BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780831|ref|YP_003065244.1| hypothetical protein
CLIBASIA_03620 [Candidatus Liberibacter asiaticus str. psy62]
         (341 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780831|ref|YP_003065244.1| hypothetical protein CLIBASIA_03620 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040508|gb|ACT57304.1| hypothetical protein CLIBASIA_03620 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 341

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/341 (100%), Positives = 341/341 (100%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS
Sbjct: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACAL 120
           NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACAL
Sbjct: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACAL 120

Query: 121 KNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAM 180
           KNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAM
Sbjct: 121 KNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAM 180

Query: 181 IWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLA 240
           IWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLA
Sbjct: 181 IWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLA 240

Query: 241 LIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESV 300
           LIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESV
Sbjct: 241 LIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESV 300

Query: 301 PFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV 341
           PFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV
Sbjct: 301 PFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV 341


>gi|315122330|ref|YP_004062819.1| hypothetical protein CKC_02910 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495732|gb|ADR52331.1| hypothetical protein CKC_02910 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 348

 Score =  550 bits (1418), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 265/345 (76%), Positives = 301/345 (87%), Gaps = 4/345 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           MNQ ++ QI+D+LK+L IPGE  NIV+M+RLS I IV NT YLSITVPH +A QLQSLR 
Sbjct: 1   MNQNIEQQILDALKILYIPGETINIVDMKRLSNICIVQNTAYLSITVPHNLAQQLQSLRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQ----RNNLNVKKFVAVASGKGGVGKSTTVVNI 116
           NAQQI+QNIP +KNAVVTLTENK+ P       N L +   +A+ASGKGGVGKSTT VN+
Sbjct: 61  NAQQIVQNIPQIKNAVVTLTENKSKPILDPIIENKLKINALIAIASGKGGVGKSTTAVNL 120

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           ACALKNK KNVAILDAD+YGPSIPKLL++SGK EI +KK LKP ENYGIKIMSMASLVD+
Sbjct: 121 ACALKNKNKNVAILDADIYGPSIPKLLQLSGKAEILEKKILKPMENYGIKIMSMASLVDD 180

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           NVAMIWRGPMVQSAIMHM  NV WGQLDFLLIDMPPGTGDAHLT+AQKIPLSGVVIVSTP
Sbjct: 181 NVAMIWRGPMVQSAIMHMFQNVSWGQLDFLLIDMPPGTGDAHLTVAQKIPLSGVVIVSTP 240

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QDLALIDVKRAI+MYQKM +PIIG+IENMSYF+ SDTGK+YDLFGNGG R EAEK+GIPF
Sbjct: 241 QDLALIDVKRAINMYQKMKVPIIGIIENMSYFVTSDTGKRYDLFGNGGVRAEAEKMGIPF 300

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV 341
           LES+PFDMDVR+LSDLGIPIV+ N NS  S++YQ+ISDRIQ++ +
Sbjct: 301 LESIPFDMDVRILSDLGIPIVIDNPNSVVSKMYQKISDRIQEYLL 345


>gi|150395667|ref|YP_001326134.1| hypothetical protein Smed_0442 [Sinorhizobium medicae WSM419]
 gi|150027182|gb|ABR59299.1| protein of unknown function DUF59 [Sinorhizobium medicae WSM419]
          Length = 384

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 171/363 (47%), Positives = 249/363 (68%), Gaps = 27/363 (7%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + +  +++ L+ +  P  + NIV++  +S++FI     Y SITVP   A +L+ +R+
Sbjct: 1   MPDVTREMVLNKLRNVRGPDMEGNIVDLGLVSDVFISDGKAYFSITVPAARAKELEPMRA 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENK------------------NPPQQRNN---------LN 93
            A+++++ IP VK A+V LT ++                  + P QR             
Sbjct: 61  AAERVVREIPGVKAAMVALTADRKAAPQKTPAERHPEAPTGHAPAQRAGGGAAPKADIPG 120

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISD 153
           V   +AVASGKGGVGKSTT VN+A AL+  G  V +LDAD+YGPS+P+LLKISG+ +  +
Sbjct: 121 VGAIIAVASGKGGVGKSTTSVNLALALQANGLKVGLLDADIYGPSMPRLLKISGRPQQIE 180

Query: 154 KKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPG 213
            + ++P ENYG+K+MSM  LVDE VAMIWRGPM+QSA++ ML  V WG LD L++DMPPG
Sbjct: 181 GRLIRPMENYGLKVMSMGFLVDEEVAMIWRGPMIQSALLQMLREVAWGDLDVLVVDMPPG 240

Query: 214 TGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDT 273
           TGDA LT+AQ++PL+G VIVSTPQDLAL+D ++ ++M++K+ +P++G++ENMSYF+A DT
Sbjct: 241 TGDAQLTMAQQVPLAGAVIVSTPQDLALVDARKGLAMFRKVEVPVLGIVENMSYFVAPDT 300

Query: 274 GKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           G++YD+FG+GGAR EAE+IG+PFL  VP  M +R  SD G P+V    +   + +Y+EI+
Sbjct: 301 GRRYDIFGHGGARKEAERIGVPFLGEVPLTMAIRETSDAGTPLVASEPDGEVARLYREIA 360

Query: 334 DRI 336
            R+
Sbjct: 361 ARV 363


>gi|15964583|ref|NP_384936.1| putative MRP protein homolog ATP-binding [Sinorhizobium meliloti
           1021]
 gi|307309329|ref|ZP_07588992.1| ATPase-like, ParA/MinD [Sinorhizobium meliloti BL225C]
 gi|307320065|ref|ZP_07599486.1| ATPase-like, ParA/MinD [Sinorhizobium meliloti AK83]
 gi|15073761|emb|CAC45402.1| Putative MRP protein homolog ATP-binding [Sinorhizobium meliloti
           1021]
 gi|306894280|gb|EFN25045.1| ATPase-like, ParA/MinD [Sinorhizobium meliloti AK83]
 gi|306900198|gb|EFN30816.1| ATPase-like, ParA/MinD [Sinorhizobium meliloti BL225C]
          Length = 384

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 169/363 (46%), Positives = 249/363 (68%), Gaps = 27/363 (7%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + +  +++ L+ +  P  + NIV++  +S++FI     Y SITVP   A +L+ +R+
Sbjct: 1   MPDVTREMVLEKLRTVRGPDMEGNIVDLGLVSDVFISDGKAYFSITVPADRAKELEPMRA 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENK------------------NPPQQRNNL---------N 93
            A+++++ IP V  A+V LT ++                  + P QR             
Sbjct: 61  AAERVVREIPGVNAAMVALTADRKAAPQKAPVERPRPAPTGHAPAQRAGGGGAPKAGIPG 120

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISD 153
           V   +AVASGKGGVGKSTT VN+A AL+  G  V +LDAD+YGPS+P+LLKISG+ +  +
Sbjct: 121 VGAIIAVASGKGGVGKSTTSVNLALALQANGLKVGLLDADIYGPSMPRLLKISGRPQQIE 180

Query: 154 KKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPG 213
            + ++P ENYG+K+MSM  LVDE VAMIWRGPM+QSA++ ML  V WG+LD L++DMPPG
Sbjct: 181 GRLIRPMENYGLKVMSMGFLVDEEVAMIWRGPMIQSALLQMLREVAWGELDVLVVDMPPG 240

Query: 214 TGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDT 273
           TGDA LT+AQ++PL+G VIVSTPQDLAL+D ++ ++M++K+ +P++G++ENMSYF+A DT
Sbjct: 241 TGDAQLTMAQQVPLAGAVIVSTPQDLALVDARKGLAMFRKVEVPVLGIVENMSYFVAPDT 300

Query: 274 GKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           G++YD+FG+GGAR EAE+IG+PFL  VP  M +R  SD G P+V    +   + +Y++I+
Sbjct: 301 GRRYDIFGHGGARKEAERIGVPFLGEVPLTMGIRETSDAGTPLVASEPDGEVARVYRDIA 360

