HHsearch alignment for GI: 254780831 and conserved domain: PRK00090

>PRK00090 bioD dithiobiotin synthetase; Reviewed.
Probab=98.81  E-value=2.6e-08  Score=75.38  Aligned_cols=188  Identities=19%  Similarity=0.210  Sum_probs=100.9

Q ss_pred             CEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCC----------CCEECCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             0102446665425789999898723577506988224678765----------310002456311233445766322303
Q gi|254780831|r   97 FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSI----------PKLLKISGKVEISDKKFLKPKENYGIK  166 (341)
Q Consensus        97 iiav~SgKGGVGKSt~s~nLa~ala~~G~~V~liDaDi~~ps~----------~~~lg~~~~~~~~~~~~i~p~~~~gi~  166 (341)
T Consensus         1 ~ifI~GT~T~vGKT~vt~~L~~~l~~~G~~v~~~KPv~tG~~~~~~~~Da~~~~~~~~~~~~-----~~~~~p~~~~~--   73 (223)
T PRK00090          1 VLFVTGTDTGVGKTVVTAALAQALREQGYRVAGYKPVQSGCDGGLRNGDALALQRLSGLPLD-----YELVNPYRFEE--   73 (223)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECEEEECCCCCCCCHHHHHHHHHHCCCCC-----HHHHCCCCCCC--
T ss_conf             98998689997699999999999997899489975120489889972799999998089998-----67605402588--


Q ss_pred             ECCCCCCCCCCCCCCCCCCCH-HHHHHHHHHHHCCCCCCEEEEECCCCCC---CCCCHHHHCCCC--CCEEEEECCCCCH
Q ss_conf             223334355221000134202-4789998675213777589974556444---210000000223--4026742144311
Q gi|254780831|r  167 IMSMASLVDENVAMIWRGPMV-QSAIMHMLHNVVWGQLDFLLIDMPPGTG---DAHLTIAQKIPL--SGVVIVSTPQDLA  240 (341)
Q Consensus       167 ~~s~g~l~~~~~~~~~rg~~~-~~~l~~~l~~~~w~~~D~liiD~ppG~g---d~~lsl~~~~~~--~~~iiVttP~~~s  240 (341)
T Consensus        74 p~s------P~~aa~~~g~~i~~~~i~~~~~~l~-~~~d~vlvEGaGGl~~Pl~~~~~~~Dla~~l~~pvILV~~~~lG~  146 (223)
T PRK00090         74 PLS------PHLAARLEGVTIDLEKISAALRELA-QQADLVLVEGAGGLLVPLTDDLTLADLAAQLQLPVILVVGVKLGC  146 (223)
T ss_pred             CCC------HHHHHHHHCCCCCHHHHHHHHHHHH-HHCCEEEEECCCCCCCCCCCCCCHHHHHHHHCCCEEEEECCCCCH
T ss_conf             989------8999999098468999999999998-318989994688655675678788999999688989997698880


Q ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCEEECCCCCHHHHHHHHHCCCEEEECCCCHHH
Q ss_conf             345666777640012211445544202458778866512477658999998479789882799899
Q gi|254780831|r  241 LIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDV  306 (341)
Q Consensus       241 ~~da~r~~~~~~~~~~~i~GiV~NMs~~~~~~~~~~~~~fg~~~~~~~a~~~~i~~lg~IP~d~~i  306 (341)
T Consensus       147 inhtllt~eal~~~gl~v~GvI~N~----~~~---~~~~~-~~~~~~l~~~~gvPvLG~iP~~~~~  204 (223)
T PRK00090        147 INHTLLTLEAIRARGLPLAGWVANG----VPP---EGLRH-AENLATLAELLPAPLLGRLPYLAEL  204 (223)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEEC----CCC---CHHHH-HHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             9999998999996899489999968----588---36677-7689999985499889975899998