RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780827|ref|YP_003065240.1| pantothenate kinase [Candidatus Liberibacter asiaticus str. psy62] (311 letters) >gnl|CDD|30198 cd02025, PanK, Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.. Length = 220 Score = 289 bits (741), Expect = 6e-79 Identities = 130/223 (58%), Positives = 158/223 (70%), Gaps = 6/223 (2%) Query: 85 VVGITGSVAVGKSTFARILCILLQ-QISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPE 143 ++GI GSVAVGKST AR+L LL + V LITTDGFL+PN L LM RKGFPE Sbjct: 1 IIGIAGSVAVGKSTTARVLQALLSRWPDHPNVELITTDGFLYPNKELIERGLMDRKGFPE 60 Query: 144 SYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQPDILLIEGINVLQQNSL 203 SYD LL FL D+KSGKK V +P YSH YD++ GE T+ QPDIL+IEG+NVLQ Sbjct: 61 SYDMEALLKFLKDIKSGKKNVKIPVYSHLTYDVIPGEKQTVDQPDILIIEGLNVLQ---- 116 Query: 204 SDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRETAFLNPRSYFHHFTEISEEQ 263 Q +SDF DFSIY+DAD+ DI +WY+ RFLKLRETAF +P SYFH + ++SEE+ Sbjct: 117 -TGQNPRLFVSDFFDFSIYVDADEDDIEKWYIKRFLKLRETAFSDPDSYFHRYAKMSEEE 175 Query: 264 SLKIAETAWNNINLPNLQHNILPTRKRADLILSKGEDHSVKTI 306 ++ A W NINL NL+ NILPTR RADLIL KG DHS++ + Sbjct: 176 AIAFAREVWKNINLKNLRENILPTRNRADLILEKGADHSIEEV 218 >gnl|CDD|31270 COG1072, CoaA, Panthothenate kinase [Coenzyme metabolism]. Length = 283 Score = 281 bits (721), Expect = 2e-76 Identities = 129/284 (45%), Positives = 174/284 (61%), Gaps = 9/284 (3%) Query: 7 YHFFTSHEWA-VHSKFSSILSKKISNQLLSFDSPIDSTEIYKIYFPLSHLLLINVNSAKI 65 Y F+ +WA + + L+++ +L + PI E+ IY PLS LL + V + + Sbjct: 6 YLIFSREQWAALRASTPLTLTEEELKRLRGLNEPISLDEVEDIYLPLSRLLQLYVEARER 65 Query: 66 TCHQYNKFLNLKEESKIPFVVGITGSVAVGKSTFARILCILLQQI-SNFKVSLITTDGFL 124 + +FL + PF++GI GSVAVGKST ARIL LL + + KV L+T DGF Sbjct: 66 LFAELLRFLG-TNNQQRPFIIGIAGSVAVGKSTTARILQALLSRWPESPKVDLVTMDGFH 124 Query: 125 FPNAVLTANNLMQRKGFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTI 184 +PNAVL LM RKGFPESYD LL FLSDVK+GK V P YSH YD + + + Sbjct: 125 YPNAVLDERGLMARKGFPESYDVAALLRFLSDVKAGKPDVFAPVYSHLIYDPVPDAFQVV 184 Query: 185 IQPDILLIEGINVLQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRET 244 QPDIL++EG NVLQ + + +SDF DFSIY+DAD+ + Y+ RFLK T Sbjct: 185 PQPDILIVEGNNVLQ------DGEPWLFLSDFFDFSIYVDADEELLEERYIERFLKFGLT 238 Query: 245 AFLNPRSYFHHFTEISEEQSLKIAETAWNNINLPNLQHNILPTR 288 AF +P SYFH++ +SE ++++ A W+NINL NL+ NILPTR Sbjct: 239 AFEDPASYFHNYAPLSEREAIESARAIWDNINLLNLRENILPTR 282 >gnl|CDD|30917 COG0572, Udk, Uridine kinase [Nucleotide transport and metabolism]. Length = 218 Score = 76.4 bits (188), Expect = 1e-14 Identities = 52/235 (22%), Positives = 93/235 (39%), Gaps = 39/235 (16%) Query: 80 SKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTAN-NLMQR 138 + ++GI G GK+T A+ L +Q+ KV +I+ D + + L Sbjct: 5 PEKVIIIGIAGGSGSGKTTVAKELS---EQLGVEKVVVISLDDYYKDQSHLPFEERNKIN 61 Query: 139 KGFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQP--DILLIEGIN 196 PE++D + L+ L D+K GK V +P Y + + E +TI D++++EGI Sbjct: 62 YDHPEAFDLDLLIEHLKDLKQGKP-VDLPVYDYKTHTR---EPETIKVEPNDVVIVEGIL 117 Query: 197 VLQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRETAFLNPRSYFHHF 256 +L + D +D I++D D + R ++ R R Sbjct: 118 LLY----------DERLRDLMDLKIFVDTDADVRLIRRIKRDVQERG------RDLESVI 161 Query: 257 TEISEEQSLKIAETAWNNINLPNLQHNILPTRKRADLILSKGEDHSVKTIKIKKI 311 + + P + I PT+K AD+I+ G + V ++ Sbjct: 162 EQ-------------YVKTVRPMYEQFIEPTKKYADIIIPSGGKNEVAVDLLQAK 203 >gnl|CDD|30196 cd02023, UMPK, Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.. Length = 198 Score = 67.5 bits (165), Expect = 4e-12 Identities = 57/231 (24%), Positives = 99/231 (42%), Gaps = 53/231 (22%) Query: 85 VVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKG---- 140 ++GI G GK+T A + +Q+ N KV +I+ D + L+ L +RK Sbjct: 1 IIGIAGGSGSGKTTVAEEII---EQLGNPKVVIISQDSYYKD---LSHEELEERKNNNYD 54 Query: 141 FPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQPDILLIEGINVLQQ 200 P+++D + L++ L D+K+G K V +P Y + L+ E T+ D++++EGI L Sbjct: 55 HPDAFDFDLLISHLQDLKNG-KSVEIPVYDFKTHSRLK-ETVTVYPADVIILEGILAL-- 110 Query: 201 NSLSDNQKATPMISDFLDFSIYIDADK-----RDIHRWYLNRFLKLRETAFLNPRSYFHH 255 + D +D I++D D R I R Sbjct: 111 --------YDKELRDLMDLKIFVDTDADVRLIRRIER----------------------- 139 Query: 256 FTEISEE-QSLKIAETAWNNINLPNLQHNILPTRKRADLILSKGEDHSVKT 305 +I E + L+ + P + I PT++ AD+I+ +G D+ V Sbjct: 140 --DIVERGRDLESVINQYLKFVKPMHEQFIEPTKRYADVIIPRGGDNHVAI 188 >gnl|CDD|33963 COG4240, COG4240, Predicted