Query: 334 DRI 336
            R+
Sbjct: 361 ARV 363


>gi|227821020|ref|YP_002824990.1| putative ATP-binding Mrp family protein [Sinorhizobium fredii
           NGR234]
 gi|227340019|gb|ACP24237.1| putative ATP-binding Mrp family protein [Sinorhizobium fredii
           NGR234]
          Length = 383

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 171/364 (46%), Positives = 250/364 (68%), Gaps = 26/364 (7%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + +  +++ L+ +  P  + NIV++  +S++FI     Y SITVP   A +L+ +R+
Sbjct: 1   MPDVTREMVLEKLRGVRGPDMEGNIVDLGLVSDVFISDGKAYFSITVPADRAKELEPMRA 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKN------------PPQQRNNL--------------NV 94
            A+++++ IP VK A+V LT ++             PP    +                V
Sbjct: 61  AAERVVREIPGVKAAMVALTADRKAAPQAAPVQRPAPPSGHAHAPRPAGGAPAKAGIPGV 120

Query: 95  KKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDK 154
              +AVASGKGGVGKSTT VN+A AL+  G  V +LDAD+YGPS+P+LLKISG+ +  + 
Sbjct: 121 GAIIAVASGKGGVGKSTTSVNLALALQANGLKVGLLDADIYGPSMPRLLKISGRPQQIEG 180

Query: 155 KFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGT 214
           + ++P ENYG+++MSM  LVDE VAMIWRGPM+QSA++ ML  V WG+LD L++DMPPGT
Sbjct: 181 RLIRPMENYGLRVMSMGFLVDEEVAMIWRGPMIQSALLQMLREVAWGELDVLVVDMPPGT 240

Query: 215 GDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTG 274
           GDA LT+AQ++PL+G VIVSTPQDLAL D ++ I+M++K+ +P++G++ENMSYF+A DTG
Sbjct: 241 GDAQLTMAQQVPLAGAVIVSTPQDLALADARKGITMFRKVEVPVLGIVENMSYFVAPDTG 300

Query: 275 KKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISD 334
            +YD+FG+GGAR EAE+IG+PFL  VP  M +R  SD G P+VV + +   + IY+ I++
Sbjct: 301 NRYDIFGHGGARKEAERIGVPFLGEVPLTMGIRETSDAGTPLVVSDPDGEVARIYRGIAE 360

Query: 335 RIQQ 338
           R+ +
Sbjct: 361 RVWE 364


>gi|153007409|ref|YP_001368624.1| hypothetical protein Oant_0064 [Ochrobactrum anthropi ATCC 49188]
 gi|151559297|gb|ABS12795.1| protein of unknown function DUF59 [Ochrobactrum anthropi ATCC
           49188]
          Length = 389

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/369 (47%), Positives = 248/369 (67%), Gaps = 33/369 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + + Q+ + LK ++ P  ++++V +  +S+IFI    V+ SITVP   A  L+ +R 
Sbjct: 1   MTSVTREQVQERLKTVTGPDFESDVVSLGLVSDIFIADGKVFFSITVPAARADALEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLT---------------------------ENKNPPQ-QRNNL 92
            A++ ++ IP V  A+VTLT                           ++++PPQ QR   
Sbjct: 61  AAEKAVKEIPGVTGALVTLTAEKKGGRTSDDAPPPPKPQARPAAAPVQHRHPPQPQRAAT 120

Query: 93  -----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG 147
                 V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P+LL +SG
Sbjct: 121 KPGIPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADIYGPSMPRLLGLSG 180

Query: 148 KVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLL 207
           + E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L+
Sbjct: 181 RPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLV 240

Query: 208 IDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSY 267
           +DMPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSY
Sbjct: 241 VDMPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSY 300

Query: 268 FLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSE 327
           F+A DTG +YD+FGNGGAR EAE++ +PFL  VP  MDVR  SD G PI VH  +S  ++
Sbjct: 301 FIAPDTGARYDIFGNGGARREAERLEVPFLGEVPLHMDVRAYSDAGTPITVHEPDSEHAK 360

Query: 328 IYQEISDRI 336
           IY+EI+ ++
Sbjct: 361 IYREIARKV 369


>gi|23500972|ref|NP_697099.1| mrp-like protein [Brucella suis 1330]
 gi|161618046|ref|YP_001591933.1| nucleotide-binding protein-like protein [Brucella canis ATCC 23365]
 gi|163842333|ref|YP_001626737.1| nucleotide-binding protein-like protein [Brucella suis ATCC 23445]
 gi|254716281|ref|ZP_05178092.1| nucleotide-binding protein-like protein [Brucella ceti M13/05/1]
 gi|256030737|ref|ZP_05444351.1| nucleotide-binding protein-like protein [Brucella pinnipedialis
           M292/94/1]
 gi|256368523|ref|YP_003106029.1| mrp-related protein [Brucella microti CCM 4915]
 gi|260169641|ref|ZP_05756452.1| mrp-related protein [Brucella sp. F5/99]
 gi|261218060|ref|ZP_05932341.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261759173|ref|ZP_06002882.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265987787|ref|ZP_06100344.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|23346830|gb|AAN29014.1| mrp-related protein [Brucella suis 1330]
 gi|161334857|gb|ABX61162.1| Nucleotide-binding protein-like protein [Brucella canis ATCC 23365]
 gi|163673056|gb|ABY37167.1| Nucleotide-binding protein-like protein [Brucella suis ATCC 23445]
 gi|255998681|gb|ACU47080.1| mrp-related protein [Brucella microti CCM 4915]
 gi|260923149|gb|EEX89717.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261739157|gb|EEY27153.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|264659984|gb|EEZ30245.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 387

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/369 (46%), Positives = 250/369 (67%), Gaps = 31/369 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + + Q+++ LK ++ P  K+++V +  +S+IFI    V+ SITVP   A  L+ +R 
Sbjct: 1   MAGVTREQVLERLKTVTGPDFKSDVVSLGLVSDIFIADGKVFFSITVPAERAEALEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLT--------------------------ENKNPPQQRNNL-- 92
            A++++++IP +  A+VTLT                          ++++PPQ R     
Sbjct: 61  AAEKVVKDIPGITGALVTLTAEKKGGRTSDDAPPPPRPQARPAAASQHRHPPQPRPAAKP 120

Query: 93  ---NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV 149
               V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P+LL +SG+ 
Sbjct: 121 GVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADIYGPSMPRLLGLSGRP 180

Query: 150 EISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID 209
           E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++D
Sbjct: 181 ETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVD 240

Query: 210 MPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFL 269
           MPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+
Sbjct: 241 MPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFI 300

Query: 270 ASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
           A DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V   +S  ++IY
Sbjct: 301 APDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVKEPDSEHAKIY 360

Query: 330 QEISDRIQQ 338
           ++I+ ++ +
Sbjct: 361 RDIARKVWE 369


>gi|225626603|ref|ZP_03784642.1| protein of unknown function DUF59 [Brucella ceti str. Cudo]
 gi|225618260|gb|EEH15303.1| protein of unknown function DUF59 [Brucella ceti str. Cudo]
          Length = 394

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/369 (46%), Positives = 250/369 (67%), Gaps = 31/369 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + + Q+++ LK ++ P  K+++V +  +S+IFI    V+ SITVP   A  L+ +R 
Sbjct: 8   MAGVTREQVLERLKTVTGPDFKSDVVSLGLVSDIFIADGKVFFSITVPAERAEALEPMRL 67

Query: 61  NAQQIIQNIPTVKNAVVTLT--------------------------ENKNPPQQRNNL-- 92
            A++++++IP +  A+VTLT                          ++++PPQ R     
Sbjct: 68  AAEKVVKDIPGITGALVTLTAEKKGGRTSDDAPPPPRPQARPAAASQHRHPPQPRPAAKP 127

Query: 93  ---NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV 149
               V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P+LL +SG+ 
Sbjct: 128 GVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADIYGPSMPRLLGLSGRP 187

Query: 150 EISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID 209
           E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++D
Sbjct: 188 ETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVD 247

Query: 210 MPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFL 269
           MPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+
Sbjct: 248 MPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFI 307

