypothetical protein CGSSp9BS68_09746 [Streptococcus pneumoniae
           SP9-BS68]
 gi|172042515|gb|EDT50561.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1873-00]
 gi|182630222|gb|ACB91170.1| hypothetical protein SPCG_1917 [Streptococcus pneumoniae CGSP14]
 gi|183569750|gb|EDT90278.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1087-00]
 gi|183571520|gb|EDT92048.1| conserved hypothetical protein [Streptococcus pneumoniae SP195]
 gi|183573735|gb|EDT94263.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC0288-04]
 gi|183577600|gb|EDT98128.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016]
 gi|220675134|emb|CAR69717.1| putative P-loop hydrolase [Streptococcus pneumoniae ATCC 700669]
 gi|225720496|gb|ACO16350.1| conserved hypothetical protein [Streptococcus pneumoniae 70585]
 gi|301794897|emb|CBW37357.1| putative P-loop hydrolase [Streptococcus pneumoniae INV104]
 gi|301800715|emb|CBW33363.1| putative P-loop hydrolase [Streptococcus pneumoniae OXC141]
 gi|301802631|emb|CBW35397.1| putative P-loop hydrolase [Streptococcus pneumoniae INV200]
 gi|302636374|gb|EFL66867.1| hypothetical protein CGSSp14BS292_11667 [Streptococcus pneumoniae
           SP14-BS292]
 gi|302638492|gb|EFL68957.1| hypothetical protein CGSSpBS293_00532 [Streptococcus pneumoniae
           SP-BS293]
 gi|302642394|gb|EFL72740.1| hypothetical protein CGSSpBS458_05082 [Streptococcus pneumoniae
           BS458]
 gi|302644475|gb|EFL74727.1| hypothetical protein CGSSpBS457_10357 [Streptococcus pneumoniae
           BS457]
 gi|302645321|gb|EFL75555.1| hypothetical protein CGSSpBS397_00622 [Streptococcus pneumoniae
           BS397]
 gi|306410099|gb|ADM85526.1| Predicted ATPase or kinase [Streptococcus pneumoniae AP200]
 gi|306485213|gb|ADM92082.1| conserved hypothetical protein [Streptococcus pneumoniae 670-6B]
 gi|327389115|gb|EGE87461.1| hypothetical protein SPAR5_1838 [Streptococcus pneumoniae GA04375]
 gi|332071929|gb|EGI82417.1| hypothetical protein SPAR148_1871 [Streptococcus pneumoniae
           GA17545]
 gi|332072032|gb|EGI82519.1| UPF0079 ATP-binding protein ydiB [Streptococcus pneumoniae GA17570]
 gi|332072140|gb|EGI82626.1| hypothetical protein SPAR68_2031 [Streptococcus pneumoniae GA41301]
 gi|332199370|gb|EGJ13447.1| hypothetical protein SPAR93_2013 [Streptococcus pneumoniae GA47368]
 gi|332199966|gb|EGJ14040.1| hypothetical protein SPAR120_1887 [Streptococcus pneumoniae
           GA47901]
          Length = 147

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 70/132 (53%), Gaps = 5/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+    LG  L  +L   D L L+G+LG+GK+   + + + L     ++  SPT+T+V+
Sbjct: 5   NEEELQALGERLGHLLAKNDVLILTGELGAGKTTFTKGLAKGLQISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE I    + +IEW  +    LP  Y+++ + +
Sbjct: 63  EYEGRLPLYHLDVYRIEGDADSIDL--DEFIFGGGVTVIEWGNLLGDALPDAYLELEILK 120

Query: 134 GKTGRKATISAE 145
              GR+    A+
Sbjct: 121 EADGRRLNFQAK 132


>gi|323350364|ref|ZP_08086028.1| ATP/GTP hydrolase [Streptococcus sanguinis VMC66]
 gi|322123437|gb|EFX95113.1| ATP/GTP hydrolase [Streptococcus sanguinis VMC66]
          Length = 146

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 74/131 (56%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L  +L+ GD L L+GDLG+GK+   + +   L     ++  SPT+T+V+
Sbjct: 5   NEEELIQQGQRLGKLLQAGDVLVLTGDLGAGKTTFTKGLALGLGISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + +IEW E+    LP+ Y+ + L + 
Sbjct: 63  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFLFGEGVTVIEWGELLGENLPEDYLKLSLLKK 121

Query: 135 KTGRKATISAE 145
           + GR+    A+
Sbjct: 122 EDGRELFFEAK 132


>gi|225855437|ref|YP_002736949.1| hypothetical protein SPJ_1938 [Streptococcus pneumoniae JJA]
 gi|225723150|gb|ACO19003.1| conserved hypothetical protein [Streptococcus pneumoniae JJA]
          Length = 147

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 70/132 (53%), Gaps = 5/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+    LG  L  +L   D L L+G+LG+GK+   + + + L     ++  SPT+T+V+
Sbjct: 5   NEEELQALGERLGHLLAKNDVLILTGELGAGKTTFTKGLAKGLQISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE I    + +IEW  +    LP  Y+++ + +
Sbjct: 63  EYEGRLPLYHLDVYRIEGDADSIDL--DEFIFGGGVTVIEWGNLLGDALPDAYLELEILK 120

Query: 134 GKTGRKATISAE 145
              GR+    A+
Sbjct: 121 EADGRRLNFQAK 132


>gi|300690590|ref|YP_003751585.1| hypothetical protein RPSI07_0926 [Ralstonia solanacearum PSI07]
 gi|299077650|emb|CBJ50286.1| conserved protein of unknown function, UPF0079 [Ralstonia
           solanacearum PSI07]
          Length = 192

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 60/101 (59%), Gaps = 10/101 (9%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-----ASIPVAHFDFYRLSS 92
           LSGDLG+GK+ L+R+I+  L H     V SPT+TLV+ YD      +  V HFD YR   
Sbjct: 56  LSGDLGAGKTTLSRAILHGLGHTG--RVRSPTYTLVEPYDVPGTSGTQKVYHFDLYRFVD 113

Query: 93  HQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHLS 132
            +E  + GF +   E  +C++EWPE  ++LL     D+H++
Sbjct: 114 PEEWTDAGFRDCFAEPALCLVEWPEKAQALL--GTPDLHIA 152


>gi|239918155|ref|YP_002957713.1| conserved hypothetical nucleotide-binding protein TIGR00150
           [Micrococcus luteus NCTC 2665]
 gi|281415658|ref|ZP_06247400.1| conserved hypothetical nucleotide-binding protein TIGR00150
           [Micrococcus luteus NCTC 2665]
 gi|239839362|gb|ACS31159.1| conserved hypothetical nucleotide-binding protein TIGR00150
           [Micrococcus luteus NCTC 2665]
          Length = 207

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 85/182 (46%), Gaps = 26/182 (14%)

Query: 2   NFSEKHLTV-IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
              E  LT  +P+     T   GR LA +LR GD L L+GDLG+GK+   + +       
Sbjct: 12  TLPEPVLTATVPLEGADGTRAFGRALAGVLRAGDVLILTGDLGAGKTTFTQGLASGFGV- 70

Query: 61  DALEVLSPTFTLVQLY--DASIPVA-----HFDFYRLSSHQEVVELGFDEILNERICIIE 113
            A  V+SPTF L +++   A  P       H D YRL S  E+ +L  D  ++  + ++E
Sbjct: 71  -ASGVVSPTFVLSRVHPAPADAPAGTPDLVHVDAYRLRSAGELTDLDLDASVDRSVTVVE 129

Query: 114 WPEIGRSL------LPK----KYIDIHLSQ---GKTGRKATISAERWIISHINQMNRSTS 160
           W   GR +       P+     ++DI + +   G+ G  A+   E  I++  +  +   +
Sbjct: 130 W---GRGMAESLAGFPEDPDASWLDIEIVRARGGEDGPAASAGEEDGIVTDFSDEDGGQA 186

Query: 161 QQ 162
           ++
Sbjct: 187 EE 188


>gi|33151671|ref|NP_873024.1| hypothetical protein HD0451 [Haemophilus ducreyi 35000HP]
 gi|33147892|gb|AAP95413.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 166

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 65/109 (59%), Gaps = 4/109 (3%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEV 96
           L+G+LG+GK+ L RSI+R   ++    V SPT+ LV+ Y   +I + HFD YRL+  +E+
Sbjct: 42  LNGELGAGKTTLTRSIVRAFDYNG--NVKSPTYALVEEYQLPTITIYHFDLYRLADPEEL 99

Query: 97  VELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
             +G  D    + +C++EW + G+ ++P   I I +   + GR  ++ A
Sbjct: 100 EFMGIRDYFQPQTLCLLEWADRGKGVIPPADITIQIDYAEQGRHLSLQA 148


>gi|148825654|ref|YP_001290407.1| hypothetical protein CGSHiEE_02970 [Haemophilus influenzae PittEE]
 gi|229845403|ref|ZP_04465534.1| hypothetical protein CGSHi6P18H1_00607 [Haemophilus influenzae
           6P18H1]
 gi|229846985|ref|ZP_04467091.1| hypothetical protein CGSHi7P49H1_06036 [Haemophilus influenzae
           7P49H1]
 gi|148715814|gb|ABQ98024.1| hypothetical protein CGSHiEE_02970 [Haemophilus influenzae PittEE]
 gi|229810069|gb|EEP45789.1| hypothetical protein CGSHi7P49H1_06036 [Haemophilus influenzae
           7P49H1]
 gi|229811711|gb|EEP47409.1| hypothetical protein CGSHi6P18H1_00607 [Haemophilus influenzae
           6P18H1]
          Length = 145

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 66/110 (60%), Gaps = 4/110 (3%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEV 96
           L+GDLG+GK+ L R +++ + H     V SPT+TLV+ Y+ A   + HFD YRL+  +E+
Sbjct: 25  LNGDLGAGKTTLTRGMLQGIGHQG--NVKSPTYTLVEEYNIAGKMIYHFDLYRLADPEEL 82

Query: 97  VELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAE 145
             +G  +  N + IC+IEW E G+ +LP+  I +++      R   + A+
Sbjct: 83  EFMGIRDYFNTDSICLIEWSEKGQGILPEADILVNIDYYDDARNIELIAQ 132


>gi|220917552|ref|YP_002492856.1| protein of unknown function UPF0079 [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955406|gb|ACL65790.1| protein of unknown function UPF0079 [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 183

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/112 (36%), Positives = 58/112 (51%), Gaps = 2/112 (1%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP 81
           LG  L  +LR GD + L GDLG+GK+ L R            EV SPTF +V  Y   IP
Sbjct: 24  LGARLGGLLRPGDVVALEGDLGAGKTQLVRGACEGADVPPG-EVSSPTFAIVATYAGRIP 82

Query: 82  VAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
           V H D YR++   E+   GF +++  E   ++EW +     LP + + + LS
Sbjct: 83  VHHADLYRIADEDELYGTGFGDLVGGEGALLVEWADRIPGALPAERLTLRLS 134


>gi|256831868|ref|YP_003160595.1| hypothetical protein Jden_0628 [Jonesia denitrificans DSM 20603]
 gi|256685399|gb|ACV08292.1| protein of unknown function UPF0079 [Jonesia denitrificans DSM
           20603]
          Length = 181

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 77/167 (46%), Gaps = 24/167 (14%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
            + +P+   T  LG  LA  L  GD L L+GDLG+GK+ L + I R L    A  V SPT
Sbjct: 8   TLTLPDADATQSLGERLAGYLTAGDLLILTGDLGAGKTTLTQGIGRGLGVRGA--VASPT 65

Query: 70  FTLVQ----LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKK 125
           F + +    L D    + H D YRLSS  EV  L  D  L+E + ++EW E     L   
Sbjct: 66  FIIAREHPSLTDGP-GLVHVDAYRLSSLDEVDALDLDTSLDECVTVVEWGEGLVDTLSDD 124

Query: 126 YIDIHLSQGKTG---------------RKATISA--ERWIISHINQM 155
            +DI L +   G               R ATI+A  ERW  +    +
Sbjct: 125 RLDIVLRRPHGGITSADVDLDSAEVGERVATITAHGERWAATDFRAL 171


>gi|225857526|ref|YP_002739037.1| hypothetical protein SPP_1972 [Streptococcus pneumoniae P1031]
 gi|225724675|gb|ACO20527.1| conserved hypothetical protein [Streptococcus pneumoniae P1031]
          Length = 147

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 70/134 (52%), Gaps = 5/134 (3%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           I NE+    LG  L  +L   D L L G+LG+GK+   + + + L     ++  SPT+T+
Sbjct: 3   IKNEEELQALGERLGHLLAKNDVLILIGELGAGKTTFTKGLAKGLQISQMIK--SPTYTI 60

Query: 73  VQLYDASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHL 131
           V+ Y+  +P+ H D YR+    + ++L  DE I    + +IEW  +    LP  Y+++ +
Sbjct: 61  VREYEGRLPLYHLDVYRIEGDADSIDL--DEFIFGGGVTVIEWGNLLGDALPDAYLELEI 118

Query: 132 SQGKTGRKATISAE 145
            +   GR+    A+
Sbjct: 119 LKEADGRRLNFQAK 132


>gi|152978665|ref|YP_001344294.1| hypothetical protein Asuc_0991 [Actinobacillus succinogenes 130Z]
 gi|150840388|gb|ABR74359.1| protein of unknown function UPF0079 [Actinobacillus succinogenes
           130Z]
          Length = 159

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 79/140 (56%), Gaps = 9/140 (6%)

Query: 13  IPNEKNTICLGRHL-ASILRL----GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
           + +E+ T+  GR L  ++ R+    G  L L+G LG+GK+ L+R +I+ L +    +V S
Sbjct: 10  LADEQATLDFGRMLIQAVCRITSPHGITLYLNGGLGAGKTTLSRGMIQSLGYQG--KVKS 67

Query: 68  PTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKK 125
           PT+TLV+ Y      + HFD YRLS  +E+  +G  D    + IC+IEW E G  LLP  
Sbjct: 68  PTYTLVEEYHLQGKHIYHFDLYRLSDPEELEFMGIRDYFSADSICLIEWAEKGIGLLPDA 127

Query: 126 YIDIHLSQGKTGRKATISAE 145
            + ++++     R+  + A+
Sbjct: 128 DLSVNINYADDARRIELIAQ 147


>gi|325677649|ref|ZP_08157301.1| hydrolase, P-loop family [Ruminococcus albus 8]
 gi|324110617|gb|EGC04781.1| hydrolase, P-loop family [Ruminococcus albus 8]
          Length = 153

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 72/137 (52%), Gaps = 12/137 (8%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           MNF+ K  +       + TI LGR +   LR G+ +   G LG+GK+ + R I   +   
Sbjct: 1   MNFTYKTNSA------EETIVLGREIGRRLRGGEIIAYRGGLGAGKTTITRGISEGMGLG 54

Query: 61  DALEVLSPTFTLVQLY---DASIPVAHFDFYRLSSHQEVVELG-FDEILNERICIIEWPE 116
           D  EV SPTF LV  Y   D+ + + HFD YR++S Q++   G FD + ++ +  +EW E
Sbjct: 55  D--EVTSPTFALVNEYRKKDSKLSLIHFDMYRITSGQDLETTGFFDYMDDDSVLAVEWSE 112

Query: 117 IGRSLLPKKYIDIHLSQ 133
                LP   I I +++
Sbjct: 113 NIDDDLPDDCIKITINR 129


>gi|71275152|ref|ZP_00651439.1| Protein of unknown function UPF0079 [Xylella fastidiosa Dixon]
 gi|71898233|ref|ZP_00680407.1| Protein of unknown function UPF0079 [Xylella fastidiosa Ann-1]
 gi|170731143|ref|YP_001776576.1| hypothetical protein Xfasm12_2083 [Xylella fastidiosa M12]
 gi|71163961|gb|EAO13676.1| Protein of unknown function UPF0079 [Xylella fastidiosa Dixon]
 gi|71731972|gb|EAO34029.1| Protein of unknown function UPF0079 [Xylella fastidiosa Ann-1]
 gi|167965936|gb|ACA12946.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 162

