HHsearch alignment for GI: 254780831 and conserved domain: PRK09841

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional.
Probab=99.91  E-value=1.4e-24  Score=183.84  Aligned_cols=162  Identities=15%  Similarity=0.281  Sum_probs=128.7

Q ss_pred             CCCEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCEECCCCCCCCCC--------CCCCCCCCCCCEE
Q ss_conf             42010244666542578999989872357750698822467876531000245631123--------3445766322303
Q gi|254780831|r   95 KKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISD--------KKFLKPKENYGIK  166 (341)
Q Consensus        95 ~~iiav~SgKGGVGKSt~s~nLa~ala~~G~~V~liDaDi~~ps~~~~lg~~~~~~~~~--------~~~i~p~~~~gi~  166 (341)
T Consensus       531 ~kvi~vTS~~pgEGKSt~a~nLA~~~A~~G~rvLLID~DlRrp~l~~~~~~~~~~GLs~~L~g~~~~~~~i~~~~~~~ld  610 (726)
T PRK09841        531 NNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFD  610 (726)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHCCCCCCCCHHHHHCCCCCHHHHCCCCCCCCEE
T ss_conf             86899977999997799999999999847995999828877710776159999987799838999889933027989989


Q ss_pred             ECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCC--CCCCCHHHHCCCCCCEEEEECCCCCHHHHH
Q ss_conf             223334355221000134202478999867521377758997455644--421000000022340267421443113456
Q gi|254780831|r  167 IMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGT--GDAHLTIAQKIPLSGVVIVSTPQDLALIDV  244 (341)
Q Consensus       167 ~~s~g~l~~~~~~~~~rg~~~~~~l~~~l~~~~w~~~D~liiD~ppG~--gd~~lsl~~~~~~~~~iiVttP~~~s~~da  244 (341)
T Consensus       611 vl~aG~~p~nP-~el----L~s~~~~~ll~~l~-~~yD~IIiDtPPvl~v~Da-~~l~~--~~D~~l~Vvr~g~T~~~~~  681 (726)
T PRK09841        611 VITRGQVPPNP-SEL----LMRDRMRQLLEWAN-DHYDLVIVDTPPMLAVSDA-AVVGR--SVGTSLLVARFGLNTAKEV  681 (726)
T ss_pred             EEECCCCCCCH-HHH----HCCHHHHHHHHHHH-HCCCEEEEECCCCCCCCHH-HHHHH--HCCEEEEEEECCCCCHHHH
T ss_conf             98289999798-999----58769999999998-1399999919996534159-99999--7895999997996889999


Q ss_pred             HHHHHHHHCCCCCHHHHHHHH
Q ss_conf             667776400122114455442
Q gi|254780831|r  245 KRAISMYQKMNIPIIGMIENM  265 (341)
Q Consensus       245 ~r~~~~~~~~~~~i~GiV~NM  265 (341)
T Consensus       682 ~~a~~~l~~~~~~v~G~vlN~  702 (726)
T PRK09841        682 SLSMQRLEQAGVNIKGAILNG  702 (726)
T ss_pred             HHHHHHHHHCCCCEEEEEECC
T ss_conf             999999997899758999828