HHsearch alignment for GI: 254780831 and conserved domain: PRK10867

>PRK10867 signal recognition particle protein; Provisional.
Probab=98.07  E-value=0.00012  Score=50.99  Aligned_cols=117  Identities=20%  Similarity=0.294  Sum_probs=65.2

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCE----EECCCEEEEEE--ECCEEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             20289999987203384797643----63587655698--8998999999668784789999999999986067634235
Q gi|254780831|r    3 QILKNQIVDSLKVLSIPGEKNNI----VEMQRLSEIFI--VHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAV   76 (341)
Q Consensus         3 ~it~~~I~e~L~~V~DPel~~dI----v~lGlI~~I~I--~~~~V~i~l~lt~~~cp~~~~l~~~i~~~l~~i~gv~~v~   76 (341)
T Consensus        21 ~lte~~i~~~lrEIr~ALLeADV~~~vvk-~~i~~vke~~~g~~v-------~~~l~p~q~i~kiv~~eL~~lLg~~~~~   92 (453)
T PRK10867         21 RLTEDNVKETLREVRMALLEADVALPVVR-EFINRVKEKAVGHEV-------NKSLTPGQEFVKIVRNELVAAMGEENQT   92 (453)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCHHHHH-HHHHHHHHHHCCCCC-------CCCCCHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             77899999999999999997568879999-999999999633513-------5789889999999999999985888766


Q ss_pred             EECCCCCCCCCCCCCCCCCCCEECCCCCCCCCHHHHHHHHHHHHC-CCCCEEEEEECCCCCCCC
Q ss_conf             503222343332223465420102446665425789999898723-577506988224678765
Q gi|254780831|r   77 VTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK-NKGKNVAILDADVYGPSI  139 (341)
Q Consensus        77 V~lt~~~~~~~~~~~~~~~~iiav~SgKGGVGKSt~s~nLa~ala-~~G~~V~liDaDi~~ps~  139 (341)
T Consensus        93 l~~~--~~---------~p~VIm~v-GLqGsGKTTT~aKLA~~lk~k~~k~vllvaaDt~RpaA  144 (453)
T PRK10867         93 LNLA--AQ---------PPAVVLMA-GLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAA  144 (453)
T ss_pred             CCCC--CC---------CCEEEEEE-CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHH
T ss_conf             6337--89---------99699997-46888518589999999997389837985588770589