kinase [General function prediction only]. Length = 300 Score = 58.1 bits (140), Expect = 3e-09 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 15/129 (11%) Query: 78 EESKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNA---VLTANN 134 +E P +VGI+G GKST + ++ LL + + ++ D +A L Sbjct: 45 QERGRPLIVGISGPQGSGKSTLSALIVRLLAAKGLERTATLSLDDLYLTHADRLRLARQV 104 Query: 135 --LMQRKGFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQP----- 187 L+Q +G P ++D L L+ + G V +PR+ S + G D Q Sbjct: 105 NPLLQTRGLPGTHDPTLGLNVLNAIARGGPTVPLPRFDKSAF---AGAGDRAPQTQWIKF 161 Query: 188 --DILLIEG 194 DI+++EG Sbjct: 162 EVDIVILEG 170 >gnl|CDD|109538 pfam00485, PRK, Phosphoribulokinase / Uridine kinase family. In Arabidopsis the region carries two binding domains, a phosphoribosylpyrophosphate-binding domain and, at the very C-terminus, a uracil-binding domain. Length = 196 Score = 50.8 bits (122), Expect = 4e-07 Identities = 38/161 (23%), Positives = 57/161 (35%), Gaps = 25/161 (15%) Query: 85 VVGITGSVAVGKSTFAR----ILCIL-LQQISNFKVSLITTDGFLFPNAVLTANN--LMQ 137 ++G+ GS GK+T AR I + S D F + Sbjct: 1 IIGVAGSSGAGKTTVARTFVSIFGREGVPAAGIEGDSFHRYDRFYMDLHMEDRKRAGNNH 60 Query: 138 RKGF-PESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQPDILLIEGIN 196 F PE+ D + L ++K G P Y+H + + I DIL IEG++ Sbjct: 61 YSFFSPEANDFDLLYEQFKELKEG-GSGDKPIYNHV-TGEADPWPELIEGADILFIEGLH 118 Query: 197 VLQQNSLSDNQKATPMISDFLDFSIYIDAD-----KRDIHR 232 L ++ LD IY+D D + I R Sbjct: 119 GLYDER----------VAQLLDLKIYVDPDIDLELIQKIQR 149 >gnl|CDD|30201 cd02028, UMPK_like, Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).. Length = 179 Score = 44.1 bits (104), Expect = 4e-05 Identities = 36/146 (24%), Positives = 59/146 (40%), Gaps = 25/146 (17%) Query: 85 VVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPES 144 VVGI G GK+TFA+ L L +++ +I+ D + P T + F Sbjct: 1 VVGIAGPSGSGKTTFAKKLSNQL-RVNGIGPVVISLDDYYVPR--KTPRDEDGNYDFESI 57 Query: 145 YDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGE---YDTIIQP--DILLIEGINVLQ 199 D + L L D+ +G K+V +P YD G+ Y + P ++++EGI L Sbjct: 58 LDLDLLNKNLHDLLNG-KEVELP-----IYDFRTGKRRGYRKLKLPPSGVVILEGIYALN 111 Query: 200 QNSLSDNQKATPMISDFLDFSIYIDA 225 + LD + + Sbjct: 112 -----------ERLRSLLDIRVAVSG 126 >gnl|CDD|38089 KOG2878, KOG2878, KOG2878, Predicted kinase [General function prediction only]. Length = 282 Score = 43.9 bits (103), Expect = 5e-05 Identities = 38/137 (27%), Positives = 57/137 (41%), Gaps = 28/137 (20%) Query: 61 NSAKITCHQYNKFLN------LKEESKIPFVVGITGSVAVGKSTFARILCILLQQ--ISN 112 N K+T Q +FL+ K+ +P V+G +G GKST L L + I Sbjct: 3 NELKLTIDQKARFLHKYIPVFFKDGDDVPLVIGFSGPQGSGKSTLVFALDYKLTKKYIQE 62 Query: 113 FKVSLITTDGFL------------FPNAVLTANNLMQRKGFPESYD---SNKLLTFLSDV 157 + + I+ D F PN N L+Q +G ++D ++L LS + Sbjct: 63 YSSATISVDDFYLTHEGQAELRKKNPN-----NALLQYRGLAGTHDLKLLVEVLNALSKL 117 Query: 158 KSGKKKVAVPRYSHSQY 174 KV VPRY S + Sbjct: 118 TKDGLKVKVPRYDKSAF 134 >gnl|CDD|39404 KOG4203, KOG4203, KOG4203, Armadillo/beta-Catenin/plakoglobin [Signal transduction mechanisms, Cytoskeleton]. Length = 473 Score = 43.4 bits (102), Expect = 8e-05 Identities = 55/236 (23%), Positives = 93/236 (39%), Gaps = 45/236 (19%) Query: 79 ESKIPFVVGITGSVAVGKSTFARILCILLQQISNF----KVSLITTDGFLFPNAVLTANN 134 E K PFV+G+ G A GKST + L I +V L++ D F VLT+ Sbjct: 40 EGKEPFVIGVAGGTASGKSTVCEKIVEQLGAIERDGRQPQVVLLSQDSFY---KVLTSEE 96 Query: 135 LMQRK------GFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQP- 187 L + + P+++D L L ++K GK V +P Y + + E ++ P Sbjct: 97 LAKAQEGKYNFDHPDAFDFELLYLTLKNLKKGKA-VEIPVYDFVTHS-RDEEKTIVVYPA 154 Query: 188 DILLIEGINVLQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRETAFL 247 D++++EGI + D +++D D + R + Sbjct: 155 DVIILEGILAF----------YDERVRDLFTMKLFVDTDADVRLARRILRDI-------- 196 Query: 248 NPRSYFHHFTEISEEQSLKIAETAWNNINLPNLQHNILPTRKRADLILSKGEDHSV 303 I + ++ P + ILPT+K AD+I+ +G D+ V Sbjct: 197 --VERGRDLESILTQ---------YSTFVKPAFEEFILPTKKYADVIIPRGGDNDV 241 >gnl|CDD|30199 cd02026, PRK, Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes. This enzyme catalyzes the phosphorylation of D-ribulose 5-phosphate to form D-ribulose 1, 5-biphosphate, using ATP and NADPH produced by the primary reactions of photosynthesis.. Length = 273 Score = 41.0 bits (96), Expect = 4e-04 Identities = 47/218 (21%), Positives = 86/218 (39%), Gaps = 49/218 (22%) Query: 85 VVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGF--- 141 ++G+ G GKSTF R L L S+ V++I D + + + RK Sbjct: 1 IIGVAGDSGCGKSTFLRRLTSLF--GSDL-VTVICLDDYH-------SLDRKGRKETGIT 50 Query: 142 ---PESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQPDILLIEGINVL 198 P + + + + L +K G+ + P Y+H I E I I++IEG++ L Sbjct: 51 ALDPRANNFDLMYEQLKALKEGQA-IEKPIYNHVTGLIDPPEL--IKPTKIVVIEGLHPL 107 Query: 199 QQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRETAFLNPRSYFHHFTE 258 + + LDFS+Y+D W + R + R H + Sbjct: 108 ----------YDERVRELLDFSVYLDISDEVKFAWKIQRDMAERG----------HSLED 147 Query: 259 ISEEQSLKIAETAWNNINLPNLQHNILPTRKRADLILS 296 + S++ + P+ + I P ++ AD+++ Sbjct: 148 V--LASIEARK--------PDFEAYIDPQKQYADVVIQ 175 >gnl|CDD|38518 KOG3308, KOG3308, KOG3308, Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism]. Length = 225 Score = 38.8 bits (90), Expect = 0.002 Identities = 40/202 (19%), Positives = 66/202 (32%), Gaps = 19/202 (9%) Query: 80 SKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFP-NAVLTANNLMQR 138 S +VGI+G GK+T A+ L SLI D F P N + N + Sbjct: 1 SMKTLIVGISGCTNSGKTTLAKSLHRFFP-----GCSLIHQDDFYKPENEIEVDYNNIDN 55 Query: 139 KGFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQPD----ILLIEG 194 ES D K L ++ + R Y E I++I+G Sbjct: 56 WDLLESLDMEKFLEKIATWLDSRHNAPEAREHLVSYANFEHYAQQFQIKAYKNHIVIIDG 115 Query: 195 INVLQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRETAFLNPRSYFH 254 + D M++ Y +R R Y +T + +P + H Sbjct: 116 FMIYNYKPQVDLFDRIIMLT-----LDYETCKRRREARTYYPPD----DTGYFDPVVWPH 166 Query: 255 HFTEISEEQSLKIAETAWNNIN 276 + E + ++ + N + Sbjct: 167 YEKNFEEARDRSRHDSLFLNGD 188 >gnl|CDD|37913 KOG2702, KOG2702, KOG2702, Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism, Coenzyme transport and metabolism]. Length = 323 Score = 36.6 bits (84), Expect = 0.010 Identities = 36/154 (23%), Positives = 55/154 (35%), Gaps = 20/154 (12%) Query: 86 VGITGSVAVGKSTFARIL-------CILLQQISNFKVSLITTDGFLFPNAVLTA----NN 134 G+ G GKST + Q S ++ DGF L Sbjct: 122 TGLAGRPGTGKSTRIAAVDNAWPVNVNKFAQESINIAIIVPMDGFHLSRRCLDLFKDPQT 181 Query: 135 LMQRKGFPESYDSNKLLTFLSDV-KSGKKKVAVPRYSHSQYDILEGEYDTIIQPDILLIE 193 R+G P ++DSN L + K+ + VP + H+ D + + I+++E Sbjct: 182 AHARRGAPWTFDSNLFLQLCKILKKTTIPDIYVPSFDHALGDPVPDDICVSKFTRIVILE 241 Query: 194 GINVL-QQNSLSDNQKATPMISDFLDFSIYIDAD 226 G +L Q + D I LD ID D Sbjct: 242 GNYLLLDQENWKD-------IYKTLDDKYKIDVD 268 >gnl|CDD|30195 cd02022, DPCK, Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) catalyzes the phosphorylation of dephosphocoenzyme A (dCoA) to yield CoA, which is the final step in CoA biosynthesis.. Length = 179 Score = 34.0 bits (78), Expect = 0.047 Identities = 9/19 (47%), Positives = 15/19 (78%) Query: 85 VVGITGSVAVGKSTFARIL 103 ++G+TG + GKST A++L Sbjct: 1 IIGLTGGIGSGKSTVAKLL 19 >gnl|CDD|30586 COG0237, CoaE, Dephospho-CoA kinase [Coenzyme metabolism]. Length = 201 Score = 33.3 bits (76), Expect = 0.079 Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 83 PFVVGITGSVAVGKSTFARIL 103 ++G+TG + GKST A+IL Sbjct: 2 MLIIGLTGGIGSGKSTVAKIL 22 >gnl|CDD|33398 COG3598, RepA, RecA-family ATPase [DNA replication, recombination, and repair]. Length = 402 Score = 33.1 bits (75), Expect = 0.096 Identities = 29/170 (17%), Positives = 59/170 (34%), Gaps = 16/170 (9%) Query: 51 PLSHLLLINVNSAKITCHQYNKFL---NLKEESKIPFVVGITGSVAVGKSTFARILCILL 107 I V + + ++++ + E + +V + G VGK+T LCI L Sbjct: 54 VTITQSFIQVQAEAMRLSEWDRSNSPQLIDEFFRKGYVSILYGDSGVGKTTLLLYLCIAL 113 Query: 108 QQISN-FKVSLITTDGFLFPNAVLTANNLMQRK-------GFPESYDSNKLLTFLSDVKS 159 N F + L+ + L ++++R G + N LT +S Sbjct: 114 AAGKNLFGNKVKEPGKVLYVSLELYREDILERLEPVRARMGLSPADVRNMDLTDVSGAAD 173 Query: 160 GKKKVAVPRYSHSQYDILEGEYDTIIQPDILLIEGINVLQQNSLSDNQKA 209 ++ Y + + + D ++ + + S+SD Q Sbjct: 174 ESDVLSPKLYRRFEKILEQKRPDFVVIDPF-----VAFYEGKSISDVQVK 218 >gnl|CDD|146080 pfam03266, DUF265, Protein of unknown function, DUF265. Length = 168 Score = 32.6 bits (75), Expect = 0.15 Identities = 25/126 (19%), Positives = 48/126 (38%), Gaps = 37/126 (29%) Query: 85 VVGITGSVAVGKSTFA-RILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPE 143 + ITG VGK+T +++ +L + KV GF P ++ G Sbjct: 1 RIFITGPPGVGKTTLVKKVIELL--KSEGVKV-----GGFYTPE--------VREGGRRI 45 Query: 144 SYDSNKLLTFLSDVKSGKKKV-----AVPRYSHSQYDILEGEYDTII---------QPDI 189 +D + D+ SG++ V +Y + E++ I + D+ Sbjct: 46 GFD-------IVDLASGERGPLARVGGVSGPRVGKYVVNLEEFEEIALPALRRALEEADL 98 Query: 190 LLIEGI 195 ++I+ I Sbjct: 99 IIIDEI 