Query: 270 ASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
           A DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V   +S  ++IY
Sbjct: 308 APDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVKEPDSEHAKIY 367

Query: 330 QEISDRIQQ 338
           ++I+ ++ +
Sbjct: 368 RDIARKVWE 376


>gi|148560560|ref|YP_001258103.1| mrp-like protein [Brucella ovis ATCC 25840]
 gi|148371817|gb|ABQ61796.1| mrp-related protein [Brucella ovis ATCC 25840]
          Length = 394

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/369 (46%), Positives = 250/369 (67%), Gaps = 31/369 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + + Q+++ LK ++ P  K+++V +  +S+IFI    V+ SITVP   A  L+ +R 
Sbjct: 8   MAGVTREQVLERLKTVTGPDFKSDVVSLGLVSDIFIADGKVFFSITVPAERAEALEPMRL 67

Query: 61  NAQQIIQNIPTVKNAVVTLT--------------------------ENKNPPQQRNNL-- 92
            A++++++IP +  A+VTLT                          ++++PPQ R     
Sbjct: 68  AAEKVVKDIPGITGALVTLTAEKKGGRTSDDAPPPPRPQARPAAASQHRHPPQPRPAAKP 127

Query: 93  ---NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV 149
               V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P+LL +SG+ 
Sbjct: 128 GVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADIYGPSMPRLLGLSGRP 187

Query: 150 EISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID 209
           E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++D
Sbjct: 188 ETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVD 247

Query: 210 MPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFL 269
           MPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+
Sbjct: 248 MPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFI 307

Query: 270 ASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
           A DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V   +S  ++IY
Sbjct: 308 APDTGTRYDIFGHGGARREAERLNVPFLGKVPLHMDVRAYSDNGTPITVKEPDSEHAKIY 367

Query: 330 QEISDRIQQ 338
           ++I+ ++ +
Sbjct: 368 RDIARKVWE 376


>gi|306846369|ref|ZP_07478920.1| mrp-related protein [Brucella sp. BO1]
 gi|306273212|gb|EFM55103.1| mrp-related protein [Brucella sp. BO1]
          Length = 387

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/369 (46%), Positives = 249/369 (67%), Gaps = 31/369 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + + Q+++ LK ++ P  K+++V +  +S+IFI    V+ SITVP   A  L+ +R 
Sbjct: 1   MAGVTREQVLERLKTVTGPDFKSDVVSLGLVSDIFIADGKVFFSITVPAERAEALEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLT--------------------------ENKNPPQQRNNL-- 92
            A++++++IP +  A+VTLT                          ++++PPQ R     
Sbjct: 61  AAEKVVKDIPGITGALVTLTAEKKGGRTSDDAPPPPRPQARPAAASQHRHPPQPRPAAKP 120

Query: 93  ---NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV 149
               V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P+LL +SG+ 
Sbjct: 121 GVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADIYGPSMPRLLGLSGRP 180

Query: 150 EISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID 209
           E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++D
Sbjct: 181 ETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVD 240

Query: 210 MPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFL 269
           MPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+
Sbjct: 241 MPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFI 300

Query: 270 ASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
           A DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V    S  ++IY
Sbjct: 301 APDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVKEPGSEHAKIY 360

Query: 330 QEISDRIQQ 338
           ++I+ ++ +
Sbjct: 361 RDIARKVWE 369


>gi|225851598|ref|YP_002731831.1| hypothetical protein BMEA_A0058 [Brucella melitensis ATCC 23457]
 gi|254694856|ref|ZP_05156684.1| hypothetical protein Babob3T_09382 [Brucella abortus bv. 3 str.
           Tulya]
 gi|261215189|ref|ZP_05929470.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|225639963|gb|ACN99876.1| protein of unknown function DUF59 [Brucella melitensis ATCC 23457]
 gi|260916796|gb|EEX83657.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|326408070|gb|ADZ65135.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326537786|gb|ADZ86001.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 387

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 172/369 (46%), Positives = 249/369 (67%), Gaps = 31/369 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + + Q+++ LK ++ P  K+++V +  +S+IFI    V+ SITVP   A  L+ +R 
Sbjct: 1   MAGVTREQVLERLKTVTGPDFKSDVVSLGLVSDIFIADGKVFFSITVPAERAEALEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLT--------------------------ENKNPPQQRNNL-- 92
            A++++++IP +  A+VTLT                          ++++PPQ R     
Sbjct: 61  AAEKVVKDIPGITGALVTLTAEKKGGRTSDDAPPPPRPQARPAAASQHRHPPQPRPAAKP 120

Query: 93  ---NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV 149
               V   +AVASGKGGVGKSTT VN+A  L   G    ILDAD+YGPS+P+LL +SG+ 
Sbjct: 121 GVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKAGILDADIYGPSMPRLLGLSGRP 180

Query: 150 EISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID 209
           E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++D
Sbjct: 181 ETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVD 240

Query: 210 MPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFL 269
           MPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+
Sbjct: 241 MPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFI 300

Query: 270 ASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
           A DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V   +S  ++IY
Sbjct: 301 APDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVKEPDSEHAKIY 360

Query: 330 QEISDRIQQ 338
           ++I+ ++ +
Sbjct: 361 RDIARKVWE 369


>gi|17988170|ref|NP_540804.1| ATPase [Brucella melitensis bv. 1 str. 16M]
 gi|17983930|gb|AAL53068.1| mrp protein [Brucella melitensis bv. 1 str. 16M]
          Length = 394

 Score =  367 bits (942), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 172/369 (46%), Positives = 249/369 (67%), Gaps = 31/369 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + + Q+++ LK ++ P  K+++V +  +S+IFI    V+ SITVP   A  L+ +R 
Sbjct: 8   MAGVTREQVLERLKTVTGPDFKSDVVSLGLVSDIFIADGKVFFSITVPAERAEALEPMRL 67

Query: 61  NAQQIIQNIPTVKNAVVTLT--------------------------ENKNPPQQRNNL-- 92
            A++++++IP +  A+VTLT                          ++++PPQ R     
Sbjct: 68  AAEKVVKDIPGITGALVTLTAEKKGGRTSDDAPPPPRPQARPAAASQHRHPPQPRPAAKP 127

Query: 93  ---NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV 149
               V   +AVASGKGGVGKSTT VN+A  L   G    ILDAD+YGPS+P+LL +SG+ 
Sbjct: 128 GVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKAGILDADIYGPSMPRLLGLSGRP 187

Query: 150 EISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID 209
           E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++D
Sbjct: 188 ETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVD 247

Query: 210 MPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFL 269
           MPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+
Sbjct: 248 MPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFI 307

Query: 270 ASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
           A DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V   +S  ++IY
Sbjct: 308 APDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVKEPDSEHAKIY 367

Query: 330 QEISDRIQQ 338
           ++I+ ++ +
Sbjct: 368 RDIARKVWE 376


>gi|254707244|ref|ZP_05169072.1| mrp-related protein [Brucella pinnipedialis M163/99/10]
 gi|261314725|ref|ZP_05953922.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261303751|gb|EEY07248.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
          Length = 387

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 172/369 (46%), Positives = 249/369 (67%), Gaps = 31/369 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + + Q+++ LK ++ P  K+++V +  +S+IFI    V+ SITVP   A  L+ +R 
Sbjct: 1   MAGVTREQVLERLKTVTGPDFKSDVVSLGLVSDIFIADGKVFFSITVPAERAEALEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLT--------------------------ENKNPPQQRNNL-- 92
            A++++++IP +  A+VTLT                          ++++PPQ R     
Sbjct: 61  AAEKVVKDIPGITGALVTLTAEKKGGRTSDDAPPPPRPQARPAAASQHRHPPQPRPAAKP 120

Query: 93  ---NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV 149
               V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P+LL +SG+ 
Sbjct: 121 GVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADIYGPSMPRLLGLSGRP 180

Query: 150 EISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID 209
           E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++D
Sbjct: 181 ETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVD 240

Query: 210 MPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFL 269
           MPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+
Sbjct: 241 MPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFI 300

Query: 270 ASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
             DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V   +S  ++IY
Sbjct: 301 TPDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVKEPDSEHAKIY 360

