HHsearch alignment for GI: 254780831 and conserved domain: cd02032

>cd02032 Bchl_like This family of proteins contains bchL and chlL. Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls. Three genes, bchL, bchN and bchB, are involved in light-independent protochlorophyllide reduction in bacteriochlorophyll biosynthesis. In cyanobacteria, algae, and gymnosperms, three similar genes, chlL, chlN and chlB are involved in protochlorophyllide reduction during chlorophylls biosynthesis. BchL/chlL, bchN/chlN and bchB/chlB exhibit significant sequence similarity to the nifH, nifD and nifK subunits of nitrogenase, respectively. Nitrogenase catalyzes the reductive formation of ammonia from dinitrogen.
Probab=99.97  E-value=7.9e-30  Score=218.79  Aligned_cols=218  Identities=21%  Similarity=0.298  Sum_probs=150.9

Q ss_pred             CEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCEECCCCCC--CCCC---C-----CCCCC-----CC
Q ss_conf             01024466654257899998987235775069882246787653100024563--1123---3-----44576-----63
Q gi|254780831|r   97 FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV--EISD---K-----KFLKP-----KE  161 (341)
Q Consensus        97 iiav~SgKGGVGKSt~s~nLa~ala~~G~~V~liDaDi~~ps~~~~lg~~~~~--~~~~---~-----~~i~p-----~~  161 (341)
T Consensus         2 kiaiy-GKGGIGKSTttaNl~aaLA~~G~kVl~IgcD---pk~Dst~~L~g~~~~tvld~l~~~~~~~~~~~~~d~v~~g   77 (267)
T cd02032           2 VLAVY-GKGGIGKSTTSSNLSVALAKRGKKVLQIGCD---PKHDSTFTLTGFLIPTVIDILEEVDFHYEELWPEDVIYEG   77 (267)
T ss_pred             EEEEE-CCCCCCHHHHHHHHHHHHHHCCCEEEEECCC---CCHHHHHHHCCCCCCCHHHHHHHHCCCHHHCCHHHHHHCC
T ss_conf             79997-7996578778999999999879959997789---9515567526988683999998608866641477875307


Q ss_pred             CCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHH-HCCCCCCEEEEECCCCCCC--CCCHHHHCCCCCCEEEEECCCC
Q ss_conf             223032233343552210001342024789998675-2137775899745564442--1000000022340267421443
Q gi|254780831|r  162 NYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHN-VVWGQLDFLLIDMPPGTGD--AHLTIAQKIPLSGVVIVSTPQD  238 (341)
Q Consensus       162 ~~gi~~~s~g~l~~~~~~~~~rg~~~~~~l~~~l~~-~~w~~~D~liiD~ppG~gd--~~lsl~~~~~~~~~iiVttP~~  238 (341)
T Consensus        78 ~~gv~cvEaGg-P~pg~Gcagrgi--~~~-~~lL~~l~~~~~~D~Vl~DvlgdVvcgGFa~pi---~~Ad~~~iVTs~e~  150 (267)
T cd02032          78 YGGVDCVEAGG-PPAGAGCGGYVV--GET-VKLLKELNLFEEYDVILFDVLGDVVCGGFAAPL---NYADYALIVTDNDF  150 (267)
T ss_pred             CCCCEEEECCC-CCCCCCCCCCCH--HHH-HHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCC---CCCCEEEEEECCCH
T ss_conf             67845766589-999988776404--899-999987166434778999536654456656761---00688999956718


Q ss_pred             CHHHHHHHHHHHHHC----CCCCHHHHHHHHCCCCCCCCCCEEECCCCCHHHHHHHHHCCCEEEECCCCHHHHHHHCCCC
Q ss_conf             113456667776400----1221144554420245877886651247765899999847978988279989997502882
Q gi|254780831|r  239 LALIDVKRAISMYQK----MNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGI  314 (341)
Q Consensus       239 ~s~~da~r~~~~~~~----~~~~i~GiV~NMs~~~~~~~~~~~~~fg~~~~~~~a~~~~i~~lg~IP~d~~i~~a~~~g~  314 (341)
T Consensus       151 ~sl~aAn~I~~~i~~~~~~~~~rl~GlI~Nr~-------~~------~~~i~~fa~~lg~~lig~VP~d~~V~~se~~g~  217 (267)
T cd02032         151 DSIFAANRIAAAVREKAKTYKVRLAGLIANRT-------DK------TDLIDKFVEAVGMPVLAVLPLIEDIRRSRVKGK  217 (267)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCEEEEECC-------CC------HHHHHHHHHHHCCCEEEECCCCHHHHHHHHCCC
T ss_conf             78999999999999975337976422787469-------85------789999999729946996699338899987398


Q ss_pred             CEEEECCCCH----HHHHHHHHHHHHHH
Q ss_conf             1799779998----99999999999999
Q gi|254780831|r  315 PIVVHNMNSA----TSEIYQEISDRIQQ  338 (341)
Q Consensus       315 P~v~~~p~s~----~a~~~~~iA~~i~~  338 (341)
T Consensus       218 tvie~~p~~~~~s~~a~~Yr~LA~~i~~  245 (267)
T cd02032         218 TLFEMDESDEELAYRCDYYLLIADQLLA  245 (267)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             6898489984378999999999999983