104 >gnl|CDD|31889 COG1703, ArgK, Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]. Length = 323 Score = 31.4 bits (71), Expect = 0.31 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Query: 83 PFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLM 136 V+GITG GKST L L++ +V+++ D P++ T +++ Sbjct: 51 AHVIGITGVPGAGKSTLIEALGRELRE-RGHRVAVLAVD----PSSPFTGGSIL 99 >gnl|CDD|185762 cd09239, BRO1_HD-PTP_like, Protein-interacting, N-terminal, Bro1-like domain of mammalian His-Domain type N23 protein tyrosine phosphatase and related domains. This family contains the N-terminal, Bro1-like domain of mammalian His-Domain type N23 protein tyrosine phosphatase (HD-PTP) and related domains. It belongs to the BRO1_Alix_like superfamily which also includes the Bro1-like domains of mammalian Alix (apoptosis-linked gene-2 interacting protein X), RhoA-binding proteins Rhophilin-1 and -2, Brox, Bro1 and Rim20 (also known as PalA) from Saccharomyces cerevisiae, Ustilago maydis Rim23 (also known as PalC), and related domains. Alix, also known as apoptosis-linked gene-2 interacting protein 1 (AIP1), HD-PTP, Brox, Bro1, Rim20, and Rim23, interact with the ESCRT (Endosomal Sorting Complexes Required for Transport) system. HD-PTP participates in cell migration and endosomal trafficking. Bro1-like domains are boomerang-shaped, and part of the domain is a tetratricopeptide repeat (TPR)-like structure. Bro1-like domains bind components of the ESCRT-III complex: CHMP4 in the case of HD-PTP. The Bro1-like domain of HD-PTP can also bind human immunodeficiency virus type 1 (HIV-1) nucleocapsid. HD-PTP, and some other members of the BRO1_Alix_like superfamily including Alix, also have a V-shaped (V) domain. In the case of Alix, the V-domain contains a binding site for the retroviral late assembly (L) domain YPXnL motif, which is partially conserved in the V-domain superfamily. HD-PTP is encoded by the PTPN23 gene, a tumor suppressor gene candidate frequently absent in human kidney, breast, lung, and cervical tumors. This family also contains Drosophila Myopic which promotes epidermal growth factor receptor (EGFR) signaling, and Caenorhabditis elegans (enhancer of glp-1) EGO-2 which promotes Notch signaling. Length = 361 Score = 31.2 bits (71), Expect = 0.33 Identities = 10/29 (34%), Positives = 16/29 (55%) Query: 137 QRKGFPESYDSNKLLTFLSDVKSGKKKVA 165 KG P++ + + L+F DV GK+ A Sbjct: 288 NAKGQPDTVNLQEALSFTMDVIGGKRNSA 316 >gnl|CDD|72985 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 205 Score = 31.4 bits (71), Expect = 0.36 Identities = 9/25 (36%), Positives = 17/25 (68%) Query: 85 VVGITGSVAVGKSTFARILCILLQQ 109 ++ +TG GK+T A+IL L+++ Sbjct: 28 IIALTGKNGAGKTTLAKILAGLIKE 52 >gnl|CDD|145019 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain. This family consists of various cobyrinic acid a,c-diamide synthases. These include CbiA and CbiP from S.typhimurium, and CobQ from R. capsulatus. These amidases catalyse amidations to various side chains of hydrogenobyrinic acid or cobyrinic acid a,c-diamide in the biosynthesis of cobalamin (vitamin B12) from uroporphyrinogen III. Vitamin B12 is an important cofactor and an essential nutrient for many plants and animals and is primarily produced by bacteria. The family also contains dethiobiotin synthetases as well as the plasmid partitioning proteins of the MinD/ParA family. Length = 212 Score = 31.3 bits (71), Expect = 0.37 Identities = 38/184 (20%), Positives = 59/184 (32%), Gaps = 40/184 (21%) Query: 84 FVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPE 143 + G G V GK+T A L L + ++V LI D AN P+ Sbjct: 2 AIAGTKGGV--GKTTLAANLARALAK-RGYRVLLIDLDP--------QANLTSSLGKGPD 50 Query: 144 SYDSNKLLTFLSDVKSGKKKVAVPRYSH-----------------SQYDILEGEYDTIIQ 186 D K + D + + A S ILEG + +I+ Sbjct: 51 LIDVLKEGLEIVDAQPLQHIAAAIVPSRNLDPLLLIPSNLSLANFESELILEGGEEGLIK 110 Query: 187 P--DILLIE---GINVLQQNSLSDNQKA----TPMISDFLDFSIYIDADKR---DIHRWY 234 D ++I+ G+ L N+L P L ++ +R I Sbjct: 111 LAYDYVIIDGAPGLGELTANALVAADILVVPIEPEGVAVLGAQRLLELVERLGLKILGVV 170 Query: 235 LNRF 238 LN+ Sbjct: 171 LNKV 174 >gnl|CDD|38430 KOG3220, KOG3220, KOG3220, Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism]. Length = 225 Score = 31.0 bits (70), Expect = 0.39 Identities = 9/20 (45%), Positives = 15/20 (75%) Query: 84 FVVGITGSVAVGKSTFARIL 103 +VG+TG +A GKST +++ Sbjct: 2 