Query: 330 QEISDRIQQ 338
           ++I+ ++ +
Sbjct: 361 RDIARKVWE 369


>gi|13474504|ref|NP_106073.1| ATP/GTP-binding-like protein [Mesorhizobium loti MAFF303099]
 gi|14025258|dbj|BAB51859.1| MRP protein (ATP/GTP-binding protein) homolog [Mesorhizobium loti
           MAFF303099]
          Length = 389

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 176/366 (48%), Positives = 246/366 (67%), Gaps = 33/366 (9%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + K  + + LK ++ P    NIV++  +SEIFI  + V+ SITVP   A +++ LR+ A+
Sbjct: 3   VTKEIVTERLKTVNGPDFTGNIVDLGMVSEIFIADSKVFFSITVPAARAQEMEPLRAAAE 62

Query: 64  QIIQNIPTVKNAVVTLTENKN-------------------------PPQ--------QRN 90
           ++++ IP V  AVV LT  K                           PQ        +R 
Sbjct: 63  RVVKAIPGVAGAVVALTAEKKGGGMEAPVPARPAPRPAPPATPQRPAPQAPASHSSGKRG 122

Query: 91  NLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVE 150
              ++  +AVASGKGGVGKSTT VN+A  L   G  V +LDAD+YGPS+PKLL I G+ +
Sbjct: 123 VPGIEAIIAVASGKGGVGKSTTAVNLALGLAANGLRVGVLDADIYGPSMPKLLNIHGRPQ 182

Query: 151 ISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDM 210
             D K LKP ENYG+K+MSM  LVDE   MIWRGPMV SA+  ML  V WG+LD L++DM
Sbjct: 183 TVDGKILKPMENYGLKVMSMGFLVDEETPMIWRGPMVMSALTQMLREVEWGRLDVLVVDM 242

Query: 211 PPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLA 270
           PPGTGDA LT+AQ++PL+G VIVSTPQDLALID ++ ++M++K+++P++G++ENMSYF+A
Sbjct: 243 PPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFKKVDVPLLGIVENMSYFIA 302

Query: 271 SDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQ 330
            DTGK+YD+FG+GGAR EAE++G+ FL  VP +M +R  SD G P+VV   +SA ++IY+
Sbjct: 303 PDTGKRYDIFGHGGARREAERLGVTFLGEVPLEMGIRESSDAGTPVVVSKPDSAEAKIYR 362

Query: 331 EISDRI 336
           +I+ ++
Sbjct: 363 DIAAKV 368


>gi|159184430|ref|NP_353734.2| mrp protein [Agrobacterium tumefaciens str. C58]
 gi|159139743|gb|AAK86519.2| mrp protein [Agrobacterium tumefaciens str. C58]
          Length = 388

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 176/370 (47%), Positives = 247/370 (66%), Gaps = 34/370 (9%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M ++ KNQ+  +L+ +  PG   NIV +  +SEIFI     Y SITVP   A +++ LR 
Sbjct: 1   MAEVSKNQVEKALETVIYPGSGKNIVALGMVSEIFIADAKAYFSITVPADKASEMEPLRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL---------------------------- 92
            A++  +++  +  AVV LT ++ P QQ+                               
Sbjct: 61  AAERAAKSVEGIAGAVVALTADRKPGQQQPAPAGPTPARPAAATGRPAAAPGRPTPQPGS 120

Query: 93  ------NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKIS 146
                  V+  +AVASGKGGVGKSTT VN+A  L+  G  V +LDAD+YGPS+P+LLKIS
Sbjct: 121 SKVGVPGVRAIIAVASGKGGVGKSTTAVNLALGLQALGLKVGMLDADIYGPSLPRLLKIS 180

Query: 147 GKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFL 206
           G+ +  + + + P ENYG+K+MSM  LVDE  AMIWRGPMVQSA+M ML  V WG+LD L
Sbjct: 181 GRPKQQEDRIILPMENYGLKVMSMGFLVDEEAAMIWRGPMVQSALMQMLREVAWGELDVL 240

Query: 207 LIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMS 266
           ++DMPPGTGDA LTIAQ++PL+G VIVSTPQDLAL+D ++ I+M++K+ +P++G+IENMS
Sbjct: 241 VLDMPPGTGDAQLTIAQQVPLAGAVIVSTPQDLALLDARKGITMFRKVEVPLLGVIENMS 300

Query: 267 YFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATS 326
           YF+A DTG +YD+FG+GGA+ EAE+IG+PFL  VP  + +R +SD G P+VV   +   +
Sbjct: 301 YFIAPDTGARYDIFGHGGAKAEAERIGVPFLGEVPLTISIREMSDAGTPVVVAEPDGPQA 360

Query: 327 EIYQEISDRI 336
            IY+EI++++
Sbjct: 361 AIYREIAEKV 370


>gi|62289043|ref|YP_220836.1| mrp-like protein [Brucella abortus bv. 1 str. 9-941]
 gi|82698980|ref|YP_413554.1| TonB-dependent receptor protein [Brucella melitensis biovar Abortus
           2308]
 gi|189023318|ref|YP_001934086.1| mrp-related protein [Brucella abortus S19]
 gi|254696485|ref|ZP_05158313.1| mrp-related protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260546337|ref|ZP_05822077.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260760862|ref|ZP_05873205.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|62195175|gb|AAX73475.1| mrp-related protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615081|emb|CAJ10010.1| TonB-dependent receptor protein:Mrp family:ATP/GTP-binding site
           motif A (P-loop):Protein of unknown function DUF59
           [Brucella melitensis biovar Abortus 2308]
 gi|189018890|gb|ACD71612.1| mrp-related protein [Brucella abortus S19]
 gi|260096444|gb|EEW80320.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260671294|gb|EEX58115.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 387

 Score =  365 bits (938), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 248/369 (67%), Gaps = 31/369 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + + Q+++ LK ++ P  K+++V +  +S+IFI    V+ SITVP   A  L+ +R 
Sbjct: 1   MAGVTREQVLERLKTVTGPDFKSDVVSLGLVSDIFIADGKVFFSITVPAERAEALEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLT--------------------------ENKNPPQQRNNL-- 92
            A++++++IP +  A+VTLT                          ++++PPQ R     
Sbjct: 61  AAEKVVKDIPGITGALVTLTAEKKGGRTSDDAPPPPRPQARPAAASQHRHPPQPRPAAKP 120

Query: 93  ---NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV 149
               V   +AVASGKGGVGKSTT VN+A  L   G    ILDAD+YGPS+P+LL +SG+ 
Sbjct: 121 GVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKAGILDADIYGPSMPRLLGLSGRP 180

Query: 150 EISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID 209
           E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++D
Sbjct: 181 ETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVD 240

Query: 210 MPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFL 269
           MPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+
Sbjct: 241 MPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFI 300

Query: 270 ASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
             DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V   +S  ++IY
Sbjct: 301 TPDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVKEPDSEHAKIY 360

Query: 330 QEISDRIQQ 338
           ++I+ ++ +
Sbjct: 361 RDIARKVWE 369


>gi|237814531|ref|ZP_04593529.1| hypothetical protein BAAA_1000055 [Brucella abortus str. 2308 A]
 gi|237789368|gb|EEP63578.1| hypothetical protein BAAA_1000055 [Brucella abortus str. 2308 A]
          Length = 394

 Score =  365 bits (938), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 248/369 (67%), Gaps = 31/369 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + + Q+++ LK ++ P  K+++V +  +S+IFI    V+ SITVP   A  L+ +R 
Sbjct: 8   MAGVTREQVLERLKTVTGPDFKSDVVSLGLVSDIFIADGKVFFSITVPAERAEALEPMRL 67

Query: 61  NAQQIIQNIPTVKNAVVTLT--------------------------ENKNPPQQRNNL-- 92
            A++++++IP +  A+VTLT                          ++++PPQ R     
Sbjct: 68  AAEKVVKDIPGITGALVTLTAEKKGGRTSDDAPPPPRPQARPAAASQHRHPPQPRPAAKP 127

