HHsearch alignment for GI: 254780831 and conserved domain: COG0529

>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism].
Probab=93.72  E-value=0.062  Score=32.88  Aligned_cols=38  Identities=37%  Similarity=0.381  Sum_probs=33.7

Q ss_pred             CEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             01024466654257899998987235775069882246
Q gi|254780831|r   97 FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV  134 (341)
Q Consensus        97 iiav~SgKGGVGKSt~s~nLa~ala~~G~~V~liDaDi  134 (341)
T Consensus        24 ~viW~TGLSGsGKSTiA~ale~~L~~~G~~~y~LDGDn   61 (197)
T COG0529          24 AVIWFTGLSGSGKSTIANALEEKLFAKGYHVYLLDGDN   61 (197)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCHH
T ss_conf             59996468888787999999999997597589855746