HHsearch alignment for GI: 254780831 and conserved domain: PRK13231

>PRK13231 nitrogenase reductase-like protein; Reviewed.
Probab=100.00  E-value=4.5e-35  Score=253.74  Aligned_cols=229  Identities=19%  Similarity=0.190  Sum_probs=173.2

Q ss_pred             CCCEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCEECCCCCCCCCC---------CCCCCCCCCCCE
Q ss_conf             42010244666542578999989872357750698822467876531000245631123---------344576632230
Q gi|254780831|r   95 KKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISD---------KKFLKPKENYGI  165 (341)
Q Consensus        95 ~~iiav~SgKGGVGKSt~s~nLa~ala~~G~~V~liDaDi~~ps~~~~lg~~~~~~~~~---------~~~i~p~~~~gi  165 (341)
T Consensus         2 m~~iAiy-GKGGIGKSTt~~NlaaalA~-g~rVl~igcDpk~dst~~L~G~~-~ptvl~~l~~~~~~~~~dvv~~g~~gi   78 (264)
T PRK13231          2 LKKIAIY-GKGGIGKSTTVSNMAAAYSS-DNSTLVIGCDPKADTTRTLVGKR-IPTVLDTLKDNRQPELEDIIYEGYNNT   78 (264)
T ss_pred             CEEEEEE-CCCCCCHHHHHHHHHHHHHC-CCCEEEECCCCCCCHHHHHHCCC-CCCHHHHHHHCCCCCHHHHEEECCCCE
T ss_conf             4289997-89854788899999999987-99779985688850246761999-883889863127777656312178984


Q ss_pred             EECCCCCCCCCCCCCCCCCCCHH-HHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHH-HCCCCCCEEEEECCCCCHHHH
Q ss_conf             32233343552210001342024-7899986752137775899745564442100000-002234026742144311345
Q gi|254780831|r  166 KIMSMASLVDENVAMIWRGPMVQ-SAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIA-QKIPLSGVVIVSTPQDLALID  243 (341)
Q Consensus       166 ~~~s~g~l~~~~~~~~~rg~~~~-~~l~~~l~~~~w~~~D~liiD~ppG~gd~~lsl~-~~~~~~~~iiVttP~~~s~~d  243 (341)
T Consensus        79 ~cvesGg-pepg~gcagrgi~~~~~lLe~~--~~~~~~~D~vl~Dvlgdvvcggfa~Pir~~~Adev~IVts~e~msLya  155 (264)
T PRK13231         79 LCVESGG-PEPGVGCAGRGVIVAMNLLEKL--GVFDNDPDVVIYDVLGDVVCGGFSVPLREDYADEVYIVTSGEYMSLYA  155 (264)
T ss_pred             EEEECCC-CCCCCCCCCCHHHHHHHHHHHH--CCCCCCCCEEEEECCCCCCCCCEECCCCCCCCCEEEEEECCCHHHHHH
T ss_conf             9973799-8877665652176898999872--642247987999435872056670455426698899994785899999


Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCEEECCCCCHHHHHHHHHCCCEEEECCCCHHHHHHHCCCCCEEEECCCC
Q ss_conf             66677764001221144554420245877886651247765899999847978988279989997502882179977999
Q gi|254780831|r  244 VKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS  323 (341)
Q Consensus       244 a~r~~~~~~~~~~~i~GiV~NMs~~~~~~~~~~~~~fg~~~~~~~a~~~~i~~lg~IP~d~~i~~a~~~g~P~v~~~p~s  323 (341)
T Consensus       156 AnnI~~~i~~~~~rl~GiI~N~-----r~~~~e-----~~iv~~fa~~~g~~vl~~IPr~~~V~~ae~~~~tVie~~P~S  225 (264)
T PRK13231        156 ANNIAKGIKKLKGKLGGIICNC-----RNVKNE-----VEIVSEFASLIGSRIIGIIPRSNLVQESELKASTVVETFPES  225 (264)
T ss_pred             HHHHHHHHHHHCCCCCEEEEEC-----CCCCCH-----HHHHHHHHHHCCCCEEEECCCCHHHHHHHHCCCEEEEECCCC
T ss_conf             9999999999546442089606-----898877-----999999999719968996689478888886297589979898


Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             8999999999999998
Q gi|254780831|r  324 ATSEIYQEISDRIQQF  339 (341)
Q Consensus       324 ~~a~~~~~iA~~i~~~  339 (341)
T Consensus       226 ~~A~~Yr~LA~~I~~~  241 (264)
T PRK13231        226 SQASIYSELANNIMNN  241 (264)
T ss_pred             HHHHHHHHHHHHHHHC
T ss_conf             8999999999999858