>gi|254780831|ref|YP_003065244.1| hypothetical protein CLIBASIA_03620 [Candidatus Liberibacter asiaticus str. psy62]
MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV