HHsearch alignment for GI: 254780831 and conserved domain: TIGR01618

>TIGR01618 phage_P_loop phage nucleotide-binding protein; InterPro: IPR006505 These sequences represent an uncharacterised family of proteins from a number of phage of Gram-positive bacteria. This protein contains a P-loop motif, G/A-X-X-G-X-G-K-T near its amino end. The function of these proteins is unknown..
Probab=93.00  E-value=0.049  Score=33.56  Aligned_cols=47  Identities=26%  Similarity=0.266  Sum_probs=31.4

Q ss_pred             CCCCCCC-CCEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCEECCC
Q ss_conf             2234654-201024466654257899998987235775069882246787653100024
Q gi|254780831|r   89 RNNLNVK-KFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKIS  146 (341)
Q Consensus        89 ~~~~~~~-~iiav~SgKGGVGKSt~s~nLa~ala~~G~~V~liDaDi~~ps~~~~lg~~  146 (341)
T Consensus         6 ~~i~~~~~~~~lIY-G~~G~GKTS~~K~l------~Gk-tL~l~~D~---SSkVL~G~~   53 (229)
T TIGR01618         6 EEIKRSEYFRYLIY-GKPGLGKTSTIKYL------PGK-TLVLSLDK---SSKVLAGDE   53 (229)
T ss_pred             CCCCCCCCCEEEEE-CCCCCCCCCEEEEC------CCC-EEEEECCC---CCCCCCCCC
T ss_conf             46656766368887-58988723056645------887-89883678---644346899