HHsearch alignment for GI: 254780831 and conserved domain: pfam07755

>pfam07755 DUF1611 Protein of unknown function (DUF1611). This region is found in a number of hypothetical bacterial and archaeal proteins. The region is approximately 350 residues long. A member of this family is thought to associate with another subunit to form an H+-transporting ATPase, but no evidence has been found to support this.
Probab=96.59  E-value=0.052  Score=33.35  Aligned_cols=164  Identities=20%  Similarity=0.321  Sum_probs=96.1

Q ss_pred             CCEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCC
Q ss_conf             20102446665425789999898723577506988224678765310002456311233445766322303223334355
Q gi|254780831|r   96 KFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVD  175 (341)
Q Consensus        96 ~iiav~SgKGGVGKSt~s~nLa~ala~~G~~V~liDaDi~~ps~~~~lg~~~~~~~~~~~~i~p~~~~gi~~~s~g~l~~  175 (341)
T Consensus       114 ~rvl~vGTDcavGK~tTal~l~~~l~~~Gi~a~fiaTGQTG----ili-----------------~g~Gv~iDa----v~  168 (302)
T pfam07755       114 KRVLTVGTDCAVGKMTTALELERALRERGLNAAFVATGQTG----ILI-----------------AGYGVPLDA----VP  168 (302)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCE----EEE-----------------ECCEEEECC----CH
T ss_conf             78999605733407899999999999779984799727613----688-----------------152478432----24


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEE-----CCCCCCCCCCHHHHCCCCCCEEEEECCCCC-----------
Q ss_conf             2210001342024789998675213777589974-----556444210000000223402674214431-----------
Q gi|254780831|r  176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID-----MPPGTGDAHLTIAQKIPLSGVVIVSTPQDL-----------  239 (341)
Q Consensus       176 ~~~~~~~rg~~~~~~l~~~l~~~~w~~~D~liiD-----~ppG~gd~~lsl~~~~~~~~~iiVttP~~~-----------  239 (341)
T Consensus       169 ~D--------FvaGavE~~v~~~~-~~~d~iiIEGQgSL~hP~y~gvsl~lL~Gs~Pd~lIL~H~p~R~~~~~~~~~~iP  239 (302)
T pfam07755       169 AD--------FVAGAVEALVLDAA-EEDDWIVIEGQGSLSHPAYSGVTLGLLHGSQPDALVLCHRPGRKHRRGFPHYPLP  239 (302)
T ss_pred             HH--------HHHHHHHHHHHHHC-CCCCEEEEECCCCCCCCCCCCCCHHHHCCCCCCEEEEECCCCCCEECCCCCCCCC
T ss_conf             76--------67678999998645-4678799916543236656654598860789986999637898622787668899


Q ss_pred             HHHHHHHHHHHHHCC--CCCHHHHHHHHCCCCCCCCCCEEECCCCCHHHHHHHHHCCCEEEECC
Q ss_conf             134566677764001--22114455442024587788665124776589999984797898827
Q gi|254780831|r  240 ALIDVKRAISMYQKM--NIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVP  301 (341)
Q Consensus       240 s~~da~r~~~~~~~~--~~~i~GiV~NMs~~~~~~~~~~~~~fg~~~~~~~a~~~~i~~lg~IP  301 (341)
T Consensus       240 ~l~~~i~l~e~~a~~~~~~kvvgIslNt~~l-----~~~e---a~~~~~~~~~~~glPv~Dp~r  295 (302)
T pfam07755       240 PLEEEIELIEALAGTTPPAKVVGISLNTRGL-----SEAE---AREAIERIEEELGLPVTDPVR  295 (302)
T ss_pred             CHHHHHHHHHHHHCCCCCCEEEEEEECCCCC-----CHHH---HHHHHHHHHHHHCCCEEECCC
T ss_conf             9899999999973647997399999557879-----9999---999999999998997471212