HHsearch alignment for GI: 254780831 and conserved domain: PRK04220

>PRK04220 2-phosphoglycerate kinase; Provisional.
Probab=90.61  E-value=0.19  Score=29.68  Aligned_cols=78  Identities=17%  Similarity=0.231  Sum_probs=41.0

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCEEEE-C---CCC----CC-CCCC-------CCCCCCCCCEECCCCCCCCCHHHHHH
Q ss_conf             8478999999999998606763423550-3---222----34-3332-------22346542010244666542578999
Q gi|254780831|r   51 IAHQLQSLRSNAQQIIQNIPTVKNAVVT-L---TEN----KN-PPQQ-------RNNLNVKKFVAVASGKGGVGKSTTVV  114 (341)
Q Consensus        51 ~cp~~~~l~~~i~~~l~~i~gv~~v~V~-l---t~~----~~-~~~~-------~~~~~~~~iiav~SgKGGVGKSt~s~  114 (341)
T Consensus        32 ~~~~A~~ia~ei~~~L~~~-~~~~i~~~el~~~v~~~l~~~~~~~~a~rY~~~r~~r~~~~pliILigGtsGvGKSTlA~  110 (306)
T PRK04220         32 KPDLAYEIASEIEEELKKE-GITKITKEELRRRVYYKLIEKDYEEIAEKYLLWRRIRKSKEPIIILIGGASGVGTSTIAF  110 (306)
T ss_pred             CHHHHHHHHHHHHHHHHHC-CCEEECHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHH
T ss_conf             8889999999999999865-771635999999999999984409999999999998536998799985899887899999


Q ss_pred             HHHHHHCCCCCEEEEEECC
Q ss_conf             9898723577506988224
Q gi|254780831|r  115 NIACALKNKGKNVAILDAD  133 (341)
Q Consensus       115 nLa~ala~~G~~V~liDaD  133 (341)
T Consensus       111 ~LA~rLg---I~~-visTD  125 (306)
T PRK04220        111 ELASRLG---IRS-VIGTD  125 (306)
T ss_pred             HHHHHHC---CCE-EECCH
T ss_conf             9999709---883-42221