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 77/144 (53%), Gaps = 14/144 (9%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY---DA 78
           LG  LA    L   L+L GD+G+GKS LAR+++R L    A+   SPT+TLV+ Y   D 
Sbjct: 15  LGMVLAHSRPLPAVLSLQGDIGAGKSTLARALLRALGVTGAIR--SPTYTLVERYVLADG 72

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEILNERIC-IIEWPEIGRSLLPKKYIDIHLSQGKTG 137
                H D YR+ +  E+  LG DE  +E +  ++EWPE G   LP   +++ L+    G
Sbjct: 73  G-EAWHLDLYRIGNAAELDFLGLDE--DEVVLWLVEWPERGAGALPSFDLEVALAIEGAG 129

Query: 138 RKATISA-----ERWIISHINQMN 156
           R+  + A     E W+ + + +M 
Sbjct: 130 RRVRLRAGSTQGEAWLAAAVIKMQ 153


>gi|317127092|ref|YP_004093374.1| hypothetical protein Bcell_0357 [Bacillus cellulosilyticus DSM
           2522]
 gi|315472040|gb|ADU28643.1| Uncharacterized protein family UPF0079, ATPase [Bacillus
           cellulosilyticus DSM 2522]
          Length = 154

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 76/137 (55%), Gaps = 9/137 (6%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  L   LA+ L  GD +TL GDLG+GK+   + + + L       V SPTFT+++ Y
Sbjct: 13  EETTQLAEKLATHLAKGDVVTLEGDLGAGKTSFTKGLAKGL--GVTRNVNSPTFTIIKEY 70

Query: 77  DAS-IPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS-Q 133
           +   + + H D YR+   +E  +LG +E    E + +IEWP +    LP++ + IH+   
Sbjct: 71  EGKHMMLYHMDAYRV--EEEYEDLGLEEYFEGEGVTVIEWPSMIAEQLPQERLSIHIQYT 128

Query: 134 GKTGRKATISA--ERWI 148
           G+T R   I+A  +R+I
Sbjct: 129 GETTRNIVITAFGQRYI 145


>gi|300703195|ref|YP_003744797.1| hypothetical protein RCFBP_10857 [Ralstonia solanacearum CFBP2957]
 gi|299070858|emb|CBJ42160.1| conserved protein of unknown function, UPF0079 [Ralstonia
           solanacearum CFBP2957]
          Length = 189

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 61/101 (60%), Gaps = 10/101 (9%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-----IPVAHFDFYRLSS 92
           LSGDLG+GK+ L+R+I+  L H     V SPT+TLV+ Y+       + V HFD YR + 
Sbjct: 53  LSGDLGAGKTTLSRAILHGLGHTG--RVRSPTYTLVEPYEVPGTSGMLKVYHFDLYRFAD 110

Query: 93  HQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHLS 132
            +E  + GF +   E  +C++EWPE  ++LL     D+H++
Sbjct: 111 PEEWTDAGFRDCFAEPALCLVEWPEKAQALL--GTPDLHIA 149


>gi|254468411|ref|ZP_05081817.1| uncharacterised P-loop hydrolase UPF0079 [beta proteobacterium
           KB13]
 gi|207087221|gb|EDZ64504.1| uncharacterised P-loop hydrolase UPF0079 [beta proteobacterium
           KB13]
          Length = 150

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 72/124 (58%), Gaps = 5/124 (4%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E++T  +   +A  L+ G  + L G+LG+GK+ L R +++ L + D  +V SPT+ LV+
Sbjct: 10  SEEDTKKVAELIAPQLKAGMVIFLKGELGAGKTTLVRYLLKSLGYQD--KVKSPTYNLVE 67

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGFDEIL--NERICIIEWPEIGRSLLPKKYIDIHL 131
            +   ++ V HFD YR    +E    GFD+ L     I IIEWPE  + +  K  ID+++
Sbjct: 68  THQLKNLTVHHFDLYRFGCPEEWFSGGFDDYLITENTISIIEWPEKIKGVNIKPDIDVNI 127

Query: 132 SQGK 135
           S G+
Sbjct: 128 STGQ 131


>gi|94429032|gb|ABF18948.1| hypothetical protein [uncultured bacterium pFosLip]
          Length = 155

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 62/111 (55%), Gaps = 4/111 (3%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP-VAHFDFYRLS 91
           G  L L GDLG+GKS  AR++I+ + H  A  V SPT+TLV+ YD     V H D YR+S
Sbjct: 28  GWTLLLEGDLGAGKSTFARALIQAMGHRGA--VPSPTYTLVEPYDLDGGIVYHVDLYRVS 85

Query: 92  SHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATI 142
             +E+  LG+ E L + + ++EWP+    L     + IHL     GR   I
Sbjct: 86  DEEELRYLGWAE-LEDGLRLVEWPDRAPGLAAAADLRIHLRYSGAGRDVEI 135


>gi|81428953|ref|YP_395953.1| hypothetical protein LSA1342 [Lactobacillus sakei subsp. sakei 23K]
 gi|78610595|emb|CAI55646.1| Hypothetical protein LCA_1342 [Lactobacillus sakei subsp. sakei
           23K]
          Length = 154

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 64/119 (53%), Gaps = 5/119 (4%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + TI + + L   L+ GD L L GDLG+GK+   + +   L  D    + SPTFTL++ Y
Sbjct: 10  EETITIAKKLGRQLQAGDVLLLDGDLGAGKTTFTKGLAEGL--DIKRYIKSPTFTLIREY 67

Query: 77  -DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            D  IP+ H D YRL       +LG +E  + + + +IEW +     LP  Y+ IH ++
Sbjct: 68  PDGRIPLYHMDVYRL-EETGASDLGLEEYFDGDGVSVIEWSQFIADELPSDYLTIHFNK 125


>gi|307711306|ref|ZP_07647726.1| conserved hypothetical protein [Streptococcus mitis SK321]
 gi|307616822|gb|EFN96002.1| conserved hypothetical protein [Streptococcus mitis SK321]
          Length = 147

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 71/132 (53%), Gaps = 5/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+    LG  L  +L   D L L+G+LG+GK+   + + R L     ++  SPT+T+V+
Sbjct: 5   NEEELQSLGERLGYLLEKNDVLILTGELGAGKTTFTKGLSRGLQISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE L    + +IEW  +    LP  Y+++ + +
Sbjct: 63  EYEGRLPLYHLDVYRIEGDADSIDL--DEFLFGGGVTVIEWGHLLGDALPDTYLELEILK 120

Query: 134 GKTGRKATISAE 145
            + GR+    A+
Sbjct: 121 EEDGRRLHFQAK 132


>gi|94970308|ref|YP_592356.1| hypothetical protein Acid345_3281 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94552358|gb|ABF42282.1| protein of unknown function UPF0079 [Candidatus Koribacter
           versatilis Ellin345]
          Length = 144

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 60/103 (58%), Gaps = 3/103 (2%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + TI LGR LAS L+    + L GDLG+GK+ L + I   L   ++ +V SPT+TL+  Y
Sbjct: 12  EETIALGRTLASDLKGLHLVLLQGDLGTGKTTLVKGIAAGLKAAESHDVTSPTYTLIHEY 71

Query: 77  DA-SIPVAHFDFYRLSSHQEVVELGFDEILNER--ICIIEWPE 116
               I V H D YR+   +E+  LG +E+L E   + ++EW E
Sbjct: 72  HGEEINVYHIDLYRVEKRRELDTLGVEELLTEENSLLLVEWGE 114


>gi|332359155|gb|EGJ36976.1| ATP/GTP hydrolase [Streptococcus sanguinis SK49]
          Length = 146

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 73/131 (55%), Gaps = 3/131 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L   L+ GD L L+GDLG+GK+   + +   L     ++  SPT+T+V+
Sbjct: 5   NEEELIQWGQRLGKSLQAGDVLVLTGDLGAGKTTFTKGLALGLGISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + +IEW E+    LP+ Y+ + L + 
Sbjct: 63  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFLFGEGVTVIEWGELLGENLPEDYLKLSLLKK 121

Query: 135 KTGRKATISAE 145
           + GR+    A+
Sbjct: 122 EDGRELVFEAK 132


>gi|332199266|gb|EGJ13344.1| hypothetical protein SPAR69_1901 [Streptococcus pneumoniae GA41317]
          Length = 147

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 70/132 (53%), Gaps = 5/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+    LG  L  +L   D L L+G+LG+GK+   + + + L     ++  SPT+T+V+
Sbjct: 5   NEEELQALGESLGHLLAKNDVLILTGELGAGKTTFTKGLAKGLQISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE I    + +IEW  +    LP  Y+++ + +
Sbjct: 63  EYEGRLPLYHLDVYRIEGDADSIDL--DEFIFGGGVTVIEWGNLLGDALPDAYLELEILK 120

Query: 134 GKTGRKATISAE 145
              GR+    A+
Sbjct: 121 EADGRRLNFQAK 132


>gi|71901137|ref|ZP_00683243.1| Protein of unknown function UPF0079 [Xylella fastidiosa Ann-1]
 gi|71729101|gb|EAO31226.1| Protein of unknown function UPF0079 [Xylella fastidiosa Ann-1]
          Length = 162

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 76/143 (53%), Gaps = 12/143 (8%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY---DA 78
           LG  LA    L   L+L GD+G+GKS LAR+++R L    A+   SPT+TLV+ Y   D 
Sbjct: 15  LGMVLAHSRPLPAVLSLQGDIGAGKSTLARALLRALGVTGAIR--SPTYTLVERYVLADG 72

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGR 138
                H D YR+ +  E+  LG DE  +  + ++EWPE G   LP   +++ L+    GR
Sbjct: 73  G-EAWHLDLYRIGNASELDFLGLDED-DVVLWLVEWPERGAGALPSFDLEVALAIEGAGR 130

Query: 139 KATISA-----ERWIISHINQMN 156
           +  + A     E W+ + + +M 
Sbjct: 131 RVRLRAGSTQGEAWLAAAVIKMQ 153


>gi|53728766|ref|ZP_00135216.2| COG0802: Predicted ATPase or kinase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 149

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-IPVAHFDFYRLSSHQ 94
           + L+G+LG+GK+ L RSI+R   H     V SPT+TLV+ Y  +   + HFD YRL+  +
Sbjct: 26  IYLNGELGAGKTTLTRSIVRAFGHQG--NVKSPTYTLVEEYQLTPFCLYHFDLYRLADPE 83

Query: 95  EVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAERWIISHI 152
           E+  +G  D    + +C++EW   G+ ++P   I I +   + GR  T+  +  I   I
Sbjct: 84  ELEFMGIRDYFRPQTLCLLEWATKGKGVIPPADIIIQIDYAELGRNLTLQPQNEIGDQI 142


>gi|312794369|ref|YP_004027292.1| hypothetical protein Calkr_2217 [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312181509|gb|ADQ41679.1| Uncharacterized protein family UPF0079, ATPase
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 157

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 67/119 (56%), Gaps = 7/119 (5%)

Query: 18  NTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD 77
            T+ +G  +   L  G  +TL G+LGSGK+ L R I +    +D   + SPTFT+  +Y+
Sbjct: 11  ETVSIGYKIGRNLFKGAIITLQGELGSGKTALTRGIAKAFGIED---ISSPTFTIFHVYE 67

Query: 78  A--SIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
               I V HFD YR+    E+ ++G++E    + I IIEW +  + L PK+Y+ + + +
Sbjct: 68  GKDGILVYHFDIYRI-EETEIEDIGYEEYFYGDGIVIIEWADKLKRLHPKEYLKVEIQK 125


>gi|33591488|ref|NP_879132.1| hypothetical protein BP0247 [Bordetella pertussis Tohama I]
 gi|33571130|emb|CAE40627.1| conserved hypothetical protein [Bordetella pertussis Tohama I]
 gi|332380923|gb|AEE65770.1| hypothetical protein BPTD_0282 [Bordetella pertussis CS]
          Length = 178

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 77/140 (55%), Gaps = 10/140 (7%)

Query: 13  IPNEKNTICLGRHLASIL------RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
           +P+E  T  L R LA ++      + G  + L GDLG+GK+   R+++R         + 
Sbjct: 12  LPDEAATENLARQLAPLVDGRRGGQPGGQIHLQGDLGAGKTAFTRALLRECGIQG--RIK 69

Query: 67  SPTFTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPK 124
           SP++ L++ Y  S +   H DFYR S  +E ++ GF ++L ++ + +IEWPE    LLP 
Sbjct: 70  SPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAGFRDLLRDDAVVLIEWPERAAGLLPP 129

Query: 125 KYIDIHLSQGKTGRKATISA 144
             + I L+    GR A+++A
Sbjct: 130 PDLLISLAYADQGRDASLTA 149


>gi|52144982|ref|YP_081846.1| uncharacterised P-loop hydrolase [Bacillus cereus E33L]
 gi|51978451|gb|AAU20001.1| conserved hypothetical protein; uncharacterised P-loop hydrolase
           [Bacillus cereus E33L]
          Length = 157

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 64/122 (52%), Gaps = 5/122 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I   + + T  L   L  + R  D + L GDLG+GK+   + + + L       V SPTF
Sbjct: 6   ITTKSSEETQRLSEKLGELARAQDVIILEGDLGAGKTTFTKGLAKGLGVKRV--VNSPTF 63

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDI 129
            +++ Y   +P+ H D YRL+  +E  +LGFDE    E I ++EW  +  + LPK+ + I
Sbjct: 64  NIIKEYKGRLPLYHMDVYRLAESEE--DLGFDEYFYGEGITVVEWAHLIEAYLPKEKLQI 121

Query: 130 HL 131
            L
Sbjct: 122 SL 123


>gi|311067063|ref|YP_003971986.1| putative ATPase or kinase [Bacillus atrophaeus 1942]
 gi|310867580|gb|ADP31055.1| putative ATPase or kinase [Bacillus atrophaeus 1942]
          Length = 158

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 70/133 (52%), Gaps = 7/133 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N + T  + +  AS  R GD LTL GDLG+GK+   +     L       V SPTFT+++
Sbjct: 10  NPEETKAIAKLTASFSRPGDVLTLEGDLGAGKTTFTKGFAEGLGISRV--VNSPTFTIIK 67

Query: 75  LY-DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y D S+P+ H D YR+    E  +LG +E    + +C++EW  +    LP   ++I L 
Sbjct: 68  EYSDGSLPLYHMDVYRMEDESE--DLGLEEYFEGQGVCLVEWAHLIHDQLPCDRLEIVLK 125

Query: 133 Q-GKTGRKATISA 144
           + G   R+ T +A
Sbjct: 126 RVGDEEREITFTA 138


>gi|298708725|emb|CBJ30687.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 242

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 55/103 (53%), Gaps = 3/103 (2%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY---DASIPVAHFDFYR 89
           GD + L GDLG+GK+  AR  +R  + D  L V SP++ L   Y   D  + + H D YR
Sbjct: 105 GDVVLLWGDLGTGKTCFARGFVRARVGDPGLAVTSPSYLLDNTYEVADEDLTLHHMDLYR 164

Query: 90  LSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLS 132
           L    ++  LG   +    +C++EWP+   +  P   +D+HL+
Sbjct: 165 LQGGTDLRVLGIPGVFETCVCLVEWPDRLGATQPVNRLDVHLT 207


>gi|291613647|ref|YP_003523804.1| hypothetical protein Slit_1179 [Sideroxydans lithotrophicus ES-1]
 gi|291583759|gb|ADE11417.1| protein of unknown function UPF0079 [Sideroxydans lithotrophicus
           ES-1]
          Length = 127

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 65/114 (57%), Gaps = 4/114 (3%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLS 91
           G  + L G+LG+GK+ L R++++ L +  A  V SPT+TL++ YD A + + HFD YR  
Sbjct: 4   GLVIYLRGNLGAGKTTLVRALLQGLGY--AGLVKSPTYTLIERYDVAGLHLRHFDLYRFR 61

Query: 92  SHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
             +E  + GF DE     IC++EWPE    LLP   I +     + GR+  + A
Sbjct: 62  DAEEWEDSGFRDEFDGRNICLVEWPEQATGLLPPADISLTFEILQDGRELLLHA 115