Query: 93  ---NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV 149
               V   +AVASGKGGVGKSTT VN+A  L   G    ILDAD+YGPS+P+LL +SG+ 
Sbjct: 128 GVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKAGILDADIYGPSMPRLLGLSGRP 187

Query: 150 EISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID 209
           E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++D
Sbjct: 188 ETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVD 247

Query: 210 MPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFL 269
           MPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+
Sbjct: 248 MPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFI 307

Query: 270 ASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
             DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V   +S  ++IY
Sbjct: 308 TPDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVKEPDSEHAKIY 367

Query: 330 QEISDRIQQ 338
           ++I+ ++ +
Sbjct: 368 RDIARKVWE 376


>gi|110636349|ref|YP_676557.1| hypothetical protein Meso_4025 [Mesorhizobium sp. BNC1]
 gi|110287333|gb|ABG65392.1| protein of unknown function DUF59 [Chelativorans sp. BNC1]
          Length = 379

 Score =  365 bits (937), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 168/357 (47%), Positives = 244/357 (68%), Gaps = 24/357 (6%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + +  +V+ L  +  P  +++IV +  +SEIFI    V+ SITVP   A +L+ LR  A+
Sbjct: 3   VSRQAVVEKLSTVEGPDHESDIVSLGLVSEIFIADGKVFFSITVPAARAQELEPLREAAE 62

Query: 64  QIIQNIPTVKNAVVTLTENK-------------------NPPQQRNNL-----NVKKFVA 99
           + ++++P V  AVV LT  +                   + PQ R         V+  +A
Sbjct: 63  RAVKSLPGVTGAVVALTAERQGGMGAAPQPKPASQPQRAHAPQDRQPAKAGVPGVEAIIA 122

Query: 100 VASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKP 159
           VASGKGGVGKSTT VN+A  L++ G  V ILDAD+YGPS+P+LL I GK E+ D K LKP
Sbjct: 123 VASGKGGVGKSTTAVNLALGLQSLGLKVGILDADIYGPSMPRLLGIKGKPEMIDSKTLKP 182

Query: 160 KENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHL 219
            + YG+++MS+  LV+E   MIWRGPMV SA+  +L +V WG LD L++DMPPGTGDA L
Sbjct: 183 MDAYGLQVMSIGFLVEEETPMIWRGPMVMSALRQLLRDVAWGPLDVLVVDMPPGTGDAQL 242

Query: 220 TIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDL 279
           T+AQ++PL+G VIVSTPQDLALID ++ ++M++++ +P++G++ENMSYF+A DTG++YD+
Sbjct: 243 TMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRRVEVPVLGIVENMSYFIAPDTGRRYDI 302

Query: 280 FGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           FG+GGAR EAE++G+PFL  VP  MDVR +SD G P+VV +   A ++ Y+ ++ ++
Sbjct: 303 FGHGGARAEAERLGVPFLGEVPLTMDVREMSDAGTPVVVSDPEGAQAKTYRAVAQKV 359


>gi|325292095|ref|YP_004277959.1| mrp protein [Agrobacterium sp. H13-3]
 gi|325059948|gb|ADY63639.1| mrp protein [Agrobacterium sp. H13-3]
          Length = 383

 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 173/365 (47%), Positives = 244/365 (66%), Gaps = 29/365 (7%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M ++ K+Q+  +L+ +  PG   +IV +  +SEIFI     Y SITVP   A  ++ LR 
Sbjct: 1   MAEVSKHQVEKALEAVIYPGSGKSIVALGMVSEIFIADAKAYFSITVPADRAADMEPLRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL---------------------------- 92
           +A+Q  + +P +  AVV LT ++ P  Q+                               
Sbjct: 61  SAEQAAKGVPGIAGAVVALTADRKPGTQQPAPARPAPAPARPAAATGRPAAQPGSSKVGV 120

Query: 93  -NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEI 151
             V   +AVASGKGGVGKSTT VN+A  L+  G  V +LDAD+YGPS+P+LLKISG+ + 
Sbjct: 121 PGVGAIIAVASGKGGVGKSTTAVNLALGLQALGLKVGMLDADIYGPSLPRLLKISGRPQQ 180

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            + + + P ENYG+K+MSM  LVDE  AMIWRGPMVQSA+M ML  V WG+LD L++DMP
Sbjct: 181 QEDRIIIPMENYGLKVMSMGFLVDEEAAMIWRGPMVQSALMQMLREVAWGELDVLVLDMP 240

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA LTIAQ++PL+G VIVSTPQDLALID ++ I+M++K+ +P++G++ENMSYF+A 
Sbjct: 241 PGTGDAQLTIAQQVPLAGAVIVSTPQDLALIDARKGITMFRKVEVPLLGVVENMSYFIAP 300

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
           DTG +YD+FG+GGA+ EAE+IG+PFL  VP  + +R +SD G P+V    +   + IY++
Sbjct: 301 DTGARYDIFGHGGAKAEAERIGVPFLGEVPLTISIREMSDAGTPVVAAEPDGPQAAIYRD 360

Query: 332 ISDRI 336
           I++++
Sbjct: 361 IAEKV 365


>gi|239830902|ref|ZP_04679231.1| hypothetical protein OINT_1000063 [Ochrobactrum intermedium LMG
           3301]
 gi|239823169|gb|EEQ94737.1| hypothetical protein OINT_1000063 [Ochrobactrum intermedium LMG
           3301]
          Length = 389

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 173/369 (46%), Positives = 242/369 (65%), Gaps = 33/369 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + + Q+ + L+ ++ P  ++++V +  +S+IFI    V+ SITVP   A  L+ +R 
Sbjct: 1   MASVTREQVQERLRAVTGPDFESDVVSLGLVSDIFIADGKVFFSITVPAERADALEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKN-----------------------------PPQQRNN 91
            A++ ++ IP V  A+VTLT  K                              PPQ+   
Sbjct: 61  AAEKAVKEIPGVTGALVTLTAEKKGGRTSDDAPPPPKPQARPAAAPAQHRHPAPPQRAAT 120

Query: 92  L----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG 147
                 V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P+LL +SG
Sbjct: 121 KPGIPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADIYGPSMPRLLGLSG 180

Query: 148 KVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLL 207
           + E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L+
Sbjct: 181 RPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLV 240

Query: 208 IDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSY 267
           +DMPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSY
Sbjct: 241 VDMPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSY 300

Query: 268 FLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSE 327
           F+A DTG +YD+FGNGGAR EAE++ +PFL  VP  MDVR  SD G PI V    S  ++
Sbjct: 301 FIAPDTGARYDIFGNGGARREAERLDVPFLGEVPLHMDVRAYSDAGTPITVKEPESEHAK 360

Query: 328 IYQEISDRI 336
           IY++I+ ++
Sbjct: 361 IYRDIAAKV 369


>gi|319779881|ref|YP_004139357.1| ATPase-like, ParA/MinD [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317165769|gb|ADV09307.1| ATPase-like, ParA/MinD [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 393

 Score =  362 bits (930), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 173/371 (46%), Positives = 243/371 (65%), Gaps = 37/371 (9%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
            + K  + + LK ++ P    NIV++  +SEIFI    V+ SITVP   A +++ LR+ A
Sbjct: 2   SVTKEIVTERLKTVNGPDFTGNIVDLGMVSEIFIADGKVFFSITVPAARAQEMEPLRAAA 61

Query: 63  QQIIQNIPTVKNAVVTLTENK-------------------------------------NP 85
           +++++ IP V  AVV LT  K                                     + 
Sbjct: 62  ERVVKAIPGVAGAVVALTAEKKGGGMEAPVPSRPAPRPVPPAAPAAAAPRAAPHAPASHS 121

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI 145
             +R    ++  +AVASGKGGVGKSTT VNIA  L   G  V +LDAD+YGPS+P+LL I
Sbjct: 122 SGKRGVPGIEAIIAVASGKGGVGKSTTAVNIALGLAANGLRVGVLDADIYGPSMPRLLNI 181

