HHsearch alignment for GI: 254780831 and conserved domain: PRK05380

>PRK05380 pyrG CTP synthetase; Validated.
Probab=92.91  E-value=0.81  Score=25.45  Aligned_cols=41  Identities=32%  Similarity=0.519  Sum_probs=31.0

Q ss_pred             CCEECCCC-CCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCC
Q ss_conf             20102446-665425789999898723577506988224678
Q gi|254780831|r   96 KFVAVASG-KGGVGKSTTVVNIACALKNKGKNVAILDADVYG  136 (341)
Q Consensus        96 ~iiav~Sg-KGGVGKSt~s~nLa~ala~~G~~V~liDaDi~~  136 (341)
T Consensus         3 KyIfVTGGVvS~lGKGi~aaSig~lLk~~G~~V~~~K~DPYl   44 (534)
T PRK05380          3 KYIFVTGGVVSSLGKGITAASLGALLKARGLKVTIQKLDPYL   44 (534)
T ss_pred             EEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCC
T ss_conf             099996983015740899999999999789658898414652