LIVGLTGGIATGKSTVSQVF 21 >gnl|CDD|48378 cd03114, ArgK-like, The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.. Length = 148 Score = 31.0 bits (70), Expect = 0.42 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 85 VVGITGSVAVGKSTFARILCILLQQISNFKVSLITTD 121 V+GITG GKST L L+ +V+++ D Sbjct: 1 VIGITGVPGAGKSTLIDALITALRA-RGKRVAVLAID 36 >gnl|CDD|73178 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]. Length = 268 Score = 31.0 bits (70), Expect = 0.47 Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Query: 78 EESKIPFVVGITGSVAVGKSTFARILCILLQ 108 +E + +VG +G GKST R++ L + Sbjct: 37 KEGETLGLVGESGC---GKSTLGRLILGLEE 64 >gnl|CDD|73295 cd02019, NK, Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.. Length = 69 Score = 29.9 bits (67), Expect = 0.86 Identities = 12/34 (35%), Positives = 16/34 (47%) Query: 85 VVGITGSVAVGKSTFARILCILLQQISNFKVSLI 118 ++ ITG GKST A+ L L S + I Sbjct: 1 IIAITGGSGSGKSTVAKKLAEQLGGRSVVVLDEI 34 >gnl|CDD|73019 cd03260, ABC_PstB_phosphate_transporter, Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).. Length = 227 Score = 29.4 bits (66), Expect = 1.2 Identities = 12/44 (27%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Query: 74 LNLK-EESKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVS 116 ++L + +I ++G +G GKST R+L L I Sbjct: 19 ISLDIPKGEITALIGPSGC---GKSTLLRLLNRLNDLIPGAPDE 59 >gnl|CDD|112137 pfam03308, ArgK, ArgK protein. The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems. Length = 267 Score = 29.3 bits (66), Expect = 1.3 Identities = 9/15 (60%), Positives = 9/15 (60%) Query: 85 VVGITGSVAVGKSTF 99 VGITG GKST Sbjct: 31 RVGITGVPGAGKSTL 45 >gnl|CDD|144640 pfam01121, CoaE, Dephospho-CoA kinase. This family catalyses the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form Coenzyme A EC:2.7.1.24. This enzyme uses ATP in its reaction. Length = 179 Score = 29.2 bits (66), Expect = 1.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 85 VVGITGSVAVGKSTFARIL 103 +VG+TG + GKST A + Sbjct: 2 IVGLTGGIGSGKSTVANLF 20 >gnl|CDD|36000 KOG0781, KOG0781, KOG0781, Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]. Length = 587 Score = 29.2 bits (65), Expect = 1.5 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Query: 77 KEESKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGF 123 K P+V+ G VGKST + L Q + F+V + D F Sbjct: 372 ARRRKRPYVISFVGVNGVGKSTNLAKIAYWLLQ-NKFRVLIAACDTF 417 >gnl|CDD|73005 cd03246, ABCC_Protease_Secretion, This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain. They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substrates ranges from inorganic ions, nutrients such as amino acids, sugars, or peptides, hydrophobic drugs, to large polypeptides, such as HlyA.. Length = 173 Score = 29.0 bits (65), Expect = 1.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 85 VVGITGSVAVGKSTFARILCILLQ 108 + I G GKST AR++ LL+ Sbjct: 30 SLAIIGPSGSGKSTLARLILGLLR 53 >gnl|CDD|37960 KOG2749, KOG2749, KOG2749, mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1 [RNA processing and modification]. Length = 415 Score = 29.1 bits (65), Expect = 1.7 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 72 KFLNLKEESKIPFVVGITGSVAVGKSTFARILC 104 + +E S P V+ + G VGKST RIL Sbjct: 93 RMQAEEESSYGPRVM-VVGPTDVGKSTLCRILL 124 >gnl|CDD|31609 COG1419, FlhF, Flagellar GTP-binding protein [Cell motility and secretion]. Length = 407 Score = 28.4 bits (63), Expect = 2.4 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Query: 64 KITCHQYNKFLNLKEESKIPF---VVGITGSVAVGKST-FARILCILLQQISNFKVSLIT 119 + + K L E+ I V+ + G VGK+T A++ + KV++IT Sbjct: 181 RYFSEKLRKLLLSLIENLIVEQKRVIALVGPTGVGKTTTLAKLAARYVMLKKKKKVAIIT 240 Query: 120 TDGF 123 TD + Sbjct: 241 TDTY 244 >gnl|CDD|31438 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]. Length = 591 Score = 28.6 bits (64), Expect = 2.4 Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 85 VVGITGSVAVGKSTFARIL 103 V+GI G +GK+TF ++L Sbjct: 369 VIGILGPNGIGKTTFVKLL 387 Score = 28.2 bits (63), Expect = 3.1 Identities = 21/92 (22%), Positives = 33/92 (35%), Gaps = 31/92 (33%) Query: 85 VVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFP-- 142 VVGI G +GKST +IL G L P NL + + P Sbjct: 102 VVGILGPNGIGKSTALKILA-----------------GELKP-------NLGRYEDPPSW 137 Query: 143 ----ESYDSNKLLTFLSDVKSGKKKVAV-PRY 169 + + +L + + G+ + P+Y Sbjct: 138 DEVIKRFRGTELQNYFKKLYEGELRAVHKPQY 169 >gnl|CDD|146036 