HHsearch alignment for GI: 254780831 and conserved domain: KOG3381

>KOG3381 consensus.
Probab=93.17  E-value=0.13  Score=30.78  Aligned_cols=80  Identities=11%  Similarity=0.083  Sum_probs=62.3

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCEEECCCEEEEEEE--C-------CEEEEEEEECCCCHHHHHHHHHHHHHHH-HCCCCCC
Q ss_conf             0289999987203384797643635876556988--9-------9899999966878478999999999998-6067634
Q gi|254780831|r    4 ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIV--H-------NTVYLSITVPHTIAHQLQSLRSNAQQII-QNIPTVK   73 (341)
Q Consensus         4 it~~~I~e~L~~V~DPel~~dIv~lGlI~~I~I~--~-------~~V~i~l~lt~~~cp~~~~l~~~i~~~l-~~i~gv~   73 (341)
T Consensus        34 ~~~~~~~dlir~I~DPEhP~TLeqL~VV~ee~v~V~d~~~~~~~s~V~i~ftPTipHCSmaTlIGLcIrVkl~RsLp~rf  113 (161)
T KOG3381          34 EDAEEIFDLIRDIRDPEHPLTLEQLNVVSEEGVEVDDPNVGDEESYVRITFTPTIPHCSMATLIGLCIRVKLLRSLPPRF  113 (161)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHCCCEEECCEEEECCCCCCCCEEEEEEECCCCCCCHHHHHHHHEEEEEEEECCCCCE
T ss_conf             36789999986168988886588706242205676457778851389999536887522776642202665530488742


Q ss_pred             CEEEECCCCC
Q ss_conf             2355032223
Q gi|254780831|r   74 NAVVTLTENK   83 (341)
Q Consensus        74 ~v~V~lt~~~   83 (341)
T Consensus       114 kvdV~I~~Gt  123 (161)
T KOG3381         114 KVDVYIKPGT  123 (161)
T ss_pred             EEEEEECCCC
T ss_conf             6899975787