Query: 146 SGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDF 205
            G+ +  D K LKP ENYG+K+MSM  LVDE   MIWRGPMV SA+  ML  V WG+LD 
Sbjct: 182 HGRPQTVDGKILKPMENYGLKVMSMGFLVDEETPMIWRGPMVMSALTQMLREVEWGRLDV 241

Query: 206 LLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENM 265
           L++DMPPGTGDA LT+AQ++PL+G VIVSTPQDLALID ++ ++M++K+++P++G++ENM
Sbjct: 242 LVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFKKVDVPLLGIVENM 301

Query: 266 SYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSAT 325
           SYF+A DTGK+YD+FG+GGAR EAE++G+ FL  VP +M +R  SD G P+VV   + A 
Sbjct: 302 SYFIAPDTGKRYDIFGHGGARREAERLGVTFLGEVPLEMGIRESSDAGTPVVVSKPDGAE 361

Query: 326 SEIYQEISDRI 336
           ++IY++I+ ++
Sbjct: 362 AKIYRDIASKV 372


>gi|260466526|ref|ZP_05812715.1| protein of unknown function DUF59 [Mesorhizobium opportunistum
           WSM2075]
 gi|259029675|gb|EEW30962.1| protein of unknown function DUF59 [Mesorhizobium opportunistum
           WSM2075]
          Length = 391

 Score =  362 bits (928), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 174/369 (47%), Positives = 244/369 (66%), Gaps = 35/369 (9%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
            + K  + + LK ++ P   +NIV++  +SEIFI    V+ SITVP   A +++ LR+ A
Sbjct: 2   SVTKEIVTERLKTVNGPDFTSNIVDLGMVSEIFIADAKVFFSITVPAARAQEMEPLRAAA 61

Query: 63  QQIIQNIPTVKNAVVTLTENK-----------------------------------NPPQ 87
           +++++ IP V  AVV LT  K                                   +   
Sbjct: 62  ERVVKAIPGVAGAVVALTAEKKGGGMEAPVPARPAARPAPSAPPAAARAAPHAPASHSHG 121

Query: 88  QRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG 147
           +R    ++  +AVASGKGGVGKSTT VNIA  L   G  V +LDAD+YGPS+P+LL I G
Sbjct: 122 KRGVPGIEAIIAVASGKGGVGKSTTAVNIALGLAANGLRVGVLDADIYGPSMPRLLNIHG 181

Query: 148 KVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLL 207
           + +  D K LKP ENYG+K+MSM  LVDE   MIWRGPMV SA+  ML  V WG+LD L+
Sbjct: 182 RPQTVDGKILKPMENYGLKVMSMGFLVDEETPMIWRGPMVMSALTQMLREVEWGRLDVLV 241

Query: 208 IDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSY 267
           +DMPPGTGDA LT+AQ++PL+G VIVSTPQDLALID ++ ++M++K+++P++G++ENMSY
Sbjct: 242 VDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSY 301

Query: 268 FLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSE 327
           FLA DTGK+YD+FG+GGAR EAE++G+ FL  VP +M +R  SD G P+V    +SA ++
Sbjct: 302 FLAPDTGKRYDIFGHGGARREAERLGVTFLGEVPLEMGIRESSDEGSPVVASKPDSAEAK 361

Query: 328 IYQEISDRI 336
           IY++I+ ++
Sbjct: 362 IYRDIASKV 370


>gi|222085037|ref|YP_002543566.1| Mrp protein [Agrobacterium radiobacter K84]
 gi|221722485|gb|ACM25641.1| Mrp protein [Agrobacterium radiobacter K84]
          Length = 385

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 179/367 (48%), Positives = 249/367 (67%), Gaps = 31/367 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  I K Q++D+LK +  P  ++NIVE+  +S++FI    VY SITVP   A  L+ +R 
Sbjct: 1   MAGITKEQVLDTLKTVRGPDLEHNIVELGMVSDVFISDAKVYFSITVPAERAKDLEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKN----------PPQQRNNLN----------------- 93
            A+++I+ +P VK A+V LT +K           PPQ +++ +                 
Sbjct: 61  AAERVIKEMPGVKGAMVALTADKKAGGAPTARPAPPQPQSHAHPHSYAPAPQQQPRAGKI 120

Query: 94  ----VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV 149
               V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P+LLKISGK 
Sbjct: 121 GVPGVGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGILDADIYGPSMPRLLKISGKP 180

Query: 150 EISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID 209
              D + + P ENYG+K+MSM  LV+E  AMIWRGPMVQSA++ ML  V WG+LD L++D
Sbjct: 181 SQIDGRIIVPMENYGLKVMSMGFLVEEETAMIWRGPMVQSALLQMLREVAWGELDVLVVD 240

Query: 210 MPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFL 269
           MPPGTGD  LT+AQ++PL+G VIVSTPQDLALID ++ ++M++K+ +P++G++ENMSYF+
Sbjct: 241 MPPGTGDVQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRKVEVPLLGIVENMSYFI 300

Query: 270 ASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
           A DTG +YD+FG+GGAR EAE+IG+PFL  VP  M +R  SD G P+V  + +   + IY
Sbjct: 301 APDTGARYDIFGHGGARKEAERIGVPFLGEVPLTMGIRETSDAGTPLVASDPSGIVAGIY 360

Query: 330 QEISDRI 336
           ++I+ ++
Sbjct: 361 RDIAAKV 367


>gi|116250694|ref|YP_766532.1| ATP-binding mrp family protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255342|emb|CAK06417.1| putative ATP-binding mrp family protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 386

 Score =  360 bits (923), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 178/370 (48%), Positives = 249/370 (67%), Gaps = 32/370 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + K Q++++LK +  P  +++IVE+  +S++FI    VY SITVP   A +L+ +R 
Sbjct: 1   MADVTKEQVLETLKTVRGPDLEHHIVELGMVSDVFISDGKVYFSITVPADRAKELEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENK--------------------------NPPQQRNNLN- 93
            A+++I+ +P VK A+VTLT +K                          + PQQ      
Sbjct: 61  AAERVIKEMPGVKGALVTLTADKKAAAAAPAARPNPPHGHPGHDHAGHAHAPQQPPRAGK 120

Query: 94  -----VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGK 148
                +   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P+LLKISG+
Sbjct: 121 IGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGILDADIYGPSMPRLLKISGR 180

Query: 149 VEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLI 208
               D + + P ENYG+K+MSM  LVDE  AMIWRGPMVQSA++ ML  V WG+LD L++
Sbjct: 181 PTQIDGRIINPMENYGLKVMSMGFLVDEETAMIWRGPMVQSALLQMLREVAWGELDVLVV 240

Query: 209 DMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYF 268
           DMPPGTGDA LT+AQ++PL+G VIVSTPQDLALID ++ ++M++K+ +P++G++ENMSYF
Sbjct: 241 DMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRKVEVPVLGIVENMSYF 300

Query: 269 LASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEI 328
           +A DTG +YD+FG+GGAR EAE+IG+PFL  VP  M++R  SD G P+V    N   + I
Sbjct: 301 IAPDTGTRYDIFGHGGARKEAERIGVPFLGEVPLTMNIRETSDAGTPLVASEPNGVVAGI 360

Query: 329 YQEISDRIQQ 338
           Y+ I+ ++ +
Sbjct: 361 YRGIAAKVWE 370


>gi|190890570|ref|YP_001977112.1| hypothetical protein RHECIAT_CH0000949 [Rhizobium etli CIAT 652]
 gi|190695849|gb|ACE89934.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 394

 Score =  360 bits (923), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 177/378 (46%), Positives = 249/378 (65%), Gaps = 40/378 (10%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + K Q++++LK +  P  +++IV +  +S++FI    VY SITVP   A +L+ +R 
Sbjct: 1   MTDVTKEQVLETLKTVRGPDLEHDIVALGMVSDVFISDGKVYFSITVPAERAKELEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKN---------------------------------PPQ 87
            A+++I+ +P VK A+VTLT ++                                   PQ
Sbjct: 61  AAERVIKEMPGVKGALVTLTADRKAAAAAPAARPAPNPPHGHAGHDHGGHDHQHHAPAPQ 120

Query: 88  QRNNL-------NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIP 140
           QR           +   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P
Sbjct: 121 QRAPRAGKIGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGILDADIYGPSMP 180

