HHsearch alignment for GI: 254780831 and conserved domain: pfam03308

>pfam03308 ArgK ArgK protein. The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems.
Probab=97.91  E-value=0.00018  Score=49.86  Aligned_cols=132  Identities=24%  Similarity=0.319  Sum_probs=74.2

Q ss_pred             CCCEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCC-CCCCEECCCCCCCCCCCCCCCC-CCCCCEEECCCCC
Q ss_conf             4201024466654257899998987235775069882246787-6531000245631123344576-6322303223334
Q gi|254780831|r   95 KKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGP-SIPKLLKISGKVEISDKKFLKP-KENYGIKIMSMAS  172 (341)
Q Consensus        95 ~~iiav~SgKGGVGKSt~s~nLa~ala~~G~~V~liDaDi~~p-s~~~~lg~~~~~~~~~~~~i~p-~~~~gi~~~s~g~  172 (341)
T Consensus        29 a~~iGiT-G~PGaGKStli~~l~~~~~~~g~~vaVlAvDPSS~~sgGaiLGDr~--------RM~~~~~~~~vfiRs~~s   99 (267)
T pfam03308        29 AHRVGIT-GVPGAGKSTLIEALGMELRRRGHRVAVLAVDPSSPFTGGSILGDRT--------RMQRLAVDPGAFIRSSPS   99 (267)
T ss_pred             CEEEEEE-CCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCHH--------HHHHHCCCCCEEEEECCC
T ss_conf             5599876-8998879999999999999689868999978999888863001077--------776505899858864577


Q ss_pred             CCCCCCCCCCCCCC--HHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHHCCCCCCEEEEECCCCCHHHHHHHHH
Q ss_conf             35522100013420--24789998675213777589974556444210000000223402674214431134566677
Q gi|254780831|r  173 LVDENVAMIWRGPM--VQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAI  248 (341)
Q Consensus       173 l~~~~~~~~~rg~~--~~~~l~~~l~~~~w~~~D~liiD~ppG~gd~~lsl~~~~~~~~~iiVttP~~~s~~da~r~~  248 (341)
T Consensus       100 ----------rg~lGGls~~t~~~i~lleaaGfD~IivETV-GVGQsE~~v~~~a--D~~llv~~Pg~GDeiQ~iKaG  164 (267)
T pfam03308       100 ----------RGALGGLSRATREAILLLDAAGFDVIIIETV-GVGQSEVDIANMA--DTFVLVTIPGGGDDLQGIKAG  164 (267)
T ss_pred             ----------CCCCCCCCHHHHHHHHHHHHCCCCEEEEECC-CCCCCCHHHHHHC--CEEEEEECCCCCHHHHHHHHH
T ss_conf             ----------8888871476999999999779999999247-7775303555415--768999558876088898753