HHsearch alignment for GI: 254780831 and conserved domain: KOG2825

>KOG2825 consensus.
Probab=98.68  E-value=5.7e-08  Score=73.13  Aligned_cols=160  Identities=26%  Similarity=0.352  Sum_probs=88.7

Q ss_pred             CCEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCEECCC--CCCCCC---CCC---CCCCCCCCCEEE
Q ss_conf             201024466654257899998987235775069882246787653100024--563112---334---457663223032
Q gi|254780831|r   96 KFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKIS--GKVEIS---DKK---FLKPKENYGIKI  167 (341)
Q Consensus        96 ~iiav~SgKGGVGKSt~s~nLa~ala~~G~~V~liDaDi~~ps~~~~lg~~--~~~~~~---~~~---~i~p~~~~gi~~  167 (341)
T Consensus        20 KwifV-GGKGGVGKTTcs~sLAvqla~~r~~vLiISTDP-AHNlSDAF~qkftk~pt~V~Gf~nLfAMEIDp~~--e~~~   95 (323)
T KOG2825          20 KWIFV-GGKGGVGKTTCSCSLAVQLAKVRESVLIISTDP-AHNLSDAFSQKFTKTPTKVEGFENLFAMEIDPNV--EMGD   95 (323)
T ss_pred             EEEEE-CCCCCCCCCCHHHHHHHHHHCCCCCEEEEECCC-CCCHHHHHHHHHCCCCCCCCCHHHHEEEECCCCH--HHHH
T ss_conf             69997-676776765312689999861688647861685-3116788887751798303572231023228724--4415


Q ss_pred             C------------C--CCCCCCCCCCCCCCC---CCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHH-------
Q ss_conf             2------------3--334355221000134---202478999867521377758997455644421000000-------
Q gi|254780831|r  168 M------------S--MASLVDENVAMIWRG---PMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQ-------  223 (341)
Q Consensus       168 ~------------s--~g~l~~~~~~~~~rg---~~~~~~l~~~l~~~~w~~~D~liiD~ppG~gd~~lsl~~-------  223 (341)
T Consensus        96 ~~~m~~~~~~n~~~~g~g~l~e--~~~~~Pgideams---fae~~klvk~~~F~~vVFDTAP-TGHT-LRlL~fP~~lek  168 (323)
T KOG2825          96 MPEMFGNAANNEGSDGKGMLQE--LANAFPGIDEAMS---FAEVMKLVKGMNFDVVVFDTAP-TGHT-LRLLQFPTTLEK  168 (323)
T ss_pred             HHHHHHCCCCCCCCCCHHHHHH--HHHCCCCHHHHHH---HHHHHHHHHCCCCCEEEECCCC-CCCE-EHHHCCCHHHHH
T ss_conf             6787530021246652327999--8731888057775---8999988630664069951588-7641-025215268999


Q ss_pred             -----------------------------------C--------------C---CCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             -----------------------------------0--------------2---23402674214431134566677764
Q gi|254780831|r  224 -----------------------------------K--------------I---PLSGVVIVSTPQDLALIDVKRAISMY  251 (341)
Q Consensus       224 -----------------------------------~--------------~---~~~~~iiVttP~~~s~~da~r~~~~~  251 (341)
T Consensus       169 ~lgKl~~l~~k~~pm~sq~~sm~g~~~~~~~~l~~kle~~~~~i~~vn~qFkdpd~TtFVcVcI~eflslyEteRliqeL  248 (323)
T KOG2825         169 GLGKLLSLKNKIGPMLSQMGSMFGMEDAGADDLAGKLEELLEVIEKVNEQFKDPDCTTFVCVCIAEFLSLYETERLIQEL  248 (323)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEHHHHHHHHHHHHHHHHH
T ss_conf             99999889988788999876352545577778999999999999999997079987259998778888688899999999


Q ss_pred             HCCCCCHHHHHHHHC
Q ss_conf             001221144554420
Q gi|254780831|r  252 QKMNIPIIGMIENMS  266 (341)
Q Consensus       252 ~~~~~~i~GiV~NMs  266 (341)
T Consensus       249 ~k~~idthnIIVNQL  263 (323)
T KOG2825         249 AKQGIDTHNIIVNQL  263 (323)
T ss_pred             HHCCCCCCCEEEEEC
T ss_conf             864886112013302