HHsearch alignment for GI: 254780831 and conserved domain: cd01122

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.
Probab=93.25  E-value=0.075  Score=32.31  Aligned_cols=38  Identities=24%  Similarity=0.377  Sum_probs=32.0

Q ss_pred             CCEECCCCCCCCCHHHHHHHHHHHHCC-CCCEEEEEECCC
Q ss_conf             201024466654257899998987235-775069882246
Q gi|254780831|r   96 KFVAVASGKGGVGKSTTVVNIACALKN-KGKNVAILDADV  134 (341)
Q Consensus        96 ~iiav~SgKGGVGKSt~s~nLa~ala~-~G~~V~liDaDi  134 (341)
T Consensus        31 eL~via-arpg~GKT~f~~~~a~~~~~~~g~~vl~~SlEm   69 (271)
T cd01122          31 ELIILT-AGTGVGKTTFLREYALDLITQHGVRVGTISLEE   69 (271)
T ss_pred             CEEEEE-ECCCCCHHHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             089999-689986999999999999997699089997049