>gi|257094713|ref|YP_003168354.1| hypothetical protein CAP2UW1_3153 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047237|gb|ACV36425.1| protein of unknown function UPF0079 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 132

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 59/103 (57%), Gaps = 4/103 (3%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-IPVAHFDFYRLSSHQEV 96
           L GDLG+GK+ L RS++R   H  A  V SPT+TLV++Y  S I   HFDFYR +  +E 
Sbjct: 5   LDGDLGTGKTTLVRSLLRACGH--AGPVKSPTYTLVEIYVISRIYWYHFDFYRFNFPEEF 62

Query: 97  VELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQGKTGR 138
           ++ G  E   ++ IC++EWPE      P   + +     + GR
Sbjct: 63  LDAGLGEYFRDDAICLVEWPEKAAEYGPAPDLVVRFQFAEPGR 105


>gi|195977568|ref|YP_002122812.1| ATP/GTP hydrolase [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|195974273|gb|ACG61799.1| ATP/GTP hydrolase [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
          Length = 147

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 72/125 (57%), Gaps = 3/125 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE   I  G+ +   L+ GD L L+GDLG+GK+ L + I + L  D  ++  SPT+T+ +
Sbjct: 6   NENELIAYGQGIGRQLKAGDVLVLTGDLGAGKTTLTKGIAKGLGIDQMIK--SPTYTIAR 63

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D I +  + +IEW E+        Y++I +++ 
Sbjct: 64  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFIFDGGVTVIEWGELLAEETLHDYLEILITKT 122

Query: 135 KTGRK 139
           +TGR+
Sbjct: 123 ETGRQ 127


>gi|325294953|ref|YP_004281467.1| hypothetical protein Dester_0767 [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065401|gb|ADY73408.1| Uncharacterized protein family UPF0079, ATPase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 159

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 65/103 (63%), Gaps = 7/103 (6%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFL-MHDDALEVLSPTFTLVQLYDASI 80
           LG+ + S + LG  + L+G+LG GK+ L R I + L + +D  E+ SP+F +V  YD+  
Sbjct: 17  LGQIIGSTVPLGTVILLTGELGCGKTALTRGIAKALGIPED--EISSPSFNIVHEYDS-- 72

Query: 81  PVAHFDFYRLSSHQEVVELGFDEI-LNERICIIEWPEIGRSLL 122
            + H D YRL S + + +L F++I L+ERI IIEWP+I    L
Sbjct: 73  -LVHIDLYRLDSVEALEDLSFEDILLDERIKIIEWPQIAAEYL 114


>gi|326564166|gb|EGE14402.1| putative ATPase or kinase [Moraxella catarrhalis 12P80B1]
          Length = 148

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 70/124 (56%), Gaps = 12/124 (9%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E +T  L + LA  + L   + LSGDLG+GK+ L R  ++ + H  A  V SPT+TLV+
Sbjct: 10  SEADTQALAKKLAQ-MNLSGSVWLSGDLGAGKTTLVRYWLQAMGHQGA--VKSPTYTLVE 66

Query: 75  LYDASI-----PVAHFDFYRLSSHQEVVELGFDEILNE--RICIIEWPEIGRSLLPKK-- 125
            Y  ++     PV H D YRL+  +E+  +GF E  +E   + IIEW      +LPK   
Sbjct: 67  PYQINLQGRLKPVYHADLYRLNDPEELDFIGFYEYFDEPNSLVIIEWASRASQVLPKPDY 126

Query: 126 YIDI 129
           +IDI
Sbjct: 127 HIDI 130


>gi|239825789|ref|YP_002948413.1| hypothetical protein GWCH70_0216 [Geobacillus sp. WCH70]
 gi|239806082|gb|ACS23147.1| protein of unknown function UPF0079 [Geobacillus sp. WCH70]
          Length = 152

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 70/135 (51%), Gaps = 8/135 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T+ L       L+  D +TL GDLG+GK+   + + + L       V SPTFT+V+ Y
Sbjct: 12  EETMHLASRFGEQLKAKDVITLEGDLGAGKTTFTKGLAKGLGVRKT--VSSPTFTIVKEY 69

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHL-SQG 134
              +P+ H D YRL    E  +LGFDE  + + + +IEW  +    LP + ++I+L   G
Sbjct: 70  KGRLPLYHMDVYRLEDTME--DLGFDEYFHGDGVTVIEWAHLIEPQLPPERLNIYLFHHG 127

Query: 135 KTGRKATIS--AERW 147
              RK  I    ER+
Sbjct: 128 NDERKLVIEPIGERY 142


>gi|145630636|ref|ZP_01786415.1| hypothetical protein CGSHi22421_01799 [Haemophilus influenzae
           R3021]
 gi|144983762|gb|EDJ91212.1| hypothetical protein CGSHi22421_01799 [Haemophilus influenzae
           R3021]
          Length = 145

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 65/110 (59%), Gaps = 4/110 (3%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEV 96
           L+GDLG+GK+ L R +++ + H     V SPT+TLV+ Y+ A   + HFD YRL+  +E+
Sbjct: 25  LNGDLGAGKTTLTRGMLQGIGHQG--NVKSPTYTLVEEYNIAGKMIYHFDLYRLADPEEL 82

Query: 97  VELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAE 145
             +G  +  N   IC+IEW E G+ +LP+  I +++      R   + A+
Sbjct: 83  EFMGIRDYFNTNSICLIEWSEKGQGILPEADILVNIDYYDDARNIELIAQ 132


>gi|327467123|gb|EGF12633.1| ATP/GTP hydrolase [Streptococcus sanguinis SK330]
          Length = 146

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 75/125 (60%), Gaps = 3/125 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I  G+ L ++L+ GD L L+GDLG+GK+   + +   L  +  ++  SPT+T+V+
Sbjct: 5   NEEELIQWGQRLGTLLQAGDVLVLTGDLGAGKTTFTKGLALGLGINQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  E + +IEW E+ R  LP+ Y+ + L + 
Sbjct: 63  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFLFGEGVTVIEWGELLRENLPEDYLKLSLLKK 121

Query: 135 KTGRK 139
           K GR+
Sbjct: 122 KDGRE 126


>gi|167854573|ref|ZP_02477354.1| hypothetical protein HPS_02314 [Haemophilus parasuis 29755]
 gi|219872208|ref|YP_002476583.1| putative ATPase [Haemophilus parasuis SH0165]
 gi|167854328|gb|EDS25561.1| hypothetical protein HPS_02314 [Haemophilus parasuis 29755]
 gi|219692412|gb|ACL33635.1| predicted ATPase or kinase [Haemophilus parasuis SH0165]
          Length = 162

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 4/120 (3%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASI 80
           L R+L +       + L+G+LG+GK+ L RSI+R   H+    V SPT+TLV+ Y     
Sbjct: 23  LQRYLDNHNEKSVVIYLNGELGAGKTTLTRSIVRAFGHNG--NVKSPTYTLVEEYQLPPY 80

Query: 81  PVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRK 139
            + HFD YRLS  +E+  +G  D    + +C++EW   G  ++P     I +   +TGR 
Sbjct: 81  ALYHFDLYRLSDPEELEFMGIRDYFRPQTVCLLEWASRGEGMIPSADFIIQIDYAETGRN 140


>gi|321314246|ref|YP_004206533.1| putative ATPase or kinase UPF0079 [Bacillus subtilis BSn5]
 gi|320020520|gb|ADV95506.1| putative ATPase or kinase UPF0079 [Bacillus subtilis BSn5]
          Length = 158

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 70/133 (52%), Gaps = 7/133 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N + T  + +  AS  + GD LTL GDLG+GK+   +     L       V SPTFT+++
Sbjct: 10  NPEETKAIAKLTASFAKPGDVLTLEGDLGAGKTTFTKGFAEGLGITRV--VNSPTFTIIK 67

Query: 75  LY-DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y D  +P+ H D YR+    E  +LG DE    + +C++EW  +    LP++ + I + 
Sbjct: 68  EYNDGVLPLYHMDVYRMEDESE--DLGLDEYFHGQGVCLVEWAHLIEEQLPQERLQIVIK 125

Query: 133 Q-GKTGRKATISA 144
           + G   R+ T +A
Sbjct: 126 RAGDDEREITFTA 138


>gi|21231738|ref|NP_637655.1| hypothetical protein XCC2300 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66768136|ref|YP_242898.1| hypothetical protein XC_1815 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188991273|ref|YP_001903283.1| hypothetical protein xccb100_1878 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21113442|gb|AAM41579.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573468|gb|AAY48878.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167733033|emb|CAP51231.1| Conserved hypothetical protein [Xanthomonas campestris pv.
           campestris]
          Length = 166

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 71/137 (51%), Gaps = 10/137 (7%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-- 76
           T  +G+ LA+       + L GDLG+GKS LAR+++R L     +   SPT+TLV+ Y  
Sbjct: 14  TEQVGQALAATRPATAVVQLHGDLGAGKSTLARALLRALGVTGPIR--SPTYTLVERYPL 71

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKT 136
            A     H D YR+    E+  LG DE  +  + ++EWPE G   LP   +++ L+    
Sbjct: 72  TAGGEAWHLDLYRIGHAGELDFLGLDEG-SATLWLVEWPERGAGALPAADLEVELAVAGE 130

Query: 137 GRKATI-----SAERWI 148
           GR  T+     S + W+
Sbjct: 131 GRALTLRGASPSGQAWV 147


>gi|33598136|ref|NP_885779.1| hypothetical protein BPP3620 [Bordetella parapertussis 12822]
 gi|33603029|ref|NP_890589.1| hypothetical protein BB4055 [Bordetella bronchiseptica RB50]
 gi|33566694|emb|CAE38904.1| conserved hypothetical protein [Bordetella parapertussis]
 gi|33568660|emb|CAE34418.1| conserved hypothetical protein [Bordetella bronchiseptica RB50]
          Length = 178

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 77/140 (55%), Gaps = 10/140 (7%)

Query: 13  IPNEKNTICLGRHLASIL------RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
           +P+E  T  L R LA ++      + G  + L GDLG+GK+   R+++R         + 
Sbjct: 12  LPDEAATEDLARQLAPLVDGRRGGQPGGQIHLQGDLGAGKTAFTRALLRECGIQG--RIK 69

Query: 67  SPTFTLVQLYDAS-IPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPK 124
           SP++ L++ Y  S +   H DFYR S  +E ++ GF ++L ++ + +IEWPE    LLP 
Sbjct: 70  SPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAGFRDLLRDDAVVLIEWPERAAGLLPP 129

Query: 125 KYIDIHLSQGKTGRKATISA 144
             + I L+    GR A+++A
Sbjct: 130 PDLLISLAYADQGRDASLTA 149


>gi|145588781|ref|YP_001155378.1| hypothetical protein Pnuc_0596 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047187|gb|ABP33814.1| protein of unknown function UPF0079 [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 176

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 70/134 (52%), Gaps = 16/134 (11%)

Query: 15  NEKNTICLGRHLASIL--------RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVL 66
            E +T  L + LA+ L        +    ++L GDLG+GK+  AR +I+ + ++   +V 
Sbjct: 18  QEADTAALAKFLAATLWHYLVQSPQKHLNISLKGDLGAGKTTFARYLIQAMGYEG--KVK 75

Query: 67  SPTFTL-----VQLYDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRS 120
           SPT+TL     ++L    I + HFD YR+    E  E GF+E  +   IC+IEWPE    
Sbjct: 76  SPTYTLCEPYQIELKQQEITIHHFDLYRMRDPLEWQEAGFEEHFDIPGICLIEWPEKAEG 135

Query: 121 LLPKKYIDIHLSQG 134
            LP   + I L+ G
Sbjct: 136 TLPAFDLQIQLTAG 149


>gi|194335269|ref|YP_002017063.1| protein of unknown function UPF0079 [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194307746|gb|ACF42446.1| protein of unknown function UPF0079 [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 145

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 58/100 (58%), Gaps = 8/100 (8%)

Query: 23  GRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASI-- 80
            R  A+ L+ GD ++L G LG+GK+   R +  +   DD L   SPTF L+ +Y+ S+  
Sbjct: 17  ARRFAATLQPGDMVSLCGQLGAGKTEFMRGVTEYFNCDDQLS--SPTFPLLNIYEGSLDG 74

Query: 81  -PVA--HFDFYRLSSHQEVVELGFDEILNE-RICIIEWPE 116
            PV   HFD YR++S QE+  +GFDE L+      +EW +
Sbjct: 75  EPVTLHHFDLYRINSQQELEGIGFDEYLSSGDFSFVEWAD 114


>gi|67922622|ref|ZP_00516128.1| Protein of unknown function UPF0079 [Crocosphaera watsonii WH 8501]
 gi|67855550|gb|EAM50803.1| Protein of unknown function UPF0079 [Crocosphaera watsonii WH 8501]
          Length = 160

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 73/140 (52%), Gaps = 11/140 (7%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           V+ + N + T  LG+ L   L     L L GDLG+GK+ L + I   L   DA  ++SPT
Sbjct: 7   VLMLANFEATKALGQKLGQNLPERSVLLLKGDLGAGKTTLVQGIGEGLGITDA--IVSPT 64

Query: 70  FTLVQLY-DASIPVAHFDFYRLSSHQEVVELGFDEILNE-----RICIIEWPEIGRSLLP 123
           FTL+  Y    +P+ H D YRL   + V EL  ++   E      I  IEWPE   S LP
Sbjct: 65  FTLINEYHQGRLPLYHLDLYRLEP-EAVAELYLEQYWEEGEALPGITAIEWPE-KLSYLP 122

Query: 124 KKYIDIHLSQGK-TGRKATI 142
             Y+ I LS  + TGR+A +
Sbjct: 123 LNYLQIQLSYSEGTGRQAIL 142


>gi|89902071|ref|YP_524542.1| hypothetical protein Rfer_3302 [Rhodoferax ferrireducens T118]
 gi|89346808|gb|ABD71011.1| protein of unknown function UPF0079 [Rhodoferax ferrireducens T118]
          Length = 183

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 79/154 (51%), Gaps = 11/154 (7%)

Query: 1   MNFSEKHLTVIP---IPNEKNTICLGRHLASILRLGDC-LTLSGDLGSGKSFLARSIIRF 56
           MN    H  ++     PNE  T      LA+   L D  + L G+LG+GK+ L R ++R 
Sbjct: 1   MNIEVGHRPIVKSLLWPNENATRDFAVALANAPALRDAFIELQGELGAGKTTLVRHLLRA 60

Query: 57  LMHDDALEVLSPTFTLVQLY---DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICII 112
           L       V SPT+ +V+ Y   D ++ V HFDFYR S  +E  + GF +I  +  + + 
Sbjct: 61  LGVPG--RVKSPTYAVVEPYELADRNLNVWHFDFYRFSDPREWEDAGFRDIFASSGLKLA 118

Query: 113 EWPEIGRSLLPKKYIDIHLSQ-GKTGRKATISAE 145
           EWP+     LP+  + IHL    +  R+ T++A+
Sbjct: 119 EWPQKAAGFLPRADLIIHLEAVTEASRQVTLTAQ 152


>gi|186475288|ref|YP_001856758.1| hypothetical protein Bphy_0520 [Burkholderia phymatum STM815]
 gi|184191747|gb|ACC69712.1| protein of unknown function UPF0079 [Burkholderia phymatum STM815]
          Length = 184

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 8/93 (8%)

Query: 36  LTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY-----DASIPVAHFDFYRL 90
           + L GDLG+GK+ L R+ +R L H  A  V SPT+TLV+ Y     D  + + HFD YR 
Sbjct: 60  VQLHGDLGAGKTTLVRATLRALGH--AGRVRSPTYTLVEPYAVERPDGELELYHFDLYRF 117

Query: 91  SSHQEVVELGFDEILNE-RICIIEWPEIGRSLL 122
           +   E  + GF E  +   IC++EWPE   SLL
Sbjct: 118 NDPAEWADAGFREYFDSGAICLVEWPERAGSLL 150


>gi|330999387|ref|ZP_08323104.1| hydrolase, P-loop family [Parasutterella excrementihominis YIT
           11859]
 gi|329575245|gb|EGG56796.1| hydrolase, P-loop family [Parasutterella excrementihominis YIT
           11859]
          Length = 165