Query: 141 KLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVW 200
           +LLKISG+    D + + P ENYG+K+MSM  LVDE  AMIWRGPMVQSA++ ML  V W
Sbjct: 181 RLLKISGRPTQIDGRIINPMENYGLKVMSMGFLVDEETAMIWRGPMVQSALLQMLREVAW 240

Query: 201 GQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIG 260
           G+LD L++DMPPGTGDA LT+AQ++PL+G VIVSTPQDLALID ++ ++M++K+ +P++G
Sbjct: 241 GELDVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRKVEVPVLG 300

Query: 261 MIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHN 320
           ++ENMSYF+A DTG +YD+FG+GGAR EAE+IG+PFL  VP  M++R  SD G P+V  +
Sbjct: 301 IVENMSYFIAPDTGTRYDIFGHGGARKEAERIGVPFLGEVPLTMNIRETSDAGTPLVASD 360

Query: 321 MNSATSEIYQEISDRIQQ 338
            N   + IY+ I+ ++ +
Sbjct: 361 PNGVVAGIYRGIATKVWE 378


>gi|86356505|ref|YP_468397.1| ATP-binding protein (Mrp protein-like) [Rhizobium etli CFN 42]
 gi|86280607|gb|ABC89670.1| probable ATP-binding protein (Mrp protein-like) [Rhizobium etli CFN
           42]
          Length = 389

 Score =  359 bits (921), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 177/373 (47%), Positives = 249/373 (66%), Gaps = 35/373 (9%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + K Q++++LK +  P  +++IV +  +S++FI    VY SITVP   A +L+ +R 
Sbjct: 1   MTDVTKEQVLETLKTVRGPDLEHDIVALGMVSDVFISDGKVYFSITVPAERAKELEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKN----------------------------PPQQRNNL 92
            A+++I+ +P VK A+VTLT +K                              PQQ+   
Sbjct: 61  AAERVIKEMPGVKGALVTLTADKKAAAAAPAARPASNPPHGHAGHDHGHHAHAPQQQPPR 120

Query: 93  -------NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI 145
                   +   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P+LLKI
Sbjct: 121 AGKIGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGILDADIYGPSMPRLLKI 180

Query: 146 SGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDF 205
           +G+    D + + P ENYG+K+MSM  LVDE  AMIWRGPMVQSA+M ML  V WG+LD 
Sbjct: 181 AGRPTQIDGRIINPMENYGLKVMSMGFLVDEETAMIWRGPMVQSALMQMLREVAWGELDV 240

Query: 206 LLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENM 265
           L++DMPPGTGDA LT+AQ++PL+G VIVSTPQDLALID ++ ++M++K+ +P++G++ENM
Sbjct: 241 LVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRKVEVPVLGIVENM 300

Query: 266 SYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSAT 325
           SYF+A DTG +YD+FG+GGAR EAE+IG+PFL  VP  M++R  SD G P+V  + N   
Sbjct: 301 SYFIAPDTGTRYDIFGHGGARKEAERIGVPFLGEVPLTMNIRETSDAGTPLVASDPNGVV 360

Query: 326 SEIYQEISDRIQQ 338
           + IY+ I+ ++ +
Sbjct: 361 AGIYRGIAAKVWE 373


>gi|254503062|ref|ZP_05115213.1| conserved domain protein [Labrenzia alexandrii DFL-11]
 gi|222439133|gb|EEE45812.1| conserved domain protein [Labrenzia alexandrii DFL-11]
          Length = 382

 Score =  358 bits (920), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 163/361 (45%), Positives = 242/361 (67%), Gaps = 25/361 (6%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M++ +KN ++D L+ +  P  + +I+ +  +S++F+    V  SITVP   A +L+ LR 
Sbjct: 1   MSETIKNAVMDRLRQIKGPDLEGDIISLGLVSDVFVSDGRVAFSITVPAARAQELEPLRQ 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENK-------------------NPPQQRNNL------NVK 95
            A+++++ +  V+NA+V LT  +                    PPQ+           +K
Sbjct: 61  AAEKVVKEVDGVENAMVALTAERAPGSAPVRPPQPAPAPRTPKPPQEEQASAKPGVPGIK 120

Query: 96  KFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKK 155
             VAVASGKGGVGKSTT  N+A  +   G  V +LDAD+YGPS+P+L  +SG+ E    +
Sbjct: 121 HIVAVASGKGGVGKSTTTANLALGMAANGLKVGVLDADIYGPSVPRLFNVSGRPEALSGR 180

Query: 156 FLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTG 215
            LKP E YG+K+MSM  +V+E   MIWRGPMV SA+  ML  V WG+LD L++DMPPGTG
Sbjct: 181 MLKPLEGYGVKVMSMGFMVEEETPMIWRGPMVISALTQMLREVAWGELDVLVVDMPPGTG 240

Query: 216 DAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGK 275
           DA LT+AQ++PL+G VIVSTPQDLALID ++ ++M++K+++P++G++ENMSYFL  D G 
Sbjct: 241 DAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLAMFKKVDVPVLGIVENMSYFLCPDCGS 300

Query: 276 KYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
           ++D+FG+GGAR +AE++G+PFL  VP  M +R  SD G PIVV +  S +++IY+EI+ +
Sbjct: 301 RHDIFGHGGARADAERLGVPFLGEVPLAMKIRETSDAGTPIVVSDPESQSAQIYKEIAGK 360

Query: 336 I 336
           +
Sbjct: 361 V 361


>gi|241203296|ref|YP_002974392.1| hypothetical protein Rleg_0549 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857186|gb|ACS54853.1| protein of unknown function DUF59 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 388

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 177/372 (47%), Positives = 248/372 (66%), Gaps = 34/372 (9%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + K Q++++LK +  P  +++IVE+  +S++FI    VY SITVP   A +L+ +R 
Sbjct: 1   MADVTKEQVLETLKTVRGPDLEHDIVELGMVSDVFISDGKVYFSITVPADRAKELEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENK----------------------------NPPQQRNNL 92
            A+++I+ +P VK A+VTLT +K                            + PQQ    
Sbjct: 61  AAERVIKEMPGVKGALVTLTADKKAAAAAPAARPAANPPHGHAGHDHGSHAHAPQQPPRA 120

Query: 93  ------NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKIS 146
                  +   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P+LLKIS
Sbjct: 121 GKIGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGILDADIYGPSMPRLLKIS 180

Query: 147 GKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFL 206
           G+    D + + P ENYG+K+MSM  LVDE  AMIWRGPMVQSA++ ML  V WG+LD L
Sbjct: 181 GRPTQIDGRIINPMENYGLKVMSMGFLVDEETAMIWRGPMVQSALLQMLREVAWGELDVL 240

Query: 207 LIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMS 266
           ++DMPPGTGD  LT+AQ++PL+G VIVSTPQDLALID ++ ++M++K+ +P++G++ENMS
Sbjct: 241 VVDMPPGTGDVQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRKVEVPVLGIVENMS 300

Query: 267 YFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATS 326
           YF+A DTG +YD+FG+GGAR EAE+IG+PFL  VP  M++R  SD G P+V    N   +
Sbjct: 301 YFIAPDTGTRYDIFGHGGARKEAERIGVPFLGEVPLTMNIRETSDAGTPLVASEPNGVVA 360

Query: 327 EIYQEISDRIQQ 338
            IY+ I+ ++ +
Sbjct: 361 GIYRGIAAKVWE 372


>gi|327188115|gb|EGE55338.1| hypothetical protein RHECNPAF_950013 [Rhizobium etli CNPAF512]
          Length = 394

 Score =  357 bits (916), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 176/378 (46%), Positives = 249/378 (65%), Gaps = 40/378 (10%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + K Q++++LK +  P  +++IV +  +S++FI    VY SITVP   A +L+ +R 
Sbjct: 1   MTDVTKEQVLETLKTVRGPDLEHDIVALGMVSDVFISDGKVYFSITVPAERAKELEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKN---------------------------------PPQ 87
            A+++I+ +P VK A+VTLT ++                                   PQ
Sbjct: 61  AAERVIKEMPGVKGALVTLTADRKAAAAAPAARPAPNPPHGHAGHDHGGHDHQHHAPAPQ 120

