HHsearch results for GI: 254780828 and protein with PDBid: 1ryp_E

>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 2z5c_C 3bdm_D* 1z7q_E 1fnt_E* 2zcy_D* 1vsy_E ...
Probab=99.96  E-value=2.7e-27  Score=189.15  Aligned_cols=173  Identities=14%  Similarity=0.042  Sum_probs=142.6

Q ss_pred             CCEEEEEEEECCEEEEEECCCCCCCCEEEECCCEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHHCC--CCCCCHH
Q ss_conf             37179999979979998136545053677445105798159759997313058899999999999998536--6563067
Q gi|254780828|r   14 HATTILTVRKDGVVVIAGDGQVSLGQTVMKANARKVRRLGKGNIIAGFAGSSADAFTLLERLEKKLEQYPN--QLLRSSV   91 (190)
Q Consensus        14 ~GTTivgi~~~dgVviAaDtR~S~G~~v~sr~~~KI~~i~d~~~~~g~ag~a~d~~~~~~~~~~~~~~~~~--~~~~~~~   91 (190)
                      +|||+|||+++||||||+|+|.+.+ ++..++.+||++|+++++++ ++|..+|++.+.+.++.++++++.  ....++.
T Consensus        25 ~G~t~vgi~~~dgVvla~d~r~~~~-l~~~~~~~Ki~~i~~~i~~~-~sG~~~D~~~l~~~~~~~~~~~~~~~~~~~~~~  102 (242)
T 1ryp_E           25 LGSTAIGIATKEGVVLGVEKRATSP-LLESDSIEKIVEIDRHIGCA-MSGLTADARSMIEHARTAAVTHNLYYDEDINVE  102 (242)
T ss_dssp             TSCCEEEEECSSCEEEEEECCCSST-TBCGGGCCCEEEEETTEEEE-EEESGGGHHHHHHHHHHHHHHHHHHHSSCCCHH
T ss_pred             CCCCEEEEEECCEEEEEEECCCCCC-CCCCCCCCEEEEECCCEEEE-EEECHHHHHHHHHHHHHHHHHHHHHHCCCCCHH
T ss_conf             5987899995999999996776677-61567644299943979999-998479999999999999999899859999706


Q ss_pred             HHHHHHHHHHH-------------HHHCCCE--EEECC-CCCCEEEEECCCCCEECCCEEEEECCHHHHHHHHHHHHCCC
Q ss_conf             99999976112-------------2201310--45137-87646998058631141327996064234578898520789
Q gi|254780828|r   92 ELAKDWRMDKY-------------LRNLEAM--ILIAD-KTITLVITGMGDVLEPENGVMAIGSGGSYALSAARALMSTQ  155 (190)
Q Consensus        92 ~~~~~~~~~~y-------------~~~~~~~--~~~~~-~~~~~~~~~d~~g~~~~~~~~a~GSGs~~A~g~Le~~y~~~  155 (190)
                      .+++.+....+             .+++...  +.+.| .++|.+|..|+.|+..+.++.|+|+|+.+++++|++.|+++
T Consensus       103 ~l~~~la~~~~~~~~~~~~~~~~~~rP~~~~~li~G~D~~~~p~Ly~idp~G~~~~~~~~a~G~g~~~~~~~Le~~~~~~  182 (242)
T 1ryp_E          103 SLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSS  182 (242)
T ss_dssp             HHHHHHHTTTTCCBSSCTTSCCCBSSCCSEEEEEEEEETTTEEEEEEECTTSCEEEBSEEEESTTHHHHHHHHHHHCCTT
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHCCCCCEEEEEEEEECCCCCCEEEEECCCEEEEEECEEECCCCHHHHHHHHHHHCCCC
T ss_conf             68999999999986412302554367717999998870799967998869878997243870676599999999754699


Q ss_pred             CCHH---HHHHHHHHHHHCCCEEECCCEEEEEEECCC
Q ss_conf             9989---999999997540110225956999994178
Q gi|254780828|r  156 NSAE---EIARKAMSIAADICVYTNHNIVLETLKVGD  189 (190)
Q Consensus       156 ~sa~---ela~~Al~~A~erDvyTgd~i~i~~i~~~~  189 (190)
                      |+.+   +++.+||..+.++|. +++++++.+|..++
T Consensus       183 ms~~ea~~l~~~~l~~~~~~~~-~~~~~~v~~i~~~~  218 (242)
T 1ryp_E          183 LTLKEAELLVLKILKQVMEEKL-DENNAQLSCITKQD  218 (242)
T ss_dssp             CCHHHHHHHHHHHHHHHCSSCC-CTTSEEEEEEETTT
T ss_pred             CCHHHHHHHHHHHHHHHHHCCC-CCCCEEEEEEECCC
T ss_conf             9999999999999999985458-99976999998799