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 76/162 (46%), Gaps = 13/162 (8%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLA--------SILRLGDCLTLSGDLGSGKSFLARS 52
           MN ++ H     + +E+ T  LG  LA         IL  G  + L GDLG+GK++L RS
Sbjct: 1   MN-TDAHSLEFHLADEEATSELGARLARALDSVKSEILEKGLNIKLVGDLGAGKTYLMRS 59

Query: 53  IIRFLMHDDALEVLSPTFTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNE-RIC 110
            +R L  +    V SPTF+L++ Y      V HFDFYR     E  E GF E     R+ 
Sbjct: 60  ALRALGFEG--RVKSPTFSLLETYKVDGFTVNHFDFYRFEDPVEFEEAGFRENYGPGRVV 117

Query: 111 IIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAERWIISHI 152
             EW       +P+  + I L     GR   ISA+  + + +
Sbjct: 118 ASEWTSKAEPFVPQPDLTITLKNEGDGRVCDISADSALGNQV 159


>gi|299065849|emb|CBJ37028.1| conserved protein of unknown function, UPF0079 [Ralstonia
           solanacearum CMR15]
          Length = 186

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 61/101 (60%), Gaps = 10/101 (9%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-----ASIPVAHFDFYRLSS 92
           LSGDLG+GK+ L+R+I+  L H  A  V SPT+TLV+ Y+      +  V HFD YR   
Sbjct: 50  LSGDLGAGKTTLSRAILHGLGH--AGRVRSPTYTLVEPYEVPGASGTQKVYHFDLYRFVD 107

Query: 93  HQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHLS 132
            +E  + GF +   E  +C++EWPE  ++LL     D+H++
Sbjct: 108 PEEWTDAGFRDCFAEPALCLVEWPEKAQALL--GTPDLHIA 146


>gi|15837360|ref|NP_298048.1| hypothetical protein XF0758 [Xylella fastidiosa 9a5c]
 gi|9105650|gb|AAF83568.1|AE003917_2 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 162

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 77/144 (53%), Gaps = 14/144 (9%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY---DA 78
           LG  LA    L   L+L GD+G+GKS LAR+++R L    A+   SPT+TLV+ Y   D 
Sbjct: 15  LGMVLAHSRPLPAVLSLQGDIGAGKSTLARALLRALGVTGAIR--SPTYTLVERYVLADG 72

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEILNERIC-IIEWPEIGRSLLPKKYIDIHLSQGKTG 137
                H D YR+ +  E+  LG DE  +E +  ++EWPE G   LP   +++ L+    G
Sbjct: 73  G-EAWHLDLYRIGNAAELDFLGLDE--DEVVLWLVEWPERGAGALPSFDLEVALAIEGAG 129

Query: 138 RKATISA-----ERWIISHINQMN 156
           R+  + A     E W+ + + +M 
Sbjct: 130 RRVRLRACSTQGEVWLAAAVIKMQ 153


>gi|330872245|gb|EGH06394.1| hypothetical protein Pgy4_01760 [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 103

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E+  +  G  LA++      + L GDLG+GK+ L+R +IR   H  A++  SPTFTLV+
Sbjct: 3   GEEAMMNFGARLAAVTEGVGVIFLDGDLGAGKTTLSRGMIRGFGHAGAVK--SPTFTLVE 60

Query: 75  LYD-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWP 115
            Y+  ++ V HFD YRL   +E+  +G  D    + +C+IEWP
Sbjct: 61  PYEIGAVRVFHFDLYRLVDPEELEYMGGRDYFDGDALCLIEWP 103


>gi|225387170|ref|ZP_03756934.1| hypothetical protein CLOSTASPAR_00922 [Clostridium asparagiforme
           DSM 15981]
 gi|225046718|gb|EEG56964.1| hypothetical protein CLOSTASPAR_00922 [Clostridium asparagiforme
           DSM 15981]
          Length = 142

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 64/119 (53%), Gaps = 4/119 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  LG+ LA   + G    L GDLG GK+   +   R L       V SPTFT+VQ Y
Sbjct: 9   QETFELGKRLAEAAKPGQVYCLDGDLGVGKTVFTQGFARGLGITGP--VNSPTFTIVQQY 66

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
           +   +P+ HFD YR+    E+ E+G+++      + +IEW E+   LLP++ + + + +
Sbjct: 67  EEGRLPLYHFDVYRIGDISEMDEIGYEDCFYGSGVSLIEWSELIEELLPERAVHVTIEK 125


>gi|317056875|ref|YP_004105342.1| hypothetical protein Rumal_2222 [Ruminococcus albus 7]
 gi|315449144|gb|ADU22708.1| Uncharacterized protein family UPF0079, ATPase [Ruminococcus albus
           7]
          Length = 158

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 67/121 (55%), Gaps = 6/121 (4%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + TI LGR +   L  GD L   G LG+GK+ + R I   +   D  EV SPTF LV  Y
Sbjct: 16  EQTIALGREIGRRLHGGDVLAYRGGLGAGKTTITRGISEGMGLGD--EVTSPTFALVNEY 73

Query: 77  ---DASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHLS 132
              D+ + + HFD YR++S +++   GF + ++E  +  +EW E     LP++ I I ++
Sbjct: 74  RKTDSKLSLIHFDMYRITSGEDLETTGFFDYMDEDTVLAVEWSENIEDELPEECIRITIN 133

Query: 133 Q 133
           +
Sbjct: 134 R 134


>gi|294011632|ref|YP_003545092.1| putative ATPase [Sphingobium japonicum UT26S]
 gi|292674962|dbj|BAI96480.1| putative ATPase [Sphingobium japonicum UT26S]
          Length = 152

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 62/105 (59%), Gaps = 5/105 (4%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
            E   +  GR LA+ +R+GD + L G LG+GK+ LAR ++  L      E  SP+F +VQ
Sbjct: 10  GEGEMLAFGRRLAAFVRIGDVIALEGGLGAGKTTLARGLLEGLGL--EGEAPSPSFAIVQ 67

Query: 75  LYD---ASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPE 116
            YD    S+PVAH D YRL   +E  EL  DE L + + I+EWP+
Sbjct: 68  PYDIPEVSLPVAHVDLYRLDGPEEAEELALDEYLTDSLLIVEWPD 112


>gi|65317685|ref|ZP_00390644.1| COG0802: Predicted ATPase or kinase [Bacillus anthracis str. A2012]
          Length = 160

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 64/122 (52%), Gaps = 5/122 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I   + + T  L   L  ++R  D + L GDLG+GK+   + + + L       V SPTF
Sbjct: 9   ITTKSSEETQKLSEKLGELVRAQDVIILEGDLGAGKTTFTKGLAKGLGVKRV--VNSPTF 66

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDI 129
            +++ Y   +P+ H D YRL+  +E  +LGFDE    E I ++EW  +  + LP + + I
Sbjct: 67  NIIKEYKGRLPLYHMDVYRLAESEE--DLGFDEYFYGEGITVVEWAHLIEAYLPNEKLQI 124

Query: 130 HL 131
            L
Sbjct: 125 SL 126


>gi|297181696|gb|ADI17878.1| predicted ATPase or kinase [uncultured Chloroflexi bacterium
           HF0200_06I16]
          Length = 164

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 66/136 (48%), Gaps = 3/136 (2%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I  PN   T  LG  +   +  GD + L+G+LGSGK+ L + I R L       V SPTF
Sbjct: 7   IQSPNADFTQELGIVIGETVSAGDVILLTGELGSGKTCLTQGIARGLGVQGY--VRSPTF 64

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDI 129
            L+  +   + + H D YR+ S  E  +LG DE +  E +C+IEW +    + P+  + I
Sbjct: 65  VLMTRHHGRLTLHHVDLYRMGSPAEAWDLGLDEQLFGEGLCVIEWADRAVEIFPEDCLWI 124

Query: 130 HLSQGKTGRKATISAE 145
               G       I+ E
Sbjct: 125 DFDYGSDSHSRYITLE 140


>gi|303232650|ref|ZP_07319335.1| conserved hypothetical protein [Atopobium vaginae PB189-T1-4]
 gi|302481136|gb|EFL44211.1| conserved hypothetical protein [Atopobium vaginae PB189-T1-4]
          Length = 1036

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 72/135 (53%), Gaps = 4/135 (2%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + TI LG      L  GD + L+GDLG+GK+   + I + +   D  +V SPTFT+  +Y
Sbjct: 26  QETINLGSIFGGCLTAGDIVVLTGDLGAGKTQFTKGIAQGMHIQD--DVTSPTFTIEMVY 83

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQG 134
           +   +P+ HFD YRLS   ++ + G  ++L+ +  CIIEW E     +    +D+ +++ 
Sbjct: 84  EGGDMPLYHFDLYRLSDPLQLEDTGLYDVLDSDGPCIIEWGEQFSDEIGSNRVDVTITRN 143

Query: 135 KTGRKATISAERWII 149
           +         ER ++
Sbjct: 144 EVDATTQDEPERTLV 158


>gi|257438569|ref|ZP_05614324.1| ATP/GTP hydrolase [Faecalibacterium prausnitzii A2-165]
 gi|257199148|gb|EEU97432.1| ATP/GTP hydrolase [Faecalibacterium prausnitzii A2-165]
          Length = 175

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 70/131 (53%), Gaps = 5/131 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           + + T+ LGR LA++L  G  +  +G LG+GK+     +   L   D   V SPTF +V 
Sbjct: 42  SREETVALGRKLAAVLPDGALIAFTGGLGAGKTAFCEGLAEGLGCTDP--VSSPTFAIVN 99

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLL-PKKYIDIHLS 132
            Y    P+AHFD YR+S+  ++   GF + L++  I   EW E    LL P+  I I++ 
Sbjct: 100 YYRGPRPLAHFDLYRISTENDLCAAGFYDYLDQGAIVAAEWSENFADLLAPEDPIYINID 159

Query: 133 Q-GKTGRKATI 142
           +   T R+ TI
Sbjct: 160 RVDDTTRRITI 170


>gi|258405824|ref|YP_003198566.1| hypothetical protein Dret_1704 [Desulfohalobium retbaense DSM 5692]
 gi|257798051|gb|ACV68988.1| protein of unknown function UPF0079 [Desulfohalobium retbaense DSM
           5692]
          Length = 168

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 70/143 (48%), Gaps = 15/143 (10%)

Query: 10  VIPIPNEKNTICLGRHLASILRLGDC--LTLSGDLGSGKSFLARSIIRFLMHDDALEVLS 67
             P+ NE+ T  LG+ LA+         L L G+LG+GK+ L R+++R L      EV S
Sbjct: 6   CFPLANEEETQRLGQCLAACHEAWQACILLLDGELGAGKTTLVRALVRALPGGGGAEVSS 65

Query: 68  PTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERI------CIIEWPE-IGRS 120
           P+F +  +Y     +AHFD YRL       + G DE L E I       I+EW   + R 
Sbjct: 66  PSFNICNIYPTQPQIAHFDLYRLE------DTGPDESLFEWIEHPGTTVIVEWARFVPRQ 119

Query: 121 LLPKKYIDIHLSQGKTGRKATIS 143
            LP   + +H+    +GR   ++
Sbjct: 120 DLPPDVVTLHIEHTNSGRAVRMT 142


>gi|323486387|ref|ZP_08091712.1| hypothetical protein HMPREF9474_03463 [Clostridium symbiosum
           WAL-14163]
 gi|323694987|ref|ZP_08109135.1| nucleotide-binding protein [Clostridium symbiosum WAL-14673]
 gi|323400369|gb|EGA92742.1| hypothetical protein HMPREF9474_03463 [Clostridium symbiosum
           WAL-14163]
 gi|323500958|gb|EGB16872.1| nucleotide-binding protein [Clostridium symbiosum WAL-14673]
          Length = 142

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 69/136 (50%), Gaps = 8/136 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  LG  L    R G+   L GDLG+GK+   +   + L  +    V SPTFT++Q Y
Sbjct: 9   EETFELGEQLGQKARPGEVYCLDGDLGTGKTVFTQGFAKGLGIEGP--VSSPTFTIIQQY 66

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIH---- 130
           D   +P+ HFD YR+    E+ E+G+++    + + +IEW  +   +LP +   I     
Sbjct: 67  DEGRLPLYHFDVYRIGDISEMDEIGYEDCFYGDGVSLIEWSSLIGEILPDQLTQIRIEKD 126

Query: 131 LSQGKTGRKATISAER 146
           L +G   RK T+   +
Sbjct: 127 LEKGFDYRKITVEERK 142


>gi|145635250|ref|ZP_01790954.1| hypothetical protein CGSHiAA_02541 [Haemophilus influenzae PittAA]
 gi|145267529|gb|EDK07529.1| hypothetical protein CGSHiAA_02541 [Haemophilus influenzae PittAA]
          Length = 145

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 65/110 (59%), Gaps = 4/110 (3%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEV 96
           L+GDLG+GK+ L R +++ + H     V SPT+TLV+ Y+ A   + HFD YRL+  +E+
Sbjct: 25  LNGDLGAGKTTLTRGMLQGIGHQG--NVKSPTYTLVEEYNIAGKMIYHFDLYRLADPEEL 82

Query: 97  VELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAE 145
             +G  +  N   IC+IEW E G+ +LP+  I +++      R   + A+
Sbjct: 83  EFMGIRDYFNTGSICLIEWSEKGQGILPESDILVNIDYYDDARNIELIAQ 132


>gi|118476005|ref|YP_893156.1| kinase [Bacillus thuringiensis str. Al Hakam]
 gi|118415230|gb|ABK83649.1| conserved hypothetical protein [Bacillus thuringiensis str. Al
           Hakam]
          Length = 160

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 64/122 (52%), Gaps = 5/122 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I   + + T  L   L  ++R  D + L GDLG+GK+   + + + L       V SPTF
Sbjct: 9   ITTKSSEETQKLSEKLGELVRAQDVIILEGDLGAGKTTFTKGLAKGLGVKRV--VNSPTF 66

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDI 129
            +++ Y   +P+ H D YRL+  +E  +LGFDE    E I ++EW  +  + LP + + I
Sbjct: 67  NIIKEYKGRLPLYHMDVYRLAESEE--DLGFDEYFYGEGITVVEWAHLIEAYLPNEKLQI 124

Query: 130 HL 131
            L
Sbjct: 125 SL 126


>gi|253576807|ref|ZP_04854133.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251843838|gb|EES71860.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 166

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 69/131 (52%), Gaps = 5/131 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T  L   LA + + G  + L GDLG+GK+  ++   + L   D   V SPTFTL++ Y
Sbjct: 20  QGTERLAEALAKLAQPGTVIALDGDLGAGKTAFSQLFAKHLGVKDT--VNSPTFTLIKEY 77

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ-G 134
           +  +P  H D YRL S  E  ELG DE      + ++EW  +   LLP+  + +++    
Sbjct: 78  EGRLPFYHMDVYRL-SLDEADELGLDEYFYGNGVTLVEWASLIEELLPEDVLRMYIETVS 136

Query: 135 KTGRKATISAE 145
            TGR+  I+ +
Sbjct: 137 ATGRRMHINVQ 147


>gi|315634033|ref|ZP_07889322.1| ATPase with strong ADP affinity [Aggregatibacter segnis ATCC 33393]
 gi|315477283|gb|EFU68026.1| ATPase with strong ADP affinity [Aggregatibacter segnis ATCC 33393]
          Length = 158

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 76/135 (56%), Gaps = 12/135 (8%)

Query: 9   TVIPIPNEKNTIC-LGRHLASIL-----RLGDCLTLSGDLGSGKSFLARSIIRFLMHDDA 62
           T+I   +++N +C  G+ L   +       G  L L+G+LG+GK+ L+R +I+ L +   
Sbjct: 4   TLIQYISDENAMCDFGKKLIDAICQVPNHKGITLYLNGELGAGKTTLSRGMIQALGYQG- 62

