BLAST/PSIBLAST alignment of GI: 254780831 and GI: 225626603 at iteration 1
>gi|225626603|ref|ZP_03784642.1| protein of unknown function DUF59 [Brucella ceti str. Cudo] Length = 394
>gi|225618260|gb|EEH15303.1| protein of unknown function DUF59 [Brucella ceti str. Cudo] Length = 394
 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/369 (46%), Positives = 250/369 (67%), Gaps = 31/369 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + + Q+++ LK ++ P  K+++V +  +S+IFI    V+ SITVP   A  L+ +R 
Sbjct: 8   MAGVTREQVLERLKTVTGPDFKSDVVSLGLVSDIFIADGKVFFSITVPAERAEALEPMRL 67

Query: 61  NAQQIIQNIPTVKNAVVTLT--------------------------ENKNPPQQRNNL-- 92
            A++++++IP +  A+VTLT                          ++++PPQ R     
Sbjct: 68  AAEKVVKDIPGITGALVTLTAEKKGGRTSDDAPPPPRPQARPAAASQHRHPPQPRPAAKP 127

Query: 93  ---NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV 149
               V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P+LL +SG+ 
Sbjct: 128 GVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADIYGPSMPRLLGLSGRP 187

Query: 150 EISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID 209
           E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++D
Sbjct: 188 ETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVD 247

Query: 210 MPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFL 269
           MPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+
Sbjct: 248 MPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFI 307

Query: 270 ASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
           A DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V   +S  ++IY
Sbjct: 308 APDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVKEPDSEHAKIY 367

Query: 330 QEISDRIQQ 338
           ++I+ ++ +
Sbjct: 368 RDIARKVWE 376