HHsearch alignment for GI: 254780831 and conserved domain: PRK13705

>PRK13705 plasmid-partitioning protein SopA; Provisional.
Probab=99.87  E-value=1.3e-21  Score=164.00  Aligned_cols=213  Identities=19%  Similarity=0.217  Sum_probs=130.0

Q ss_pred             CCEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEE-CCCCCCCCCCEECCCCCCCCCCCC---------------CCCC
Q ss_conf             201024466654257899998987235775069882-246787653100024563112334---------------4576
Q gi|254780831|r   96 KFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILD-ADVYGPSIPKLLKISGKVEISDKK---------------FLKP  159 (341)
Q Consensus        96 ~iiav~SgKGGVGKSt~s~nLa~ala~~G~~V~liD-aDi~~ps~~~~lg~~~~~~~~~~~---------------~i~p  159 (341)
T Consensus       107 ~VIAVaNqKGGvGKTTTavnLA~~LAl~G~RVLlID~LDPQa-nlT~~~G~~pd~~~~~~~tl~~~~~~~~~~~~~~I~~  185 (388)
T PRK13705        107 PVIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQG-TASMYHGWVPDLHIHAEDTLLPFYLGEKDDAAYAIKP  185 (388)
T ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCC-CCCCCCCCCCCCCCCCCCHHHHHHHCCCCCHHHEEEC
T ss_conf             289995278885599999999999997799089995878886-5643568888766564430247761466655450434


Q ss_pred             CCCCCEEECCCCC-CCCCCCCCCC---CC--CCH-HHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHHCCCCCCEEE
Q ss_conf             6322303223334-3552210001---34--202-478999867521377758997455644421000000022340267
Q gi|254780831|r  160 KENYGIKIMSMAS-LVDENVAMIW---RG--PMV-QSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVI  232 (341)
Q Consensus       160 ~~~~gi~~~s~g~-l~~~~~~~~~---rg--~~~-~~~l~~~l~~~~w~~~D~liiD~ppG~gd~~lsl~~~~~~~~~ii  232 (341)
T Consensus       186 T~~~gLDlIPs~l~L~~~E~el~~~~~~~~~~~~~~~~Lr~aL~~v-~d~YD~IlIDcPPsLG--~LTiNAL~AAd~vlI  262 (388)
T PRK13705        186 TCWPGLDIIPSCLALHRIETELMGKFDEGKLPTDPHLMLRLAIETV-AHDYDVIVIDSAPNLG--IGTINVVCAADVLIV  262 (388)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH-HHCCCEEEEECCCCHH--HHHHHHHHHHCEEEE
T ss_conf             7889979970898999999999775531232225899999999862-5039999995897177--999999998085486


Q ss_pred             EECCCCCHHHHHHHHHHHHHCCCC--CHHHHHHHHCCCCCCCCCCEEECCCCCHHHH-H----HHHHCCCEE-EECCCCH
Q ss_conf             421443113456667776400122--1144554420245877886651247765899-9----998479789-8827998
Q gi|254780831|r  233 VSTPQDLALIDVKRAISMYQKMNI--PIIGMIENMSYFLASDTGKKYDLFGNGGARF-E----AEKIGIPFL-ESVPFDM  304 (341)
Q Consensus       233 VttP~~~s~~da~r~~~~~~~~~~--~i~GiV~NMs~~~~~~~~~~~~~fg~~~~~~-~----a~~~~i~~l-g~IP~d~  304 (341)
T Consensus       263 Pv~p~~lD~~S~~qFl~m~~~l~~~~~~~g~~~~~r~L~Tr-----~e~-~d~~q~~~m~~~lr~~fg~~vl~~~i~~S~  336 (388)
T PRK13705        263 PTPAELFDYTSALQFFDMLRDLLKNVDLKGFEPDVRILLTK-----YSN-ANGSQSPWMEEQIRDAWGSMVLKNVVRETD  336 (388)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEC-----CCC-CCCCHHHHHHHHHHHHHHHHHHHCCCHHHH
T ss_conf             78940776999999999999999998751777634899872-----589-998789999999999976777636225789


Q ss_pred             HHHHHHCCCCCEEE
Q ss_conf             99975028821799
Q gi|254780831|r  305 DVRVLSDLGIPIVV  318 (341)
Q Consensus       305 ~i~~a~~~g~P~v~  318 (341)
T Consensus       337 aI~~A~~~~~TlyE  350 (388)
T PRK13705        337 EVGKGQIRMRTVFE  350 (388)
T ss_pred             HHHHHHHHCCCCEE
T ss_conf             99872652073010