pfam03205, MobB, Molybdopterin guanine dinucleotide synthesis protein B. This protein contains a P-loop. Length = 122 Score = 28.5 bits (64), Expect = 2.5 Identities = 7/21 (33%), Positives = 10/21 (47%) Query: 84 FVVGITGSVAVGKSTFARILC 104 +V + G GK+T R L Sbjct: 1 PIVLVVGPKDSGKTTLIRKLL 21 >gnl|CDD|30898 COG0552, FtsY, Signal recognition particle GTPase [Intracellular trafficking and secretion]. Length = 340 Score = 28.3 bits (63), Expect = 2.9 Identities = 16/51 (31%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Query: 73 FLNLKEESKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGF 123 + K PFV+ G VGK+T L L+Q V L D F Sbjct: 129 LPLEIPKEKKPFVILFVGVNGVGKTTTIAKLAKYLKQ-QGKSVLLAAGDTF 178 >gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 157 Score = 28.0 bits (62), Expect = 3.2 Identities = 10/27 (37%), Positives = 14/27 (51%) Query: 85 VVGITGSVAVGKSTFARILCILLQQIS 111 +V + G GKST R + LL+ S Sbjct: 27 IVALVGPNGSGKSTLLRAIAGLLKPTS 53 >gnl|CDD|37046 KOG1835, KOG1835, KOG1835, Uncharacterized conserved protein [Function unknown]. Length = 1704 Score = 28.0 bits (62), Expect = 3.3 Identities = 33/159 (20%), Positives = 60/159 (37%), Gaps = 7/159 (4%) Query: 29 ISNQLLSFDSPIDSTEIYKIYFPLSHLLLINVNSAKITCHQYNKFLNLKEESKIPFVVGI 88 +++ L+ + D KI+ S +L N N + L+L +P ++G+ Sbjct: 132 VTSILMLKEEREDIPTRLKIFLN-SAFILENGNKLLFQQIWFFPVLSLIVRLILPLILGL 190 Query: 89 TGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPESYDSN 148 GS + A + I + VS + + F N +L + +L Q F Sbjct: 191 LGSKSQ-ILQRAAFIEIRDEVH----VSELDINVFPGINYLLASVHLFQIVKFVIRRVHL 245 Query: 149 KLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQP 187 + F+ D+K K +PR + +L I P Sbjct: 246 LITAFIDDMKI-KSSELLPRADADIFQVLTNMILGIEPP 283 >gnl|CDD|31805 COG1618, COG1618, Predicted nucleotide kinase [Nucleotide transport and metabolism]. Length = 179 Score = 27.5 bits (61), Expect = 4.6 Identities = 12/42 (28%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Query: 79 ESKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITT 120 K+ + ITG VGK+T + L++ +KV T Sbjct: 1 MIKMAMKIFITGRPGVGKTTLVLKIAEKLRE-KGYKVGGFIT 41 >gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 211 Score = 27.8 bits (62), Expect = 4.6 Identities = 12/26 (46%), Positives = 13/26 (50%) Query: 86 VGITGSVAVGKSTFARILCILLQQIS 111 V I G GKST R+L LL S Sbjct: 30 VLIVGPNGSGKSTLLRLLNGLLGPTS 55 >gnl|CDD|34241 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]. Length = 580 Score = 27.5 bits (61), Expect = 4.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Query: 85 VVGITGSVAVGKSTFARIL 103 +GI G GKST AR+L Sbjct: 364 ALGIIGPSGSGKSTLARLL 382 >gnl|CDD|39436 KOG4235, KOG4235, KOG4235, Mitochondrial thymidine kinase 2/deoxyguanosine kinase [Nucleotide transport and metabolism]. Length = 244 Score = 27.3 bits (60), Expect = 5.1 Identities = 11/28 (39%), Positives = 15/28 (53%) Query: 76 LKEESKIPFVVGITGSVAVGKSTFARIL 103 L E + + I G++AVGKSTF Sbjct: 15 LHEGTGPKRLSIIEGNIAVGKSTFLNFF 42 >gnl|CDD|119440 cd06578, HemD, Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme. This ubiquitous enzyme is present in eukaryotes, bacteria and archaea. Mutations in the human uroporphyrinogen-III synthase gene cause congenital erythropoietic porphyria, a recessive inborn error of metabolism also known as Gunther disease. Length = 239 Score = 27.3 bits (61), Expect = 5.1 Identities = 16/54 (29%), Positives = 22/54 (40%), Gaps = 6/54 (11%) Query: 131 TANNLMQRKGF-----PESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEG 179 TA L + G PE DS LL L K++ PR ++ D+ E Sbjct: 88 TAEAL-REAGLTADFVPEEGDSEGLLELLELQDGKGKRILRPRGGRAREDLAEA 140 >gnl|CDD|30631 COG0283, Cmk, Cytidylate kinase [Nucleotide transport and metabolism]. Length = 222 Score = 27.5 bits (61), Expect = 5.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 81 KIPFVVGITGSVAVGKSTFARIL 103 K ++ I G GKST A+IL Sbjct: 2 KAAIIIAIDGPAGSGKSTVAKIL 24 >gnl|CDD|73021 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively. Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQMP system of S. typhimurium, where HisJ is the extracellular solute binding proteins and HisP is the ABC protein.. Length = 213 Score = 27.4 bits (61), Expect = 5.6 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 7/82 (8%) Query: 85 VVGITGSVAVGKSTFARILCI-LLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFP- 142 VV I G GKST R CI LL++ + I DG + N L Q+ G Sbjct: 28 VVVIIGPSGSGKSTLLR--CINLLEEPDSGT---IIIDGLKLTDDKKNINELRQKVGMVF 82 Query: 143 ESYDSNKLLTFLSDVKSGKKKV 164 + ++ LT L ++ KV Sbjct: 83 QQFNLFPHLTVLENITLAPIKV 104 >gnl|CDD|111395 pfam02492, cobW, CobW/HypB/UreG, nucleotide-binding domain. This domain is found in HypB, a hydrogenase expression / formation protein, and UreG a urease accessory protein. Both these proteins contain a P-loop nucleotide binding motif. HypB has GTPase activity and is a guanine nucleotide binding protein. It is not known whether UreG binds GTP or some other nucleotide. Both enzymes are involved in nickel binding. HypB can store nickel and is required for nickel dependent hydrogenase expression. UreG is required for functional incorporation of the urease nickel metallocenter. GTP hydrolysis may required by these proteins for nickel incorporation into other nickel proteins. This family of domains also contains P47K, a Pseudomonas chlororaphis protein needed for nitrile hydratase expression, and the cobW gene product, which may be involved in cobalamin biosynthesis in Pseudomonas denitrificans. Length = 174 Score = 27.2 bits (61), Expect = 5.6 Identities = 10/38 (26%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Query: 84 FVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTD 121 V +TG + GK+T + +L K+++I D Sbjct: 1 PVTVLTGFLGSGKTTL--LEHLLRDNREGLKIAVIVND 36 >gnl|CDD|31532 COG1341, COG1341, Predicted GTPase or GTP-binding protein [General function prediction only]. Length = 398 Score = 27.2 bits (60), Expect = 5.8 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Query: 75 NLKEESKIPFVVGITGSVAVGKSTFARILC-ILLQQISNFKVSLITTD 121 + E + VV + G V GKST L LL + KV++I D Sbjct: 65 SKSESAGKVGVVMVVGPVDSGKSTLTTYLANKLLARG--RKVAIIDAD 110 >gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]. Length = 709 Score = 27.1 bits (60), Expect = 6.2 Identities = 9/24 (37%), Positives = 12/24 (50%) Query: 85 VVGITGSVAVGKSTFARILCILLQ 108 V I G GKST ++L L + Sbjct: 501 KVAIVGRSGSGKSTLLKLLLGLYK 524 >gnl|CDD|30191 cd01673, dNK, Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs). This family consists of various deoxynucleoside kinases including deoxyribo- cytidine (EC 2.7.1.74), guanosine (EC 2.7.1.113), adenosine (EC 2.7.1.76), and thymidine (EC 2.7.1.21) kinases. They are key enzymes in the salvage of deoxyribonucleosides originating from extra- or intracellular breakdown of DNA.. Length = 193 Score = 27.1 bits (60), Expect = 6.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 85 VVGITGSVAVGKSTFARIL 103 V+ + G++ GKST A+ L Sbjct: 1 VIVVEGNIGAGKSTLAKEL 19 >gnl|CDD|31775 COG1587, HemD, Uroporphyrinogen-III synthase [Coenzyme metabolism]. Length = 248 Score = 26.9 bits (59), Expect = 6.4 Identities = 18/71 (25%), Positives = 26/71 (36%), Gaps = 14/71 (19%) Query: 131 TANNLMQRKG----FPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQ 186 TA L + PE DS LL L ++ G K+V + R + + + E Sbjct: 89 TAEALRKLGIKVDFIPEDGDSEGLLEELPELLKGGKRVLILRGNGGREVLEEK------- 141 Query: 187 PDILLIEGINV 197 L G V Sbjct: 142 ---LEERGAEV 149 >gnl|CDD|31385 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 259 Score = 27.1 bits (59), Expect = 6.5 Identities = 31/145 (21%), Positives = 47/145 (32%), Gaps = 20/145 (13%) Query: 80 SKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRK 139 KI V G VGK+T A L L + KV LI D P LT+ ++ Sbjct: 2 MKIIAVANQKG--GVGKTTTAVNLAAALAKRGGKKVLLIDLD----PQGSLTSWLGLRPD 55 Query: 140 GFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQPDILLIEGINVLQ 199 + Y+ L + + D++ D +I L L Sbjct: 56 LEGDLYN-------LLSGLKERPDILDYTVVIEGLDLIPSNIDLAEGAEIELNAVAKELL 108 Query: 200 QNSLSDNQKATPMISDFLDFSIYID 224 ++ + D D+ I ID Sbjct: 109 L------KRLLDPVKDDYDY-IIID 126 >gnl|CDD|73290 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.. Length = 99 Score = 27.0 bits (59), Expect = 7.0 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 85 VVGITGSVAVGKSTFARILCILLQQISNFKVSLI 118 V+ +TG VGK+T A L L + +V LI Sbjct: 1 VIVVTGKGGVGKTTLAANLAAALAK-RGKRVLLI 33 >gnl|CDD|30197 cd02024, NRK1, Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+). This enzyme catalyzes the phosphorylation of nicotinamide riboside (NR) to form nicotinamide mononucleotide (NMN). It defines the NR salvage pathway of NAD+ biosynthesis in addition to the pathways through nicotinic acid mononucleotide (NaMN). This enzyme can also