Query: 63  LEVLSPTFTLVQLYDASIP-VAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRS 120
             V SPT+TLV+ Y  S   + HFD YRLS  +E+  +G  +   E  IC+IEW E G  
Sbjct: 63  -NVKSPTYTLVEEYKISGKNIYHFDLYRLSDPEELEFMGIRDYFAENTICLIEWAEKGVG 121

Query: 121 LL--PKKYIDIHLSQ 133
           LL  P   ++IH ++
Sbjct: 122 LLSAPDLLVNIHYAK 136


>gi|300726851|ref|ZP_07060281.1| conserved hypothetical protein [Prevotella bryantii B14]
 gi|299775964|gb|EFI72544.1| conserved hypothetical protein [Prevotella bryantii B14]
          Length = 137

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 62/115 (53%), Gaps = 8/115 (6%)

Query: 31  RLGD--CLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASI---PVAHF 85
            LGD       G +G+GK+   ++I   L  DD   + SPTF +V  Y ++    P+ HF
Sbjct: 21  NLGDNKIFAFYGKMGAGKTTFIKAICEALDVDDV--ITSPTFAIVNEYTSNKLGEPIYHF 78

Query: 86  DFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRK 139
           DFYR+    EV ++G+ D   +  +C +EWPE+   LLP+  + + ++  + G +
Sbjct: 79  DFYRIKKLDEVYDMGYEDYFYSGNLCFLEWPELIEDLLPEDAVKVTITANEDGTR 133


>gi|168494720|ref|ZP_02718863.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC3059-06]
 gi|183575366|gb|EDT95894.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC3059-06]
          Length = 147

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 70/132 (53%), Gaps = 5/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+    LG  L  +L   D + L+G+LG+GK+   + + + L     ++  SPT+T+V+
Sbjct: 5   NEEELQALGERLGHLLAKNDVVILTGELGAGKTTFTKGLAKGLQISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE I    + +IEW  +    LP  Y+++ + +
Sbjct: 63  EYEGRLPLYHLDVYRIEGDADSIDL--DEFIFGGGVTVIEWGNLLGDALPDAYLELEILK 120

Query: 134 GKTGRKATISAE 145
              GR+    A+
Sbjct: 121 EADGRRLNFQAK 132


>gi|30260434|ref|NP_842811.1| hypothetical protein BA_0258 [Bacillus anthracis str. Ames]
 gi|47525517|ref|YP_016866.1| hypothetical protein GBAA_0258 [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49183276|ref|YP_026528.1| hypothetical protein BAS0244 [Bacillus anthracis str. Sterne]
 gi|165873321|ref|ZP_02217925.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           A0488]
 gi|167634242|ref|ZP_02392564.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           A0442]
 gi|167640103|ref|ZP_02398370.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           A0193]
 gi|170687727|ref|ZP_02878942.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           A0465]
 gi|170709441|ref|ZP_02899847.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           A0389]
 gi|177655766|ref|ZP_02937041.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           A0174]
 gi|190567359|ref|ZP_03020273.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis
           Tsiankovskii-I]
 gi|227812925|ref|YP_002812934.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           CDC 684]
 gi|229601798|ref|YP_002864884.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           A0248]
 gi|254686654|ref|ZP_05150512.1| hypothetical protein BantC_22820 [Bacillus anthracis str.
           CNEVA-9066]
 gi|254724721|ref|ZP_05186504.1| hypothetical protein BantA1_20009 [Bacillus anthracis str. A1055]
 gi|254735449|ref|ZP_05193157.1| hypothetical protein BantWNA_09826 [Bacillus anthracis str. Western
           North America USA6153]
 gi|254744193|ref|ZP_05201875.1| hypothetical protein BantKB_24851 [Bacillus anthracis str. Kruger
           B]
 gi|254756021|ref|ZP_05208052.1| hypothetical protein BantV_26444 [Bacillus anthracis str. Vollum]
 gi|254761671|ref|ZP_05213689.1| hypothetical protein BantA9_25454 [Bacillus anthracis str.
           Australia 94]
 gi|30253755|gb|AAP24297.1| ATPase, YjeE family [Bacillus anthracis str. Ames]
 gi|47500665|gb|AAT29341.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49177203|gb|AAT52579.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           Sterne]
 gi|164710941|gb|EDR16514.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           A0488]
 gi|167511914|gb|EDR87293.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           A0193]
 gi|167530556|gb|EDR93271.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           A0442]
 gi|170125645|gb|EDS94566.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           A0389]
 gi|170668254|gb|EDT19002.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           A0465]
 gi|172079995|gb|EDT65097.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           A0174]
 gi|190561486|gb|EDV15457.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis
           Tsiankovskii-I]
 gi|227006333|gb|ACP16076.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           CDC 684]
 gi|229266206|gb|ACQ47843.1| conserved hypothetical protein TIGR00150 [Bacillus anthracis str.
           A0248]
          Length = 157

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 64/122 (52%), Gaps = 5/122 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I   + + T  L   L  ++R  D + L GDLG+GK+   + + + L       V SPTF
Sbjct: 6   ITTKSSEETQKLSEKLGELVRAQDVIILEGDLGAGKTTFTKGLAKGLGVKRV--VNSPTF 63

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDI 129
            +++ Y   +P+ H D YRL+  +E  +LGFDE    E I ++EW  +  + LP + + I
Sbjct: 64  NIIKEYKGRLPLYHMDVYRLAESEE--DLGFDEYFYGEGITVVEWAHLIEAYLPNEKLQI 121

Query: 130 HL 131
            L
Sbjct: 122 SL 123


>gi|257792584|ref|YP_003183190.1| hypothetical protein Elen_2855 [Eggerthella lenta DSM 2243]
 gi|317488872|ref|ZP_07947402.1| Holliday junction ATP-dependent DNA helicase ruvB [Eggerthella sp.
           1_3_56FAA]
 gi|325832758|ref|ZP_08165521.1| hydrolase, P-loop family [Eggerthella sp. HGA1]
 gi|257476481|gb|ACV56801.1| protein of unknown function UPF0079 [Eggerthella lenta DSM 2243]
 gi|316911946|gb|EFV33525.1| Holliday junction ATP-dependent DNA helicase ruvB [Eggerthella sp.
           1_3_56FAA]
 gi|325485897|gb|EGC88358.1| hydrolase, P-loop family [Eggerthella sp. HGA1]
          Length = 164

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 69/128 (53%), Gaps = 4/128 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           + + T  L   LA  L+ GD + LSGDLG+GK+   + +   L   D  +V SPTF ++ 
Sbjct: 6   SSEATKQLAATLAPYLQAGDVIVLSGDLGAGKTQFVQGVAAGLGVRD--QVTSPTFNILL 63

Query: 75  LYDA-SIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y A S+P+ HFD YRL    E+ ++G+ E ++ +    +EW E     LP  Y++I + 
Sbjct: 64  TYPAGSLPLYHFDLYRLEEADELEDIGYYETIDGDGASFVEWGEKFPEALPYGYLEISIR 123

Query: 133 QGKTGRKA 140
               G ++
Sbjct: 124 VDDEGNRS 131


>gi|54401395|gb|AAV34489.1| conserved hypothetical protein [uncultured proteobacterium
           RedeBAC7D11]
          Length = 150

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 64/109 (58%), Gaps = 6/109 (5%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-IPVAHFDFYRLSSHQEV 96
           LSGDLG+GK+ L + ++ +L  ++ +   SPTFTL++ Y+ + + + H D YR+    E+
Sbjct: 36  LSGDLGTGKTTLVKEVLNYLGIENFIN--SPTFTLIEPYEINDLKIFHIDLYRVEKITEL 93

Query: 97  VELGFDEILNE--RICIIEWPEIGRSLLPKKYIDIHLS-QGKTGRKATI 142
             +G +E L E   I  IEWPE G   L + +I I L   G+T RK  +
Sbjct: 94  SAIGLEEYLQEANSISFIEWPEKGSGFLKEPHIAISLDHHGETTRKCKV 142


>gi|291544336|emb|CBL17445.1| conserved hypothetical nucleotide-binding protein [Ruminococcus sp.
           18P13]
          Length = 150

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 67/124 (54%), Gaps = 6/124 (4%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           + + TI L   +  +LR GD +  +G+LG+GK+   R I R +   D  EV SPTF LV 
Sbjct: 9   SPEETIALAEAIGRLLRKGDVIAYTGELGAGKTTFTRGIARGMGLPD--EVHSPTFALVN 66

Query: 75  LY---DASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIH 130
            Y     + P+ HFD YR++  + +   GF D  L++ +  IEW E     LP++ + I 
Sbjct: 67  EYLGKPGTTPLYHFDMYRITLPEALESTGFYDYPLSDSVFAIEWSENIPYALPEQCLRIG 126

Query: 131 LSQG 134
           ++ G
Sbjct: 127 IAYG 130


>gi|88658287|ref|YP_506843.1| P-loop hydrolase family protein [Ehrlichia chaffeensis str.
           Arkansas]
 gi|88599744|gb|ABD45213.1| P-loop hydrolase family protein [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 155

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 66/104 (63%), Gaps = 7/104 (6%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDA--LEVLSPTFTLVQLYDAS 79
           L R +A  L+ GD ++L GDLG GK+    + +RFL+H  A   +V SPTF+++  Y ++
Sbjct: 17  LARFIALGLKKGDSISLVGDLGVGKT----TFVRFLVHALAPCEDVGSPTFSIINEYHSN 72

Query: 80  -IPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLL 122
              + H D YR++S +EV +LG + I ++ + IIEWP++   +L
Sbjct: 73  KFTIYHIDLYRINSLREVYDLGIESICDDGVGIIEWPDLLNDIL 116


>gi|225869928|ref|YP_002745875.1| P-loop hydrolase [Streptococcus equi subsp. equi 4047]
 gi|225699332|emb|CAW92718.1| putative P-loop hydrolase [Streptococcus equi subsp. equi 4047]
          Length = 147

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 71/125 (56%), Gaps = 3/125 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE   I  G+ +   L+ GD L L+GDLG+GK+ L + + + L  D  ++  SPT+T+ +
Sbjct: 6   NENELIAYGQGIGRQLKAGDVLVLTGDLGAGKTTLTKGVAKGLGIDQMIK--SPTYTIAR 63

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D I    + +IEW E+        Y++I +++ 
Sbjct: 64  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFIFGGGVTVIEWGELLAKGTLHDYLEILITKT 122

Query: 135 KTGRK 139
           +TGR+
Sbjct: 123 ETGRQ 127


>gi|317153452|ref|YP_004121500.1| hypothetical protein Daes_1742 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943703|gb|ADU62754.1| Uncharacterized protein family UPF0079, ATPase [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 166

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 75/138 (54%), Gaps = 8/138 (5%)

Query: 13  IPNEKNTICLGRHLASILR---LGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPT 69
           + +E+ T  LG+ +A++L        L L G LGSGK+ L R ++  L   +  EV SP+
Sbjct: 4   LADERATRELGKAMAAVLAGTVWPPALLLQGVLGSGKTTLVRGLVGALPGSELAEVSSPS 63

Query: 70  FTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNER--ICIIEWPE-IGRSLLPKKY 126
           F +  LY  + PVAH+D YRL +     + G  E L +R  + ++EW + + R L P++ 
Sbjct: 64  FNICNLYPTTPPVAHYDLYRLENMPP--DEGLLERLEDRDTLLVVEWAQFLDRELWPEEA 121

Query: 127 IDIHLSQGKTGRKATISA 144
           + +  S  +TGR   + A
Sbjct: 122 LVLTWSPTRTGRTLDMHA 139


>gi|296113126|ref|YP_003627064.1| uncharacterized protein family (UPF0079) family protein [Moraxella
           catarrhalis RH4]
 gi|295920820|gb|ADG61171.1| uncharacterized protein family (UPF0079) family protein [Moraxella
           catarrhalis RH4]
          Length = 148

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 70/124 (56%), Gaps = 12/124 (9%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E +T  L   LA +  LG  + LSGDLG+GK+ L R  ++ + H  A  V SPT+TLV+
Sbjct: 10  SEADTQALAETLAQMNLLG-SVWLSGDLGAGKTTLVRYWLQAMGHQGA--VKSPTYTLVE 66

Query: 75  LYDASI-----PVAHFDFYRLSSHQEVVELGFDEILNE--RICIIEWPEIGRSLLPKK-- 125
            Y  ++     PV H D YRL+  +E+  +GF E  +E   + IIEW      +LPK   
Sbjct: 67  PYQINLQGRLKPVYHADLYRLNDPEELDFIGFYEYFDEPNSLVIIEWASRASQVLPKPDY 126

Query: 126 YIDI 129
           +IDI
Sbjct: 127 HIDI 130


>gi|227872844|ref|ZP_03991155.1| possible ATP-binding protein [Oribacterium sinus F0268]
 gi|227841314|gb|EEJ51633.1| possible ATP-binding protein [Oribacterium sinus F0268]
          Length = 144

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 71/130 (54%), Gaps = 7/130 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E+ +  L   L    + G+   L GDLG GK+  A+   + L   + ++  SPTFT+V+
Sbjct: 7   SEEESYQLAFRLGQEAKKGEIYCLEGDLGVGKTVFAKGFAKGLGVSENVD--SPTFTIVK 64

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKK----YIDI 129
            Y     + HFD YR+   +E+ E+GF ++L+ E I ++EW    R  +P +    YI+ 
Sbjct: 65  EYQGREQLYHFDLYRIVDPEELWEIGFQDMLSGEGIALMEWASQVREDIPPEAKWIYIEK 124

Query: 130 HLSQGKTGRK 139
            LSQG + R+
Sbjct: 125 DLSQGFSFRR 134


>gi|49476751|ref|YP_034584.1| hypothetical protein BT9727_0230 [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|196036847|ref|ZP_03104235.1| conserved hypothetical protein TIGR00150 [Bacillus cereus W]
 gi|196041103|ref|ZP_03108399.1| conserved hypothetical protein TIGR00150 [Bacillus cereus
           NVH0597-99]
 gi|196046217|ref|ZP_03113444.1| conserved hypothetical protein TIGR00150 [Bacillus cereus 03BB108]
 gi|218901450|ref|YP_002449284.1| conserved hypothetical protein TIGR00150 [Bacillus cereus AH820]
 gi|225862299|ref|YP_002747677.1| conserved hypothetical protein TIGR00150 [Bacillus cereus 03BB102]
 gi|228912989|ref|ZP_04076631.1| ATP/GTP hydrolase [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
 gi|228925504|ref|ZP_04088596.1| ATP/GTP hydrolase [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|228931750|ref|ZP_04094650.1| ATP/GTP hydrolase [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228944056|ref|ZP_04106438.1| ATP/GTP hydrolase [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|229119914|ref|ZP_04249171.1| ATP/GTP hydrolase [Bacillus cereus 95/8201]
 gi|229182645|ref|ZP_04309889.1| ATP/GTP hydrolase [Bacillus cereus BGSC 6E1]
 gi|301051980|ref|YP_003790191.1| P-loop hydrolase [Bacillus anthracis CI]
 gi|49328307|gb|AAT58953.1| conserved hypothetical protein, uncharacterised P-loop hydrolase
           [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|195990529|gb|EDX54509.1| conserved hypothetical protein TIGR00150 [Bacillus cereus W]
 gi|196022962|gb|EDX61642.1| conserved hypothetical protein TIGR00150 [Bacillus cereus 03BB108]
 gi|196028038|gb|EDX66649.1| conserved hypothetical protein TIGR00150 [Bacillus cereus
           NVH0597-99]
 gi|218540052|gb|ACK92450.1| conserved hypothetical protein TIGR00150 [Bacillus cereus AH820]
 gi|225786685|gb|ACO26902.1| conserved hypothetical protein TIGR00150 [Bacillus cereus 03BB102]
 gi|228600814|gb|EEK58390.1| ATP/GTP hydrolase [Bacillus cereus BGSC 6E1]
 gi|228663528|gb|EEL19111.1| ATP/GTP hydrolase [Bacillus cereus 95/8201]
 gi|228815606|gb|EEM61845.1| ATP/GTP hydrolase [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228827899|gb|EEM73633.1| ATP/GTP hydrolase [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228834142|gb|EEM79687.1| ATP/GTP hydrolase [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|228846643|gb|EEM91653.1| ATP/GTP hydrolase [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
 gi|300374149|gb|ADK03053.1| P-loop hydrolase [Bacillus cereus biovar anthracis str. CI]
          Length = 157

