HHsearch alignment for GI: 254780831 and conserved domain: PRK05748

>PRK05748 replicative DNA helicase; Provisional.
Probab=92.18  E-value=0.43  Score=27.26  Aligned_cols=38  Identities=34%  Similarity=0.526  Sum_probs=31.9

Q ss_pred             CCEECCCCCCCCCHHHHHHHHHHHHC-CCCCEEEEEECCC
Q ss_conf             20102446665425789999898723-5775069882246
Q gi|254780831|r   96 KFVAVASGKGGVGKSTTVVNIACALK-NKGKNVAILDADV  134 (341)
Q Consensus        96 ~iiav~SgKGGVGKSt~s~nLa~ala-~~G~~V~liDaDi  134 (341)
T Consensus       204 ~Livia-aRP~mGKTa~alnia~~~a~~~~~~v~~fSlEM  242 (448)
T PRK05748        204 DLIIVA-ARPSVGKTAFALNIAQNVATKTDKNVAIFSLEM  242 (448)
T ss_pred             CEEEEE-ECCCCCHHHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             379998-479987689999999999985698089981778