HHsearch alignment for GI: 254780831 and conserved domain: PRK08506

>PRK08506 replicative DNA helicase; Provisional.
Probab=93.29  E-value=0.091  Score=31.76  Aligned_cols=38  Identities=29%  Similarity=0.533  Sum_probs=33.1

Q ss_pred             CCEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             201024466654257899998987235775069882246
Q gi|254780831|r   96 KFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV  134 (341)
Q Consensus        96 ~iiav~SgKGGVGKSt~s~nLa~ala~~G~~V~liDaDi  134 (341)
T Consensus       194 dLiIIA-ARPsmGKTAfAlniA~~~a~~~~~V~~FSLEM  231 (473)
T PRK08506        194 DLIIIA-ARPSMGKTTLVLNMVLKALNQGKGVAFFSLEM  231 (473)
T ss_pred             CEEEEE-CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             279995-07998678999999999996599658982247