>cd04168 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W), and OtrA are tetracycline resistance genes found in Gram-positive and Gram-negative bacteria. Tetracyclines inhibit protein synthesis by preventing aminoacyl-tRNA from binding to the ribosomal acceptor site. This subfamily contains tetracycline resistance proteins that function through ribosomal protection and are typically found on mobile genetic elements, such as transposons or plasmids, and are often conjugative. Ribosomal protection proteins are homologous to the elongation factors EF-Tu and EF-G. EF-G and Tet(M) compete for binding on the ribosomes. Tet(M) has a higher affinity than EF-G, suggesting these two proteins may have overlapping binding sites and that Tet(M) must be released before EF-G can bind. Tet(M) and Tet(O) have been shown to have ribosome-dependent GTPase activity. These proteins are part of the GTP translation factor family, which includes EF-G, EF-Tu, EF2, LepA, and SelB.

Probab=96.24 E-value=0.011 Score=37.80 Aligned_cols=90 Identities=21% Similarity=0.315 Sum_probs=52.3 Q ss_pred HHCCCCCCEEEEECCCCCCCCCCHHHHC-CCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCC Q ss_conf 5213777589974556444210000000-223402674214431134566677764001221144554420245877886 Q gi|254780831|r 197 NVVWGQLDFLLIDMPPGTGDAHLTIAQK-IPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGK 275 (341) Q Consensus 197 ~~~w~~~D~liiD~ppG~gd~~lsl~~~-~~~~~~iiVttP~~~s~~da~r~~~~~~~~~~~i~GiV~NMs~~~~~~~~~ 275 (341) T Consensus 58 ~~~~~~~~~n~iDtP-G~~dF~~e~~~al~~~D~av~Vv~a~~Gv~~~t~~~~~~~~~~~~P~i-ifiNK----mDre~a 131 (237) T cd04168 58 SFQWEDTKVNLIDTP-GHMDFIAEVERSLSVLDGAILVISAVEGVQAQTRILWRLLRKLNIPTI-IFVNK----IDRAGA 131 (237) T ss_pred EEEECCEEEEEEECC-CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCEE-EEEEC----CCCCCC T ss_conf 999899879998898-846566689889763481699996588822344999999998599859-98624----457899 Q ss_pred EEECCCCCHHHHHHHHHCCCE Q ss_conf 651247765899999847978 Q gi|254780831|r 276 KYDLFGNGGARFEAEKIGIPF 296 (341) Q Consensus 276 ~~~~fg~~~~~~~a~~~~i~~ 296 (341) T Consensus 132 d---f-~~~l~~i~~~l~~~~ 148 (237) T cd04168 132 D---L-EKVYQEIKEKLSSDI 148 (237) T ss_pred C---H-HHHHHHHHHHHCCCE T ss_conf 9---9-999999999978974

HHsearch alignment for GI: 254780831 and conserved domain: cd04168