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 64/122 (52%), Gaps = 5/122 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I   + + T  L   L  ++R  D + L GDLG+GK+   + + + L       V SPTF
Sbjct: 6   ITTKSSEETQKLSEKLGELVRAQDVIILEGDLGAGKTTFTKGLAKGLGVKRV--VNSPTF 63

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDI 129
            +++ Y   +P+ H D YRL+  +E  +LGFDE    E I ++EW  +  + LP + + I
Sbjct: 64  NIIKEYKGRLPLYHMDVYRLAESEE--DLGFDEYFYGEGITVVEWAHLIEAYLPNEKLQI 121

Query: 130 HL 131
            L
Sbjct: 122 SL 123


>gi|149021901|ref|ZP_01835888.1| hypothetical protein CGSSp23BS72_00885 [Streptococcus pneumoniae
           SP23-BS72]
 gi|147929939|gb|EDK80927.1| hypothetical protein CGSSp23BS72_00885 [Streptococcus pneumoniae
           SP23-BS72]
          Length = 147

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 70/132 (53%), Gaps = 5/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+    LG  L  +L   D L L+G+LG+GK+   + + + L     ++  SPT+T+V+
Sbjct: 5   NEEELQALGECLGHLLAKNDVLILTGELGAGKTTFTKGLAKGLQISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE I    + +IEW  +    LP  Y+++ + +
Sbjct: 63  EYEGRLPLYHLDVYRIEGDADSIDL--DEFIFGGGVTVIEWGNLLGDALPDAYLELEILK 120

Query: 134 GKTGRKATISAE 145
              GR+    A+
Sbjct: 121 EADGRRLNFQAK 132


>gi|89100192|ref|ZP_01173059.1| hypothetical protein B14911_20070 [Bacillus sp. NRRL B-14911]
 gi|89085042|gb|EAR64176.1| hypothetical protein B14911_20070 [Bacillus sp. NRRL B-14911]
          Length = 151

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 66/125 (52%), Gaps = 5/125 (4%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           T+   + LA  L  GD LTL GDLG+GK+   + +   L       V SPTFT+++ Y  
Sbjct: 14  TMDFSKRLAERLLPGDVLTLEGDLGAGKTTFTKGLAEGL--GVQRNVSSPTFTIIKEYMG 71

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLSQGKTG 137
            +P+ H D YR+    E  +LGFDE    + + ++EW  +    LP++ + I +  G+ G
Sbjct: 72  RMPLYHMDVYRVEDSFE--DLGFDEYFEGKGVTVVEWAHLIEDQLPEERLQIDILHGEAG 129

Query: 138 RKATI 142
            +  I
Sbjct: 130 SRMLI 134


>gi|229917806|ref|YP_002886452.1| hypothetical protein EAT1b_2084 [Exiguobacterium sp. AT1b]
 gi|229469235|gb|ACQ71007.1| protein of unknown function UPF0079 [Exiguobacterium sp. AT1b]
          Length = 149

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 75/134 (55%), Gaps = 8/134 (5%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           T  +   LA+++  G  +TL+GDLG+GK+   +   + L       V SPTFT+++ Y  
Sbjct: 12  TQAVAERLATLVEAGTVITLNGDLGAGKTTFTQGFAKGL--GVTRNVNSPTFTIMKQYKG 69

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQ-GKT 136
            +P+ H D YRL    +  ++G +E +N + + I+EW  +  S LP++ + I + + G  
Sbjct: 70  RLPLYHMDVYRLEDTGD--DIGLEEYINGDGVAIVEWSNLIESSLPEERLAITIERVGDE 127

Query: 137 GRKATI--SAERWI 148
            RK T+  + ER++
Sbjct: 128 ERKLTLAPTGERYV 141


>gi|270293425|ref|ZP_06199634.1| ATP/GTP hydrolase [Streptococcus sp. M143]
 gi|270278274|gb|EFA24122.1| ATP/GTP hydrolase [Streptococcus sp. M143]
          Length = 147

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I LG  L ++L+  D L LSG+LG+GK+   + + + L     ++  SPT+T+V+
Sbjct: 5   NEEELINLGERLGTLLQKNDVLILSGELGAGKTTFTKGLAKGLGIRQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE L    + +IEW  +    LP  Y+++ L +
Sbjct: 63  EYEGRLPLYHLDVYRIEGDADSIDL--DEFLFGGGVTVIEWGHLLGEDLPDSYLELELLK 120

Query: 134 GKTGRKATISAE 145
              GR+   +A+
Sbjct: 121 EAEGRRLYFAAQ 132


>gi|55820430|ref|YP_138872.1| hypothetical protein stu0337 [Streptococcus thermophilus LMG 18311]
 gi|55822314|ref|YP_140755.1| hypothetical protein str0337 [Streptococcus thermophilus CNRZ1066]
 gi|116627254|ref|YP_819873.1| hypothetical protein STER_0376 [Streptococcus thermophilus LMD-9]
 gi|55736415|gb|AAV60057.1| conserved hypothetical protein [Streptococcus thermophilus LMG
           18311]
 gi|55738299|gb|AAV61940.1| conserved hypothetical protein [Streptococcus thermophilus
           CNRZ1066]
 gi|116100531|gb|ABJ65677.1| Predicted ATPase or kinase [Streptococcus thermophilus LMD-9]
 gi|312277738|gb|ADQ62395.1| Predicted ATPase or kinase [Streptococcus thermophilus ND03]
          Length = 147

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 72/125 (57%), Gaps = 3/125 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I +G+ L  +L  GD + LSGDLG+GK+ L + I + L  D +  + SPT+T+V+
Sbjct: 6   NEEELISIGQKLGRLLNSGDIIVLSGDLGAGKTTLTKGIAKGL--DVSQMIKSPTYTIVR 63

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  + + IIEW E+    L   Y+ I ++  
Sbjct: 64  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFLYGDGVTIIEWGELLDESLLGDYLLISITHH 122

Query: 135 KTGRK 139
             GR+
Sbjct: 123 GDGRQ 127


>gi|331267070|ref|YP_004326700.1| UPF superfamily protein [Streptococcus oralis Uo5]
 gi|326683742|emb|CBZ01360.1| UPF superfamily protein [Streptococcus oralis Uo5]
          Length = 147

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 69/125 (55%), Gaps = 5/125 (4%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  + LG  L  +L+  D L L+G+LG+GK+   + + + L  D    + SPT+T+V+
Sbjct: 5   NEEELLALGERLGHLLQKDDVLILTGELGAGKTTFTKGLAKGL--DIRQMIKSPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE L    + +IEW  +    LP  Y+++ + +
Sbjct: 63  EYEGRLPLYHLDVYRIEGDADSIDL--DEFLFGGGVTVIEWGHLLGEDLPDSYLELEILK 120

Query: 134 GKTGR 138
              GR
Sbjct: 121 EADGR 125


>gi|322374977|ref|ZP_08049491.1| ATP/GTP hydrolase [Streptococcus sp. C300]
 gi|321280477|gb|EFX57516.1| ATP/GTP hydrolase [Streptococcus sp. C300]
          Length = 147

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 69/125 (55%), Gaps = 5/125 (4%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  + LG  L  +L+  D L L+G+LG+GK+   + + + L  D    + SPT+T+V+
Sbjct: 5   NEEELLALGERLGHLLQKDDVLILTGELGAGKTTFTKGLAKGL--DIRQMIKSPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE L    + +IEW  +    LP  Y+++ + +
Sbjct: 63  EYEGRLPLYHLDVYRIEGDADSIDL--DEFLFGGGVTVIEWGHLLGEDLPDSYLELEILK 120

Query: 134 GKTGR 138
              GR
Sbjct: 121 EAEGR 125


>gi|294508452|ref|YP_003572510.1| P-loop hydrolase UPF0079 [Salinibacter ruber M8]
 gi|294344780|emb|CBH25558.1| Uncharacterized P-loop hydrolase UPF0079 [Salinibacter ruber M8]
          Length = 163

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 70/131 (53%), Gaps = 4/131 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           ++T+ LG  +A  L  G  + L GDLG+GK+   + + + L    A EV SPTFT++ ++
Sbjct: 24  EDTMALGARIAQGLPPGAVVALYGDLGTGKTHFVKGVAQGLGLPPA-EVRSPTFTILAVH 82

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ- 133
           D    P+ HFD YR+ +  E VELGF+  +  + +  IEW      LLP   + +     
Sbjct: 83  DDGDRPLYHFDAYRVQTPDEFVELGFETYVHGDGLTCIEWAGRVADLLPADTVPLQFHHV 142

Query: 134 GKTGRKATISA 144
             + R+ T+ A
Sbjct: 143 APSTRRVTLGA 153


>gi|332886156|gb|EGK06400.1| hypothetical protein HMPREF9456_00274 [Dysgonomonas mossii DSM
           22836]
          Length = 138

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 69/124 (55%), Gaps = 8/124 (6%)

Query: 26  LASILRLGD--CLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY--DASIP 81
           L  I  +GD       GD+G+GK+   +++   L   D +   SPTF +V  Y  D+   
Sbjct: 16  LEFIRAMGDNTVFAFHGDMGAGKTTFIKAVCENLGVSDTIN--SPTFAIVNEYRSDSGEL 73

Query: 82  VAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTG-RK 139
           + HFDFYR++  +EV + G+ D   +  +C IEWPE   +LLPK  +++++   + G R+
Sbjct: 74  IYHFDFYRINKIEEVFDFGYEDYFYSGSLCFIEWPEKVDTLLPKDTVNVYVKVQEDGSRE 133

Query: 140 ATIS 143
            ++S
Sbjct: 134 VSLS 137


>gi|326565409|gb|EGE15586.1| putative ATPase or kinase [Moraxella catarrhalis 103P14B1]
 gi|326573397|gb|EGE23365.1| putative ATPase or kinase [Moraxella catarrhalis 101P30B1]
 gi|326575706|gb|EGE25629.1| putative ATPase or kinase [Moraxella catarrhalis CO72]
          Length = 148

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 70/124 (56%), Gaps = 12/124 (9%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E +T  L   LA +  LG  + LSGDLG+GK+ L R  ++ + H  A  V SPT+TLV+
Sbjct: 10  SEADTQALAETLAQMNLLG-SVWLSGDLGAGKTTLVRYWLQAMGHKGA--VKSPTYTLVE 66

Query: 75  LYDASI-----PVAHFDFYRLSSHQEVVELGFDEILNE--RICIIEWPEIGRSLLPKK-- 125
            Y  ++     PV H D YRL+  +E+  +GF E  +E   + IIEW      +LPK   
Sbjct: 67  PYQINLQGRLKPVYHADLYRLNDPEELDFIGFYEYFDEPNSLVIIEWASRASQVLPKPDY 126

Query: 126 YIDI 129
           +IDI
Sbjct: 127 HIDI 130


>gi|312130389|ref|YP_003997729.1| uncharacterized protein family upf0079, atpase [Leadbetterella
           byssophila DSM 17132]
 gi|311906935|gb|ADQ17376.1| Uncharacterized protein family UPF0079, ATPase [Leadbetterella
           byssophila DSM 17132]
          Length = 137

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 66/116 (56%), Gaps = 8/116 (6%)

Query: 22  LGRHLASILRLGD---CLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA 78
           LG+ +  IL +G      T +GDLG+GK+ L +++ + +   D  E+ SPT+  V  Y  
Sbjct: 13  LGKVMKEILEMGKPYPVWTFTGDLGAGKTTLIQALGKAIGIQD--EISSPTYNYVNEYSG 70

Query: 79  SIPVAHFDFYRLSSHQEVVELGFDEILNE-RICIIEWPEIGRSLLPKKYIDIHLSQ 133
            +   HFD YRL S ++ + LG +E ++  + C +EWPE+  SLLP   + IH+  
Sbjct: 71  GL--YHFDCYRLDSVEQALNLGLEEYIDSGQRCWVEWPEVISSLLPTPSLHIHVGH 124


>gi|293364287|ref|ZP_06611013.1| ATP/GTP hydrolase [Streptococcus oralis ATCC 35037]
 gi|307702747|ref|ZP_07639699.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037]
 gi|291317133|gb|EFE57560.1| ATP/GTP hydrolase [Streptococcus oralis ATCC 35037]
 gi|307623863|gb|EFO02848.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037]
          Length = 147

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 69/125 (55%), Gaps = 5/125 (4%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  + LG  L  +L+  D L L+G+LG+GK+   + + + L  D    + SPT+T+V+
Sbjct: 5   NEEELLALGERLGHLLQKDDVLILTGELGAGKTTFTKGLAKGL--DIRQMIKSPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE L    + +IEW  +    LP  Y+++ + +
Sbjct: 63  EYEGRLPLYHLDVYRIEGDADSIDL--DEFLFGGGVTVIEWGHLLGEDLPDSYLELEILK 120

Query: 134 GKTGR 138
              GR
Sbjct: 121 EAEGR 125


>gi|313617909|gb|EFR90093.1| ATP-binding protein YdiB [Listeria innocua FSL S4-378]
          Length = 153

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (53%), Gaps = 5/121 (4%)

Query: 13  IPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTL 72
           + NE+ T  L + L   L  GD + L GDLG+GK+   + +   L+    ++  SPTFT+
Sbjct: 7   MTNERETRLLAKQLGEQLAAGDVILLEGDLGAGKTTFTKGLGEGLLIPQMIK--SPTFTI 64

Query: 73  VQLY-DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIH 130
           ++ Y    +P+ H D YRL       ELG +E      + ++EW +  R  LP++Y++I 
Sbjct: 65  IREYKKGRLPLYHMDVYRLEDAS-TDELGLEEYFYGAGVSVVEWAQFVREDLPEEYLEIK 123

Query: 131 L 131
           L
Sbjct: 124 L 124


>gi|328952454|ref|YP_004369788.1| Uncharacterized protein family UPF0079, ATPase [Desulfobacca
           acetoxidans DSM 11109]
 gi|328452778|gb|AEB08607.1| Uncharacterized protein family UPF0079, ATPase [Desulfobacca
           acetoxidans DSM 11109]
          Length = 156

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 63/120 (52%), Gaps = 4/120 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSI-IRFLMHDDALEVLSPTFTLV 73
           + + T  LG  +A+ L+ GD L L GDLG+GK+ L R + +      DA  V SPTF LV
Sbjct: 12  SPRQTQILGEKIAARLQPGDILLLHGDLGAGKTELVRGLAVGLGAPPDA--VSSPTFALV 69

Query: 74  QLYDASIPVAHFDFYRLSSHQEVVELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLS 132
             Y   IP+ H D YRL   +    L  +E      + +IEW E     LP+ Y+DI L+
Sbjct: 70  HEYPTRIPLIHVDLYRLPVMEAEFILELEEYWQRPVVVVIEWAERLGEELPEDYLDITLT 129


>gi|167748527|ref|ZP_02420654.1| hypothetical protein ANACAC_03271 [Anaerostipes caccae DSM 14662]
 gi|167652519|gb|EDR96648.1| hypothetical protein ANACAC_03271 [Anaerostipes caccae DSM 14662]
          Length = 146

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 64/119 (53%), Gaps = 4/119 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           ++T   G  L      GD   L GDLG GK+   +   + L  ++   V SPTFT+VQ Y
Sbjct: 14  EDTFRTGFLLGEKAGPGDVYCLCGDLGVGKTVFTQGFAKGLGVEEP--VQSPTFTIVQEY 71

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
           +   +P  HFD YR+   +E+ E+G+ D I  + + +IEW  +   +LP+ Y  I +S+
Sbjct: 72  EEGRLPFYHFDVYRIGDVEEMDEIGYEDYIYGQGVSLIEWANLIEEILPEHYTKITISK 130


>gi|326565769|gb|EGE15931.1| putative ATPase or kinase [Moraxella catarrhalis BC1]
 gi|326570420|gb|EGE20460.1| putative ATPase or kinase [Moraxella catarrhalis BC8]
 gi|326571105|gb|EGE21129.1| putative ATPase or kinase [Moraxella catarrhalis BC7]
 gi|326577172|gb|EGE27066.1| putative ATPase or kinase [Moraxella catarrhalis O35E]
          Length = 148

