HHsearch alignment for GI: 254780831 and conserved domain: PRK12724

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional.
Probab=96.69  E-value=0.0017  Score=43.20  Aligned_cols=167  Identities=20%  Similarity=0.241  Sum_probs=86.1

Q ss_pred             CCCCCEECCCCCCCCCHHHHHHHHHHHHC-CCCCEEEEEECCCCCCCCCCEECCCCCCCCCCCCCC--CCCCCCCEEECC
Q ss_conf             65420102446665425789999898723-577506988224678765310002456311233445--766322303223
Q gi|254780831|r   93 NVKKFVAVASGKGGVGKSTTVVNIACALK-NKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFL--KPKENYGIKIMS  169 (341)
Q Consensus        93 ~~~~iiav~SgKGGVGKSt~s~nLa~ala-~~G~~V~liDaDi~~ps~~~~lg~~~~~~~~~~~~i--~p~~~~gi~~~s  169 (341)
T Consensus       221 ~~~kvi~lV-GPTGVGKTTTiAKLAA~~~l~~~kkVaLIT~DTYRIgA-----vE-QLktY--a~Il~iPv-----~vv~  286 (432)
T PRK12724        221 NQRKVVFFV-GPTGSGKTTSIAKLAAKYFLHMGKSVSLYTTDNYRIAA-----IE-QLKRY--ADTMGMPF-----YPVK  286 (432)
T ss_pred             CCCEEEEEE-CCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHH-----HH-HHHHH--HHHHCCCE-----EEEE
T ss_conf             776299998-99998889999999999999749927999526653779-----99-99999--99859945-----9951


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCC--C-CCCH----HHHCCC---CCCEEEEECCCCC
Q ss_conf             3343552210001342024789998675213777589974556444--2-1000----000022---3402674214431
Q gi|254780831|r  170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTG--D-AHLT----IAQKIP---LSGVVIVSTPQDL  239 (341)
Q Consensus       170 ~g~l~~~~~~~~~rg~~~~~~l~~~l~~~~w~~~D~liiD~ppG~g--d-~~ls----l~~~~~---~~~~iiVttP~~~  239 (341)
T Consensus       287 -----~~------------~el~~al~~---~~~DlILIDTA-GrS~rd~~~~~eL~~ll~~~~~~~~ie~~LVLSa-Tt  344 (432)
T PRK12724        287 -----DI------------KKFKETLAR---DGSELILIDTA-GYSHRNLEQLERMQSFYSCFGEKDSVENLLVLSS-TS  344 (432)
T ss_pred             -----CH------------HHHHHHHHH---CCCCEEEEECC-CCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEEC-CC
T ss_conf             -----89------------999999985---69999999299-9897899999999999986366788517999978-89


Q ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCEEECCCCCHHHHHHHHHCCCEE----EE-CCCCHHHH
Q ss_conf             1345666777640012211445544202458778866512477658999998479789----88-27998999
Q gi|254780831|r  240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL----ES-VPFDMDVR  307 (341)
Q Consensus       240 s~~da~r~~~~~~~~~~~i~GiV~NMs~~~~~~~~~~~~~fg~~~~~~~a~~~~i~~l----g~-IP~d~~i~  307 (341)
T Consensus       345 k~~dl~~ii~~f~~l~~--~~lIfT-------KLDET~---s~G~ilni~~~~~~PisYiT~GQ~VPdDI~~A  405 (432)
T PRK12724        345 SYHHTLTVLKAYESLNY--RRIL