HHsearch alignment for GI: 254780831 and conserved domain: cd03109

>cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms. The enzyme catalyzes formation of the ureido ring of dethiobiotin from (7R,8S)-7,8-diaminononanoic acid (DAPA) and carbon dioxide. The enzyme utilizes carbon dioxide instead of hydrogen carbonate as substrate and is dependent on ATP and divalent metal ions as cofactors.
Probab=98.35  E-value=2.2e-06  Score=62.54  Aligned_cols=125  Identities=23%  Similarity=0.275  Sum_probs=79.2

Q ss_pred             CCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCEEECC--CCCCCCCCCCCCC
Q ss_conf             65425789999898723577506988224678765310002456311233445766322303223--3343552210001
Q gi|254780831|r  105 GGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMS--MASLVDENVAMIW  182 (341)
Q Consensus       105 GGVGKSt~s~nLa~ala~~G~~V~liDaDi~~ps~~~~lg~~~~~~~~~~~~i~p~~~~gi~~~s--~g~l~~~~~~~~~  182 (341)
T Consensus         8 T~VGKT~vt~~l~~~l~~~G~~v~~~KP---------------------------v~t~D~vlVEGaGG~~vPl~~----   56 (134)
T cd03109           8 TDIGKTVATAILARALKEKGYRVAPLKP---------------------------VQTYDFVLVEGAGGLCVPLKE----   56 (134)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCEEEECH---------------------------HHCCCEEEEECCCCEEECCCC----
T ss_conf             8876899999999999977991778756---------------------------672798999889774600389----


Q ss_pred             CCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             34202478999867521377758997455644421000000022340267421443113456667776400122114455
Q gi|254780831|r  183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMI  262 (341)
Q Consensus       183 rg~~~~~~l~~~l~~~~w~~~D~liiD~ppG~gd~~lsl~~~~~~~~~iiVttP~~~s~~da~r~~~~~~~~~~~i~GiV  262 (341)
T Consensus        57 ---------------------~~~~~Dl-----------~~~l~-~pvIlV~~~~LG~INhtlLt~eal~~~gi~v~G~i  103 (134)
T cd03109          57 ---------------------DFTNADV-----------AKELN-LPAILVTSAGLGSINHAFLTIEAARIKGIILNGVL  103 (134)
T ss_pred             ---------------------CCCHHHH-----------HHHHC-CCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             ---------------------8629999-----------99709-99899977887858999999999998799288999


Q ss_pred             HHHCCCCCCCCCCEEECCCCCHHHHHHHHHCCCEEEECC
Q ss_conf             442024587788665124776589999984797898827
Q gi|254780831|r  263 ENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVP  301 (341)
Q Consensus       263 ~NMs~~~~~~~~~~~~~fg~~~~~~~a~~~~i~~lg~IP  301 (341)
T Consensus       104 ~N~-~--~~~-~---~~-~~~N~~~I~~~t~vPvLG~vP  134 (134)
T cd03109         104 GNV-I--VEK-E---GL-ATLNVETIERLTGIPVLGIVP  134 (134)
T ss_pred             EEC-C--CCC-C---HH-HHHHHHHHHHHHCCCEEEECC
T ss_conf             946-7--997-1---06-787599999974999778288