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 69/124 (55%), Gaps = 12/124 (9%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E +T  L   LA  + L   + LSGDLG+GK+ L R  ++ + H  A  V SPT+TLV+
Sbjct: 10  SEADTQALAEKLAQ-MNLSGSVWLSGDLGAGKTTLVRYWLQAMGHQGA--VKSPTYTLVE 66

Query: 75  LYDASI-----PVAHFDFYRLSSHQEVVELGFDEILNE--RICIIEWPEIGRSLLPKK-- 125
            Y  ++     PV H D YRL+  +E+  +GF E  +E   + IIEW      +LPK   
Sbjct: 67  PYQINLQGRLKPVYHADLYRLNDPEELDFIGFYEYFDEPNSLVIIEWASRASQVLPKPDY 126

Query: 126 YIDI 129
           +IDI
Sbjct: 127 HIDI 130


>gi|88607207|ref|YP_505847.1| hypothetical protein APH_1344 [Anaplasma phagocytophilum HZ]
 gi|88598270|gb|ABD43740.1| conserved hypothetical protein TIGR00150 [Anaplasma phagocytophilum
           HZ]
          Length = 144

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 3/103 (2%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDA-SI 80
           + R LA  LR G  + L G+LG GK+  +R II     +D L   SPTF+LV  Y   + 
Sbjct: 17  VARELAGSLRGGMVVALRGNLGVGKTAFSREIIDCFSGEDFLG--SPTFSLVHEYSTPAF 74

Query: 81  PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLP 123
            + H D YRLS+ +EV E+GF +  +  + ++EWP+I   ++P
Sbjct: 75  SLYHVDLYRLSTLKEVQEVGFFDFCDNNLVLVEWPDILDGVVP 117


>gi|148827218|ref|YP_001291971.1| hypothetical protein CGSHiGG_02840 [Haemophilus influenzae PittGG]
 gi|148718460|gb|ABQ99587.1| hypothetical protein CGSHiGG_02840 [Haemophilus influenzae PittGG]
          Length = 145

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 66/110 (60%), Gaps = 4/110 (3%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP-VAHFDFYRLSSHQEV 96
           L+GDLG+GK+ L R +++ + H     V SPT+TLV+ Y+ +   + HFD YRL+  +E+
Sbjct: 25  LNGDLGAGKTTLTRGMLQGIGHQG--NVKSPTYTLVEEYNITGKMIYHFDLYRLADPEEL 82

Query: 97  VELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAE 145
             +G  +  N + IC+IEW E G+ +LP+  I +++      R   + A+
Sbjct: 83  EFMGIRDYFNTDSICLIEWSEKGQGILPEADILVNIDYYDDARNIELIAQ 132


>gi|308172419|ref|YP_003919124.1| hypothetical protein BAMF_0528 [Bacillus amyloliquefaciens DSM 7]
 gi|307605283|emb|CBI41654.1| putative ATPase or kinase UPF0079 [Bacillus amyloliquefaciens DSM
           7]
 gi|328552243|gb|AEB22735.1| ATPase or kinase UPF0079 [Bacillus amyloliquefaciens TA208]
 gi|328910516|gb|AEB62112.1| putative ATPase or kinase UPF0079 [Bacillus amyloliquefaciens LL3]
          Length = 158

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 71/133 (53%), Gaps = 7/133 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           N + T  + +  AS+ + GD LTL GDLG+GK+   +     L       V SPTFT+++
Sbjct: 10  NPEETKAVAKLAASLAKPGDILTLEGDLGAGKTTFTKGFAEGLGITRV--VNSPTFTIIK 67

Query: 75  LY-DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLS 132
            Y D S+P+ H D YR+    E  +LG +E    + +C+IEW  + +  LP + + I + 
Sbjct: 68  EYHDGSLPLYHMDVYRMEDESE--DLGLEEYFEGQGVCLIEWAHLIQEQLPVERLQIVIK 125

Query: 133 Q-GKTGRKATISA 144
           + G   R  T +A
Sbjct: 126 RAGDEERDITFTA 138


>gi|303256745|ref|ZP_07342759.1| putative nucleotide-binding protein [Burkholderiales bacterium
           1_1_47]
 gi|302860236|gb|EFL83313.1| putative nucleotide-binding protein [Burkholderiales bacterium
           1_1_47]
          Length = 165

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 76/162 (46%), Gaps = 13/162 (8%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLA--------SILRLGDCLTLSGDLGSGKSFLARS 52
           MN ++ H     + +E+ T  LG  LA         IL  G  + L GDLG+GK++L RS
Sbjct: 1   MN-TDAHSLEFHLADEEATSELGARLARALDSVKSEILEKGLNIKLVGDLGAGKTYLMRS 59

Query: 53  IIRFLMHDDALEVLSPTFTLVQLYDA-SIPVAHFDFYRLSSHQEVVELGFDEILNE-RIC 110
            +R L  +    V SPTF+L++ Y      V HFDFYR     E  E GF E     R+ 
Sbjct: 60  ALRALGFEG--RVKSPTFSLLETYKVDGFTVNHFDFYRFEDPVEFEEAGFRENYGPGRVV 117

Query: 111 IIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAERWIISHI 152
             EW       +P+  + I L     GR   ISA+  + + +
Sbjct: 118 ASEWTSKAGPFVPQPDLTITLKSEGEGRVCDISADSALGNQV 159


>gi|300115279|ref|YP_003761854.1| hypothetical protein Nwat_2767 [Nitrosococcus watsonii C-113]
 gi|299541216|gb|ADJ29533.1| protein of unknown function UPF0079 [Nitrosococcus watsonii C-113]
          Length = 155

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 71/135 (52%), Gaps = 6/135 (4%)

Query: 15  NEKNTICLGRHLASILRL-GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV 73
           NE+ T+ LG  L +  R  G  + L G LG+GK+ LAR I++ L H     V SPT+TLV
Sbjct: 8   NEEATLALGTRLGTACRKEGAIIFLQGALGAGKTTLARGILQALGHQGT--VKSPTYTLV 65

Query: 74  QLYDASIP-VAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHL 131
           + Y  +   + HFD YRL+  +E+  +G  D      I ++EWPE     LP   + + L
Sbjct: 66  EPYLLNQQLIYHFDLYRLTDPRELEFMGIQDYFAPGVIALVEWPERAFDWLPPADLQMSL 125

Query: 132 SQ-GKTGRKATISAE 145
              G  GR   + A+
Sbjct: 126 EHLGSRGRSVRLEAK 140


>gi|325916957|ref|ZP_08179199.1| hypothetical nucleotide-binding protein [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325536808|gb|EGD08562.1| hypothetical nucleotide-binding protein [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 166

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (50%), Gaps = 15/155 (9%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           MN  + HL      + + T  LGR LA++      + L GDLG+GKS LAR+++R L   
Sbjct: 1   MNQLDAHLI-----DAEATETLGRALAAVRPAAAMVQLHGDLGAGKSTLARALLRALGVT 55

Query: 61  DALEVLSPTFTLVQLYDASI--PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIG 118
             +   SPT+TLV+ Y  S      H D YR+ +  E+  LG DE  +  + ++EWPE G
Sbjct: 56  GPIR--SPTYTLVERYPLSSGDEAWHLDLYRIGNAGELDFLGLDEG-SASLWLVEWPERG 112

Query: 119 RSLLPKKYIDIHLSQGKTGRKA-----TISAERWI 148
              LP   +D+ L+    GR       T++   W+
Sbjct: 113 AGTLPPVDLDVELAVEGEGRSVRLLGRTLAGRDWL 147


>gi|317471943|ref|ZP_07931276.1| hypothetical protein HMPREF1011_01625 [Anaerostipes sp. 3_2_56FAA]
 gi|316900580|gb|EFV22561.1| hypothetical protein HMPREF1011_01625 [Anaerostipes sp. 3_2_56FAA]
          Length = 140

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 64/119 (53%), Gaps = 4/119 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           ++T   G  L      GD   L GDLG GK+   +   + L  ++   V SPTFT+VQ Y
Sbjct: 8   EDTFRTGFLLGEKAGPGDVYCLCGDLGVGKTVFTQGFAKGLGVEEP--VQSPTFTIVQEY 65

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
           +   +P  HFD YR+   +E+ E+G+ D I  + + +IEW  +   +LP+ Y  I +S+
Sbjct: 66  EEGRLPFYHFDVYRIGDVEEMDEIGYEDYIYGQGVSLIEWANLIEEILPEHYTKITISK 124


>gi|149003608|ref|ZP_01828473.1| hypothetical protein CGSSp14BS69_13258 [Streptococcus pneumoniae
           SP14-BS69]
 gi|169833438|ref|YP_001695306.1| hypothetical protein SPH_2093 [Streptococcus pneumoniae
           Hungary19A-6]
 gi|194396875|ref|YP_002038535.1| hypothetical protein SPG_1853 [Streptococcus pneumoniae G54]
 gi|225861743|ref|YP_002743252.1| hypothetical protein SPT_1902 [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298230229|ref|ZP_06963910.1| hypothetical protein SpneCMD_06116 [Streptococcus pneumoniae str.
           Canada MDR_19F]
 gi|298255900|ref|ZP_06979486.1| hypothetical protein SpneCM_09948 [Streptococcus pneumoniae str.
           Canada MDR_19A]
 gi|298503689|ref|YP_003725629.1| ATP-binding protein [Streptococcus pneumoniae TCH8431/19A]
 gi|303254122|ref|ZP_07340237.1| hypothetical protein CGSSpBS455_01520 [Streptococcus pneumoniae
           BS455]
 gi|147758340|gb|EDK65340.1| hypothetical protein CGSSp14BS69_13258 [Streptococcus pneumoniae
           SP14-BS69]
 gi|168995940|gb|ACA36552.1| conserved hypothetical protein [Streptococcus pneumoniae
           Hungary19A-6]
 gi|194356542|gb|ACF54990.1| conserved hypothetical protein [Streptococcus pneumoniae G54]
 gi|225727593|gb|ACO23444.1| conserved hypothetical protein [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298239284|gb|ADI70415.1| ATP-binding protein [Streptococcus pneumoniae TCH8431/19A]
 gi|302598955|gb|EFL65986.1| hypothetical protein CGSSpBS455_01520 [Streptococcus pneumoniae
           BS455]
          Length = 147

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 69/132 (52%), Gaps = 5/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+    LG  L  +L   D L L G+LG+GK+   + + + L     ++  SPT+T+V+
Sbjct: 5   NEEELQALGERLGHLLAKNDVLILIGELGAGKTTFTKGLAKGLQISQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDE-ILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE I    + +IEW  +    LP  Y+++ + +
Sbjct: 63  EYEGRLPLYHLDVYRIEGDADSIDL--DEFIFGGGVTVIEWGNLLGDALPDAYLELEILK 120

Query: 134 GKTGRKATISAE 145
              GR+    A+
Sbjct: 121 EADGRRLNFQAK 132


>gi|315223505|ref|ZP_07865361.1| ATP/GTP hydrolase [Capnocytophaga ochracea F0287]
 gi|314946540|gb|EFS98532.1| ATP/GTP hydrolase [Capnocytophaga ochracea F0287]
          Length = 154

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 61/107 (57%), Gaps = 5/107 (4%)

Query: 40  GDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEVVE 98
           G +G GK+ L ++++R L   D   V SPTF+LV  Y+ A   + HFDFYR+ + +E  +
Sbjct: 49  GGMGFGKTTLIKALVRALGSTDI--VSSPTFSLVNPYEGADSRIYHFDFYRIKNEEEAFD 106

Query: 99  LGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ-GKTGRKATIS 143
           +GF+E L +   C IEW E  +  LP  Y  + L Q  K  RK  IS
Sbjct: 107 IGFEEYLYSGNWCFIEWAEKVQKYLPDTYTTVELIQIDKNYRKLVIS 153


>gi|311029244|ref|ZP_07707334.1| ATP/GTP hydrolase [Bacillus sp. m3-13]
          Length = 151

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 72/135 (53%), Gaps = 8/135 (5%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           + T+     L  ++  G  L L GDLG+GK+   + + + L  +    V SPTFT+++ Y
Sbjct: 12  EETMAKSEALGRLMEGGAVLLLEGDLGAGKTTFTKGLAKGL--EIKRNVNSPTFTIIKEY 69

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL-SQG 134
              +P+ H D YRL+  +E  +LGFD+    E + ++EW  +    LP + ++I++   G
Sbjct: 70  QGRLPLYHMDVYRLADSEE--DLGFDDYFEGEGVTVVEWAHLIEEFLPSERLEIYIYHHG 127

Query: 135 KTGRKATIS--AERW 147
              RK  ++   ER+
Sbjct: 128 DDERKIVLTPKGERY 142


>gi|289168674|ref|YP_003446943.1| hypothetical protein smi_1843 [Streptococcus mitis B6]
 gi|288908241|emb|CBJ23083.1| conserved hypothetical protein [Streptococcus mitis B6]
          Length = 147

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 71/132 (53%), Gaps = 5/132 (3%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+    LG  L  +L   D L L+G+LG+GK+   + + + L     ++  SPT+T+V+
Sbjct: 5   NEEELQFLGERLGCLLEKNDVLILTGELGAGKTTFTKGLAKGLQITQMIK--SPTYTIVR 62

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ 133
            Y+  +P+ H D YR+    + ++L  DE L    + +IEW  +    LP  Y+++ + +
Sbjct: 63  EYEGRLPLYHLDVYRIEGDADSIDL--DEFLFGGGVTVIEWGNLLGDALPDTYLELKILK 120

Query: 134 GKTGRKATISAE 145
            + GR+    A+
Sbjct: 121 EEDGRRLHFQAK 132


>gi|160946138|ref|ZP_02093349.1| hypothetical protein PEPMIC_00100 [Parvimonas micra ATCC 33270]
 gi|158447661|gb|EDP24656.1| hypothetical protein PEPMIC_00100 [Parvimonas micra ATCC 33270]
          Length = 149

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 65/125 (52%), Gaps = 8/125 (6%)

Query: 24  RHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDAL--EVLSPTFTLVQLYDASIP 81
           +  +  L+ GD ++L GDLG+GK+    +  +FL  +  +  ++ SPTF LV LY     
Sbjct: 17  KRFSKTLKNGDVISLVGDLGAGKT----TFTKFLGKNLGIGEDITSPTFNLVNLYSGKFE 72

Query: 82  VAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIH-LSQGKTGRK 139
             H D YR+ S +E+ ++ ++     + I +IEW E    LLPK  I+I  L   +  RK
Sbjct: 73  FNHMDLYRIDSPEELYQIDYENYFYPDGITVIEWAENAGYLLPKNLIEIEILKISENSRK 132

Query: 140 ATISA 144
             I  
Sbjct: 133 IVIKG 137


>gi|47567497|ref|ZP_00238209.1| ATP/GTP hydrolase [Bacillus cereus G9241]
 gi|228983505|ref|ZP_04143713.1| ATP/GTP hydrolase [Bacillus thuringiensis serovar tochigiensis BGSC
           4Y1]
 gi|47555899|gb|EAL14238.1| ATP/GTP hydrolase [Bacillus cereus G9241]
 gi|228776212|gb|EEM24570.1| ATP/GTP hydrolase [Bacillus thuringiensis serovar tochigiensis BGSC
           4Y1]
          Length = 157

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 64/122 (52%), Gaps = 5/122 (4%)

Query: 11  IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTF 70
           I   + + T  L   L  ++R  D + L GDLG+GK+   + + + L       V SPTF
Sbjct: 6   ITTKSSEETQRLSEKLGELVRAQDVIILEGDLGAGKTTFTKGLAKGLGVKRV--VNSPTF 63

Query: 71  TLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDI 129
            +++ Y   +P+ H D YRL+  +E  +LGFDE    E I ++EW  +  + LP + + I
Sbjct: 64  NIIKEYKGRLPLYHMDVYRLAESEE--DLGFDEYFYGEGITVVEWAHLIEAYLPNEKLQI 121

