HHsearch alignment for GI: 254780829 and conserved domain: COG4650

>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms].
Probab=95.94  E-value=0.012  Score=36.45  Aligned_cols=39  Identities=33%  Similarity=0.589  Sum_probs=33.0

Q ss_pred             CCCEEEECCCCCCHHHHHHHHHH------HHCCCEEEEECCCEEE
Q ss_conf             68669967988868999999999------7078779714341012
Q gi|254780829|r   53 PKNILLVGPTGVGKTAISRRLAR------LAGAPFIKVEVTKFTE   91 (437)
Q Consensus        53 psNiLLiGPtGtGKTlLAktLA~------~l~VPF~~~daT~ftE   91 (437)
T Consensus       208 r~p~ll~gptgagksflarriyelk~arhq~sg~fvevncatlrg  252 (531)
T COG4650         208 RAPILLNGPTGAGKSFLARRIYELKQARHQFSGAFVEVNCATLRG  252 (531)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEEECC
T ss_conf             697686468874366899999999988875378627886300047