HHsearch alignment for GI: 254780831 and conserved domain: COG0455

>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility].
Probab=100.00  E-value=4.4e-36  Score=260.43  Aligned_cols=228  Identities=26%  Similarity=0.398  Sum_probs=166.9

Q ss_pred             CCCEECCCCCCCCCHHHHHHHH-HHHHCCCCCEEEEEECCCCCCCCCCEECCCCCCC-CCC----CCCC----CCCCCCC
Q ss_conf             4201024466654257899998-9872357750698822467876531000245631-123----3445----7663223
Q gi|254780831|r   95 KKFVAVASGKGGVGKSTTVVNI-ACALKNKGKNVAILDADVYGPSIPKLLKISGKVE-ISD----KKFL----KPKENYG  164 (341)
Q Consensus        95 ~~iiav~SgKGGVGKSt~s~nL-a~ala~~G~~V~liDaDi~~ps~~~~lg~~~~~~-~~~----~~~i----~p~~~~g  164 (341)
T Consensus         2 ~~~Iav~SgKGGvGKTtitanlga~~~~~~~k~V~~iDaD~g~~nL~~~~g~~~~~~~l~dvL~~~~~~~Di~~~~~~~g   81 (262)
T COG0455           2 TKVIAVVSGKGGVGKTTITANLGAALAALGGKVVLLIDADLGLGNLSLLLGVESKPTTLHDVLAGEASIEDIIYETPQDG   81 (262)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHCCCCCCCCHHHHHHCCCCHHHEEEECCCCC
T ss_conf             78999984588756898998699999964897699996588887288885888885509999707787768023157689


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHHCCCCCCEEEEECCCCCHHHHH
Q ss_conf             03223334355221000134202478999867521377758997455644421000000022340267421443113456
Q gi|254780831|r  165 IKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDV  244 (341)
Q Consensus       165 i~~~s~g~l~~~~~~~~~rg~~~~~~l~~~l~~~~w~~~D~liiD~ppG~gd~~lsl~~~~~~~~~iiVttP~~~s~~da  244 (341)
T Consensus        82 l~vipg~~~~~~~~~~~--~~~~~~~~~~l-~----~~~D~iliD~~aGl~~~~~~~--~~~sd~~viVt~pe~~si~~A  152 (262)
T COG0455          82 LYVLPGGSGLEDLAKLD--PEDLEDVIKEL-E----ELYDYILIDTGAGLSRDTLSF--ILSSDELVIVTTPEPTSITDA  152 (262)
T ss_pred             EEEEECCCCHHHHHHCC--HHHHHHHHHHH-H----HCCCEEEEECCCCCCHHHHHH--HHHCCCEEEEECCCCCHHHHH
T ss_conf             89960788768886169--88899999998-7----529999996899966888999--873681799927985208999


Q ss_pred             HHHHHHHHCCCCCHHH--HHHHHCCCCCCCCCCEEECCCCCHHHHHHHHHCCCEEEECCCCHHHHHHHCCCCCEEEECCC
Q ss_conf             6677764001221144--55442024587788665124776589999984797898827998999750288217997799
Q gi|254780831|r  245 KRAISMYQKMNIPIIG--MIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMN  322 (341)
Q Consensus       245 ~r~~~~~~~~~~~i~G--iV~NMs~~~~~~~~~~~~~fg~~~~~~~a~~~~i~~lg~IP~d~~i~~a~~~g~P~v~~~p~  322 (341)
T Consensus       153 ~~~i~~~~~~~~~~~~~~vV~N~v~----~~~e~~~~~--~~~~~~~--~~~~~~~~i~~~~~v~~a~~~g~p~~~~~p~  224 (262)
T COG0455         153 YKTIKILSKLGLDLLGRRVVLNRVR----STKEGVDVA--ALLIQVV--KQVPVLQVIPFDPEVRRALAEGKPIVLYSPN  224 (262)
T ss_pred             HHHHHHHHHCCCCCCCCEEEEEECC----CCCCHHHHH--HHHHHHH--HHCCCEEEECCCHHHHHHHHCCCCEEEECCC
T ss_conf             9999999973876433158997036----666546789--9999999--7077434715675789986249867972889


Q ss_pred             CHHHHHHHHHHHHHHHH
Q ss_conf             98999999999999998
Q gi|254780831|r  323 SATSEIYQEISDRIQQF  339 (341)
Q Consensus       323 s~~a~~~~~iA~~i~~~  339 (341)
T Consensus       225 s~as~ai~~lA~~l~~~  241 (262)
T COG0455         225 SKASQAIKELAAKLAGL  241 (262)
T ss_pred             CHHHHHHHHHHHHHHCC
T ss_conf             78999999999998605