HHsearch alignment for GI: 254780829 and conserved domain: PRK03846

>PRK03846 adenylylsulfate kinase; Provisional.
Probab=96.52  E-value=0.0066  Score=38.26  Aligned_cols=40  Identities=15%  Similarity=0.209  Sum_probs=32.9

Q ss_pred             CCCEEEECCCCCCHHHHHHHHHHHH---CCCEEEEECCCEEEC
Q ss_conf             6866996798886899999999970---787797143410121
Q gi|254780829|r   53 PKNILLVGPTGVGKTAISRRLARLA---GAPFIKVEVTKFTEI   92 (437)
Q Consensus        53 psNiLLiGPtGtGKTlLAktLA~~l---~VPF~~~daT~ftE~   92 (437)
T Consensus        24 g~viWlTGLSGSGKTTlA~~L~~~L~~~~~~~~~LDGD~lR~~   66 (198)
T PRK03846         24 GVVLWFTGLSGSGKSTVAGALEEALHELGVHTYLLDGDNVRHG   66 (198)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECHHHHHHH
T ss_conf             8699987999998899999999999975997599777999874