Query: 130 HL 131
            L
Sbjct: 122 SL 123


>gi|325122665|gb|ADY82188.1| conserved hypothetical protein [Acinetobacter calcoaceticus PHEA-2]
          Length = 157

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 76/134 (56%), Gaps = 8/134 (5%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E++T CL R LA  ++LG  + L GDLG+GK+ L R  ++ L H  +  V SPT+TLV+
Sbjct: 11  HEEDTECLARALAQHVQLG-VIYLIGDLGAGKTTLTRYFLQALGHKGS--VKSPTYTLVE 67

Query: 75  LYDAS-IPVAHFDFYRLSSHQEVVELGFDEILN--ERICIIEWPEIGRSLLPKK--YIDI 129
            Y  +   + HFD YRL+   E+  +G  + L+  + + + EWP  G   +P+    IDI
Sbjct: 68  PYKINDKEIFHFDLYRLNDPYELELMGIRDYLDITDALFLFEWPSKGGDEIPQADIIIDI 127

Query: 130 HLSQGKTGRKATIS 143
             S  +  R  T++
Sbjct: 128 QKSDDELTRLVTLT 141


>gi|57239617|ref|YP_180753.1| hypothetical protein Erum8910 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579607|ref|YP_197819.1| hypothetical protein ERWE_CDS_09430 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161696|emb|CAH58626.1| conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58418233|emb|CAI27437.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 150

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 69/126 (54%), Gaps = 4/126 (3%)

Query: 22  LGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS-I 80
           L   LA  LR GD ++LSGDLG GK+   + ++  L+  +  +V SPTF +V  Y  S  
Sbjct: 15  LASILAFNLRTGDSISLSGDLGVGKTSFVKLLVNTLIPSE--DVSSPTFNIVNEYHFSKF 72

Query: 81  PVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKY-IDIHLSQGKTGRK 139
            + H D YR++S  E+ ++G D I +  + I+EWP++   ++     I+I  S     R 
Sbjct: 73  TIYHIDLYRINSLSEIYDIGIDTIFDNDVGIVEWPDLLSDIVNFNLRINIQYSIKDGLRN 132

Query: 140 ATISAE 145
            +IS +
Sbjct: 133 ISISTD 138


>gi|281421260|ref|ZP_06252259.1| ATPase [Prevotella copri DSM 18205]
 gi|281404795|gb|EFB35475.1| ATPase [Prevotella copri DSM 18205]
          Length = 136

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 59/111 (53%), Gaps = 5/111 (4%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDAS--IPVAHFDFYRL 90
           G      G +G+GK+   ++I   L  +D   + SPTF LV  Y A    PV HFDFYR+
Sbjct: 25  GKVFAFYGKMGAGKTTFVKAICEELGVEDV--ITSPTFALVNEYTAGDGSPVYHFDFYRI 82

Query: 91  SSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKA 140
               EV ++G+ D   +  +C +EWPE+   LLP+    + ++  + G ++
Sbjct: 83  KKLDEVYDMGYEDYFYSGNLCFLEWPELIEDLLPEDCTKVTITAEEDGTRS 133


>gi|88810488|ref|ZP_01125745.1| predicted ATPase or kinase [Nitrococcus mobilis Nb-231]
 gi|88792118|gb|EAR23228.1| predicted ATPase or kinase [Nitrococcus mobilis Nb-231]
          Length = 153

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 66/109 (60%), Gaps = 4/109 (3%)

Query: 38  LSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD-ASIPVAHFDFYRLSSHQEV 96
           L+G+LG+GK+ L R ++R L H     V SPT+TL++ Y  A   + H D YRLS  +E+
Sbjct: 32  LTGELGAGKTTLVRGLLRTLGHIGP--VRSPTYTLIEPYQVAERRLYHLDLYRLSDPEEL 89

Query: 97  VELGFDEILNER-ICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISA 144
             +G  ++L E  + ++EWPE G  +LP   + I LS  ++ R A ++A
Sbjct: 90  EYIGLRDLLGESAVLLVEWPERGGRVLPMADLVIALSVVESMRLAQLTA 138


>gi|219122121|ref|XP_002181401.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217407387|gb|EEC47324.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 172

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 59/104 (56%), Gaps = 4/104 (3%)

Query: 33  GDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYD--ASIPVAHFDFYRL 90
           G  + L GDLG+GK+  AR  +R  + D  L V SPT+ L   Y       + H D YRL
Sbjct: 21  GSIVFLDGDLGAGKTAFARGFVRAAIGDPVLRVTSPTYLLSNTYALRRGYEIHHMDLYRL 80

Query: 91  SSHQE-VVELGFDEILNERICIIEWP-EIGRSLLPKKYIDIHLS 132
           S + E ++ L  D+ L+  I +IEWP  +GR  +P + +++H++
Sbjct: 81  SENPEDLMPLNLDQALSNGISLIEWPIRLGRDKIPPQRLEVHIT 124


>gi|167765644|ref|ZP_02437697.1| hypothetical protein CLOSS21_00128 [Clostridium sp. SS2/1]
 gi|317497010|ref|ZP_07955338.1| hypothetical protein HMPREF0996_00317 [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|167712690|gb|EDS23269.1| hypothetical protein CLOSS21_00128 [Clostridium sp. SS2/1]
 gi|291558953|emb|CBL37753.1| conserved hypothetical nucleotide-binding protein
           [butyrate-producing bacterium SSC/2]
 gi|316895670|gb|EFV17824.1| hypothetical protein HMPREF0996_00317 [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 141

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 67/119 (56%), Gaps = 4/119 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           ++T  +G+ +    + G  + L GDLG GK+   + +   L   + ++  SPTFT+V+ Y
Sbjct: 9   EDTYEIGKKIGQEAQPGQVICLYGDLGVGKTVFTKGLADGLGITEPIQ--SPTFTIVREY 66

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGF-DEILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
           +   +P+ HFD YR+   +E+ E+G+ D +  E +C+IEW  +   +LP  Y  I + +
Sbjct: 67  EEGRLPLYHFDVYRIGDIEEMDEIGYEDYVYGEGVCLIEWANLIEEILPDHYQKITIRK 125


>gi|83815515|ref|YP_446518.1| P-loop hydrolase UPF0079 [Salinibacter ruber DSM 13855]
 gi|83756909|gb|ABC45022.1| Uncharacterized P-loop hydrolase UPF0079 [Salinibacter ruber DSM
           13855]
          Length = 163

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 70/131 (53%), Gaps = 4/131 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           ++T+ LG  +A  L  G  + L GDLG+GK+   + + + L    A EV SPTFT++ ++
Sbjct: 24  EDTMALGARIAQGLSPGAVVALYGDLGTGKTHFVKGVAQGLGLPPA-EVRSPTFTILAVH 82

Query: 77  D-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ- 133
           D    P+ HFD YR+ +  E VELGF+  +  + +  IEW      LLP   + +     
Sbjct: 83  DDGDRPLYHFDAYRVQTPDEFVELGFETYVHGDGLTCIEWAGRVADLLPADTVPLQFHHV 142

Query: 134 GKTGRKATISA 144
             + R+ T+ A
Sbjct: 143 APSTRRITLGA 153


>gi|295106567|emb|CBL04110.1| conserved hypothetical nucleotide-binding protein [Gordonibacter
           pamelaeae 7-10-1-b]
          Length = 171

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 71/132 (53%), Gaps = 7/132 (5%)

Query: 19  TICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFL-MHDDALEVLSPTFT-LVQLY 76
           T  L   LA  L  GD + LSGDLG+GK+   + +   L +HD   +V SPTF  L+Q  
Sbjct: 17  TKQLASTLAPYLHEGDVVVLSGDLGAGKTQFVQGVAAALGVHD---QVTSPTFNILLQYP 73

Query: 77  DASIPVAHFDFYRLSSHQEVVELG-FDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGK 135
              +P+ HFD YRL    E+ ++G F+ I  +    +EW E   S LP  Y++I ++   
Sbjct: 74  GGRLPLYHFDLYRLEDPDELEDIGYFETIDGDGASFVEWGEKFPSALPYGYLEIAVTVDA 133

Query: 136 TGRKATISAERW 147
            G + T+ A+ +
Sbjct: 134 DGNR-TVRAQSF 144


>gi|229816614|ref|ZP_04446912.1| hypothetical protein COLINT_03671 [Collinsella intestinalis DSM
           13280]
 gi|229807820|gb|EEP43624.1| hypothetical protein COLINT_03671 [Collinsella intestinalis DSM
           13280]
          Length = 169

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 65/119 (54%), Gaps = 4/119 (3%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
            +T+ LG  +A  L  GD L L+G LG GK+   + +   L   D   V SPTF L+ ++
Sbjct: 17  DDTVHLGELVAGCLEDGDVLVLTGGLGVGKTHFTKGVSAGL--GDGHPVTSPTFALMAVH 74

Query: 77  DAS-IPVAHFDFYRLSSHQEVVELG-FDEILNERICIIEWPEIGRSLLPKKYIDIHLSQ 133
           D   IP+ HFD YRL    E+ + G FD +  E  C++EW E  +  L  +Y+ + +S+
Sbjct: 75  DGGRIPLFHFDLYRLEHAFELEDTGIFDVLGYEGACLLEWGEQFQDELTDEYLGVIISR 133


>gi|52079047|ref|YP_077838.1| hypothetical protein BL00842 [Bacillus licheniformis ATCC 14580]
 gi|52784418|ref|YP_090247.1| YdiB [Bacillus licheniformis ATCC 14580]
 gi|319648649|ref|ZP_08002861.1| hypothetical protein HMPREF1012_03900 [Bacillus sp. BT1B_CT2]
 gi|52002258|gb|AAU22200.1| hypothetical conserved protein YdiB [Bacillus licheniformis ATCC
           14580]
 gi|52346920|gb|AAU39554.1| YdiB [Bacillus licheniformis ATCC 14580]
 gi|317389297|gb|EFV70112.1| hypothetical protein HMPREF1012_03900 [Bacillus sp. BT1B_CT2]
          Length = 158

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 70/133 (52%), Gaps = 9/133 (6%)

Query: 14  PNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLV 73
           P E   I   R  A  ++ GD +TL GDLG+GK+   +     +       V SPTFT++
Sbjct: 11  PEETKNIA--RLAAKYVQPGDVITLEGDLGAGKTTFTKGFAEGIGIKRV--VSSPTFTII 66

Query: 74  QLY-DASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHL 131
           + Y D S+P+ H D YR+    E  +LG DE    + +C++EW  +    LPK+ +++ +
Sbjct: 67  KEYRDGSLPLFHMDVYRMEDETE--DLGLDEYFEGDGVCLVEWAHLIEEQLPKERLEVVI 124

Query: 132 SQ-GKTGRKATIS 143
            + G   RK T +
Sbjct: 125 KRLGDDKRKLTFT 137


>gi|332882641|ref|ZP_08450253.1| hydrolase, P-loop family [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332679441|gb|EGJ52426.1| hydrolase, P-loop family [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 136

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 64/112 (57%), Gaps = 5/112 (4%)

Query: 35  CLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIP-VAHFDFYRLSSH 93
            +   G +G GK+ L +++++ L   D   V SPTF+LV  Y+ +   + HFDFYRL S 
Sbjct: 26  VVIFKGAMGFGKTTLIKALVKALGSTD--NVSSPTFSLVNPYEGTDSRIYHFDFYRLKSP 83

Query: 94  QEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDIHLSQ-GKTGRKATIS 143
           +E  ++GF+E L +   C IEW E     LP++Y  I L Q  K  RK TI+
Sbjct: 84  EEAFDIGFEEYLFSGDWCFIEWAERVEKYLPEQYSVIELIQIDKNHRKLTIN 135


>gi|326560118|gb|EGE10508.1| putative ATPase or kinase [Moraxella catarrhalis 46P47B1]
 gi|326560501|gb|EGE10883.1| putative ATPase or kinase [Moraxella catarrhalis 7169]
          Length = 148

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 69/124 (55%), Gaps = 12/124 (9%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           +E +T  L   LA  + L   + LSGDLG+GK+ L R  ++ + H  A  V SPT+TLV+
Sbjct: 10  SEADTQALAETLAQ-MNLSGSVWLSGDLGAGKTTLVRYWLQAMGHQGA--VKSPTYTLVE 66

Query: 75  LYDASI-----PVAHFDFYRLSSHQEVVELGFDEILNE--RICIIEWPEIGRSLLPKK-- 125
            Y  ++     PV H D YRL+  +E+  +GF E  +E   + IIEW      +LPK   
Sbjct: 67  PYQINLQGRLKPVYHADLYRLNDPEELDFIGFYEYFDEPNSLVIIEWASRASQVLPKPDY 126

Query: 126 YIDI 129
           +IDI
Sbjct: 127 HIDI 130


>gi|295402740|ref|ZP_06812680.1| protein of unknown function UPF0079 [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312112517|ref|YP_003990833.1| hypothetical protein GY4MC1_3582 [Geobacillus sp. Y4.1MC1]
 gi|294975204|gb|EFG50842.1| protein of unknown function UPF0079 [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311217618|gb|ADP76222.1| Uncharacterized protein family UPF0079, ATPase [Geobacillus sp.
           Y4.1MC1]
          Length = 152

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 66/129 (51%), Gaps = 6/129 (4%)

Query: 17  KNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLY 76
           K T+ L       L   D +TL GDLG+GK+   + + + L       V SPTFT+V+ Y
Sbjct: 12  KETMHLAAKFGEKLAEKDVITLEGDLGAGKTTFTKGLAKGLGVRKT--VSSPTFTIVKEY 69

Query: 77  DASIPVAHFDFYRLSSHQEVVELGFDEILN-ERICIIEWPEIGRSLLPKKYIDIHL-SQG 134
              +P+ H D YRL    E  +LGFDE  + + + ++EW  +    LP + ++I+L   G
Sbjct: 70  KGRLPLYHMDVYRLEDTME--DLGFDEYFDGDGVTVVEWAHLIEPQLPPERLNIYLFHHG 127

Query: 135 KTGRKATIS 143
              RK  I 
Sbjct: 128 NDERKLVIE 136


>gi|24378902|ref|NP_720857.1| hypothetical protein SMU.409 [Streptococcus mutans UA159]
 gi|24376785|gb|AAN58163.1|AE014888_1 conserved hypothetical protein [Streptococcus mutans UA159]
          Length = 147

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 72/128 (56%), Gaps = 3/128 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE   + LG+ +   L+  D L L+GDLGSGK+ L + I + L     ++  SPT+T+V+
Sbjct: 6   NENQLMALGQRIGQKLQAQDVLVLTGDLGSGKTTLTKGIAKGLGIKQMIK--SPTYTIVR 63

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+  +P+ H D YR+    + ++L  D +  + + +IEW E+    L   Y+ + L + 
Sbjct: 64  EYEGRLPLYHLDVYRIGDDPDSIDL-DDFLFGDGVTVIEWGELLDDSLLSDYLTVLLDKT 122

Query: 135 KTGRKATI 142
           + GR+ T+
Sbjct: 123 EGGRQITL 130


>gi|312862496|ref|ZP_07722738.1| hydrolase, P-loop family [Streptococcus vestibularis F0396]
 gi|322517418|ref|ZP_08070291.1| ATP/GTP hydrolase [Streptococcus vestibularis ATCC 49124]
 gi|311101901|gb|EFQ60102.1| hydrolase, P-loop family [Streptococcus vestibularis F0396]
 gi|322123900|gb|EFX95459.1| ATP/GTP hydrolase [Streptococcus vestibularis ATCC 49124]
          Length = 147

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 70/125 (56%), Gaps = 3/125 (2%)

Query: 15  NEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQ 74
           NE+  I +GR L  +L  GD + LSGDLG+GK+ L + I + L  D +  + SPT+T+V+
Sbjct: 6   NEEELISIGRKLGRLLNSGDIIVLSGDLGAGKTTLTKGIAKGL--DVSQMIKSPTYTIVR 63

Query: 75  LYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQG 134
            Y+   P+ H D YR+    + ++L  D +  + + IIEW E+    L   Y+ I +   
Sbjct: 64  EYEGRSPLYHLDVYRIGDDPDS