phosphorylate the anticancer drug tiazofurin, which is an analog of nicotinamide riboside.. Length = 187 Score = 26.8 bits (59), Expect = 7.6 Identities = 26/127 (20%), Positives = 48/127 (37%), Gaps = 26/127 (20%) Query: 85 VVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGF--- 141 +VGI+G GK+T A+ +L + + N +I D F P + + GF Sbjct: 1 IVGISGVTNSGKTTLAK---LLQRILPN--CCVIHQDDFFKPEDEIP----VDENGFKQW 51 Query: 142 --PESYDSNKLLTFLSDVKSGK----------KKVAVPRYSHSQYDILEGEYDTIIQPD- 188 E+ D +++ L + + + I E + D + D Sbjct: 52 DVLEALDMEAMMSTLDYWRETGHFPKFLRSHGNENDPEKEFIEDAQIEETKADLLGAEDL 111 Query: 189 -ILLIEG 194 IL+++G Sbjct: 112 HILIVDG 118 >gnl|CDD|38804 KOG3598, KOG3598, KOG3598, Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription]. Length = 2220 Score = 27.0 bits (59), Expect = 7.7 Identities = 9/37 (24%), Positives = 18/37 (48%) Query: 198 LQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWY 234 +SL ++++ ++ L F + DKR I +Y Sbjct: 116 DLSSSLVLARRSSTLLCQALGFLFEMAQDKRKIDAYY 152 >gnl|CDD|133448 cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase. NADP binding domain of the Methylene-Tetrahydrofolate Dehydrogenase/cyclohydrolase (m-THF DH/cyclohydrolase) bifunctional enzyme. Tetrahydrofolate is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. In addition, most DHs also have an associated cyclohydrolase activity which catalyzes its hydrolysis to N10-formyltetrahydrofolate. m-THF DH is typically found as part of a multifunctional protein in eukaryotes. NADP-dependent m-THF DH in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional DH/cyclodrolase form. In bacteria, monofucntional DH, as well as bifunctional m-THF m-THF DHm-THF DHDH/cyclodrolase are found. In addition, yeast (S. cerevisiae) also express an monofunctional DH. This family contains the bifunctional DH/cyclohydrolase. M-THF DH, like other amino acid DH-like NAD(P)-binding domains, is a member of the Rossmann fold superfamily which includes glutamate, leucine, and phenylalanine DHs, m-THF DH, methylene-tetrahydromethanopterin DH, m-THF DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel domain, CoA-binding, and ornithine cyclodeaminase-like domains. Length = 168 Score = 26.7 bits (60), Expect = 7.9 Identities = 22/53 (41%), Positives = 27/53 (50%), Gaps = 15/53 (28%) Query: 51 PLSHLLLINVNSAKIT-CHQYNKFLNLKEESK---IPFVVGITGSVAVGKSTF 99 PL+ LLL +A +T CH K NLKE +K I V+ VAVGK Sbjct: 59 PLAALLL--NRNATVTVCHSKTK--NLKEHTKQADI--VI-----VAVGKPGL 100 >gnl|CDD|29743 cd01140, FatB, Siderophore binding protein FatB. These proteins have been shown to function as ABC-type initial receptors in the siderophore-mediated iron uptake in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.. Length = 270 Score = 26.7 bits (59), Expect = 8.5 Identities = 19/88 (21%), Positives = 35/88 (39%), Gaps = 15/88 (17%) Query: 146 DSNKLLTFLSDVKSGK-KKVAVPRYSHSQYDILEGEYDTI--IQPDILLIEGINVLQQNS 202 S+ L +L K K V E + + I ++PD+++I G Sbjct: 38 KSSTLPEYLKKYKDDKYANVGTLF---------EPDLEAIAALKPDLIIIGG---RLAEK 85 Query: 203 LSDNQKATPMISDFLDFSIYIDADKRDI 230 + +K P I D Y+++ K++I Sbjct: 86 YDELKKIAPTIDLGADLKNYLESVKQNI 113 >gnl|CDD|31113 COG0770, MurF, UDP-N-acetylmuramyl pentapeptide synthase [Cell envelope biogenesis, outer membrane]. Length = 451 Score = 26.4 bits (58), Expect = 9.0 Identities = 10/27 (37%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Query: 83 PFVVGITGSVAVGKSTFARILCILLQQ 109 V+ ITGS GK+T +L +L Sbjct: 103 AKVIAITGS--NGKTTTKEMLAAILST 127 >gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]. Length = 539 Score = 26.7 bits (59), Expect = 9.5 Identities = 12/19 (63%), Positives = 14/19 (73%), Gaps = 3/19 (15%) Query: 85 VVGITGSVAVGKSTFARIL 103 +VG +GS GKST ARIL Sbjct: 322 LVGESGS---GKSTLARIL 337 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.136 0.397 Gapped Lambda K H 0.267 0.0704 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,696,608 Number of extensions: 191149 Number of successful extensions: 718 Number of sequences better than 10.0: 1 Number of HSP's gapped: 703 Number of HSP's successfully gapped: 74 Length of query: 311 Length of database: 6,263,737 Length adjustment: 94 Effective length of query: 217 Effective length of database: 4,232,491 Effective search space: 918450547 Effective search space used: 918450547 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (25.8 bits)