RPSBLAST alignment for GI: 254780824 and conserved domain: TIGR00150

>gnl|CDD|129254 TIGR00150, HI0065_YjeE, ATPase, YjeE family. Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity. Length = 133
 Score =  113 bits (284), Expect = 3e-26
 Identities = 47/135 (34%), Positives = 74/135 (54%), Gaps = 4/135 (2%)

Query: 12  PIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFT 71
             P+EK     G+  A  L  G  + L GDLG+GK+ L + +++ L       V SPTFT
Sbjct: 1   ANPDEKAMDKFGKAFAKPLDFGTVVLLKGDLGAGKTTLVQGLLQGLGIQ--GNVTSPTFT 58

Query: 72  LVQLYD-ASIPVAHFDFYRLSSHQEVVELGFDEIL-NERICIIEWPEIGRSLLPKKYIDI 129
           LV  Y+  ++ V HFD YRL+  +E+  +G ++    + IC++EWPE G  +LP   + I
Sbjct: 59  LVNEYNEGNLMVYHFDLYRLADPEELELMGLEDYFEGDGICLVEWPEEGLEILPDYDLQI 118

Query: 130 HLSQGKTGRKATISA 144
            +     GR+  ++A
Sbjct: 119 KIDYVGDGREIELTA 133