Query: 88  QRNNL-------NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIP 140
           Q+           +   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P
Sbjct: 121 QQAPRAGKIGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGILDADIYGPSMP 180

Query: 141 KLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVW 200
           +LLKISG+    D + + P ENYG+K+MSM  LVDE  AMIWRGPMVQSA++ ML  V W
Sbjct: 181 RLLKISGRPTQIDGRIINPMENYGLKVMSMGFLVDEETAMIWRGPMVQSALLQMLREVAW 240

Query: 201 GQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIG 260
           G+LD L++DMPPGTGDA LT+AQ++PL+G VIVSTPQDLALID ++ ++M++K+ +P++G
Sbjct: 241 GELDVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRKVEVPVLG 300

Query: 261 MIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHN 320
           ++ENMSYF+A DTG +YD+FG+GGAR EAE+IG+PFL  VP  M++R  SD G P+V  +
Sbjct: 301 IVENMSYFIAPDTGTRYDIFGHGGARKEAERIGVPFLGEVPLTMNIRETSDAGTPLVASD 360

Query: 321 MNSATSEIYQEISDRIQQ 338
            N   + IY+ I+ ++ +
Sbjct: 361 PNGVVAGIYRGIATKVWE 378


>gi|218662815|ref|ZP_03518745.1| hypothetical protein RetlI_27224 [Rhizobium etli IE4771]
          Length = 394

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 176/378 (46%), Positives = 250/378 (66%), Gaps = 40/378 (10%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + K Q++++LK +  P  +++IV +  +S++FI    VY SITVP   A +L+ +R 
Sbjct: 1   MTDVTKEQVLETLKTVRGPDLEHDIVALGMVSDVFISDGKVYFSITVPAERAKELEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENK---------------------------------NPPQ 87
            A+++I+ +P VK A+VTLT ++                                 + PQ
Sbjct: 61  AAERVIKEMPGVKGALVTLTADRKATAAAPAARPAPNPPHGHGGHDHGTHDHQHHAHAPQ 120

Query: 88  QRNNL-------NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIP 140
           Q+           +   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P
Sbjct: 121 QQPPRAGKIGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGILDADIYGPSMP 180

Query: 141 KLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVW 200
           +LLKISG+    D + + P ENYG+K+MSM  LVDE  AMIWRGPMVQSA++ ML  V W
Sbjct: 181 RLLKISGRPTQIDGRIINPMENYGLKVMSMGFLVDEETAMIWRGPMVQSALLQMLREVAW 240

Query: 201 GQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIG 260
           G+LD L++DMPPGTGDA LT+AQ++PL+G VIVSTPQDLALID ++ ++M++K+ +P++G
Sbjct: 241 GELDVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRKVEVPVLG 300

Query: 261 MIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHN 320
           ++ENMSYF+A DTG +YD+FG+GGAR EAE+IG+PFL  VP  M++R  SD G P+V  +
Sbjct: 301 IVENMSYFIAPDTGTRYDIFGHGGARKEAERIGVPFLGEVPLTMNIRETSDAGTPLVASD 360

Query: 321 MNSATSEIYQEISDRIQQ 338
            N   + IY+ I+ ++ +
Sbjct: 361 PNGVVAGIYRGIAAKVWE 378


>gi|209548112|ref|YP_002280029.1| hypothetical protein Rleg2_0506 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533868|gb|ACI53803.1| protein of unknown function DUF59 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 394

 Score =  356 bits (914), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 176/378 (46%), Positives = 248/378 (65%), Gaps = 40/378 (10%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + K Q++++LK +  P  +++IVE+  +S++FI    VY SITVP   A +L+ +R 
Sbjct: 1   MTDVTKEQVLETLKTVRGPDLEHDIVELGMVSDVFISDGKVYFSITVPADRAKELEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKN---------------------------------PPQ 87
            A+++++ +P VK A+V LT +K                                   PQ
Sbjct: 61  AAERVVKAMPGVKGALVALTADKKAAAAAPAARPAPNPPHGHAGHDHHGHDHGSHAHAPQ 120

Query: 88  QRNNL-------NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIP 140
           Q+           +   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P
Sbjct: 121 QQPPRAGKIGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGILDADIYGPSMP 180

Query: 141 KLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVW 200
           +LLKISG+    D + + P ENYG+K+MSM  LVDE  AMIWRGPMVQSA++ ML  V W
Sbjct: 181 RLLKISGRPTQIDGRIINPMENYGLKVMSMGFLVDEETAMIWRGPMVQSALLQMLREVAW 240

Query: 201 GQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIG 260
           G+LD L++DMPPGTGDA LT+AQ++PL+G VIVSTPQDLALID ++ ++M++K+ +P++G
Sbjct: 241 GELDVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRKVEVPVLG 300

Query: 261 MIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHN 320
           ++ENMSYF+A DTG +YD+FG+GGAR EAE+IG+PFL  VP  M++R  SD G P+V   
Sbjct: 301 IVENMSYFIAPDTGTRYDIFGHGGARKEAERIGVPFLGEVPLTMNIRETSDAGTPLVASE 360

Query: 321 MNSATSEIYQEISDRIQQ 338
            N   + IY+ I+ ++ +
Sbjct: 361 PNGVVAGIYRGIATKVWE 378


>gi|328544431|ref|YP_004304540.1| ATP-binding protein (Mrp protein-like) [polymorphum gilvum
           SL003B-26A1]
 gi|326414173|gb|ADZ71236.1| Probable ATP-binding protein (Mrp protein-like) [Polymorphum gilvum
           SL003B-26A1]
          Length = 381

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 166/360 (46%), Positives = 237/360 (65%), Gaps = 24/360 (6%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+  +K  ++D L  +  P  + ++V +  +S+IF+    V  SITVP   A +L+ LR 
Sbjct: 1   MSDAIKQAVLDRLSRVKGPDLEGDLVSLGLVSDIFVSDGRVAFSITVPADRARELEPLRQ 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENK-----------NPPQQRNNL-------------NVKK 96
            A++++  I  V+ A+V LT  +            P   R  +              V+ 
Sbjct: 61  AAEKVVLEIDGVERAMVALTAERKVSGDAASARSTPSPARARVAAPEASSAKPGVPGVRH 120

Query: 97  FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKF 156
            +AVASGKGGVGKSTT  N+A ALK  G  V +LDAD+YGPSIP+L  +SG+ E    + 
Sbjct: 121 IIAVASGKGGVGKSTTTANLALALKANGLRVGVLDADIYGPSIPRLFHVSGRPEPVSGRV 180

Query: 157 LKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGD 216
           LKP E YG+K+MSM  +V+E+  MIWRGPMV SA+  ML  V WG LD L++DMPPGTGD
Sbjct: 181 LKPLEGYGVKVMSMGFMVEEDTPMIWRGPMVMSALTQMLREVAWGDLDVLVVDMPPGTGD 240

Query: 217 AHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKK 276
           A LT+AQ++PLSG VIVSTPQDLALID ++ ++M++++ +P++G++ENMSYFL  D G +
Sbjct: 241 AQLTMAQQVPLSGAVIVSTPQDLALIDARKGLNMFRRVEVPVLGIVENMSYFLCPDCGSR 300

Query: 277 YDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +D+FG+GGAR EAEK+G+PFL  VP DM +R+ SD G P+VV + +   + IY++I+ R+
Sbjct: 301 HDIFGHGGARAEAEKLGVPFLGEVPLDMQIRITSDAGTPVVVSDPDGPHARIYRDIASRV 360


>gi|163758627|ref|ZP_02165714.1| hypothetical protein HPDFL43_14427 [Hoeflea phototrophica DFL-43]
 gi|162283917|gb|EDQ34201.1| hypothetical protein HPDFL43_14427 [Hoeflea phototrophica DFL-43]
          Length = 394

 Score =  352 bits (904), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 167/358 (46%), Positives = 236/358 (65%), Gaps = 28/358 (7%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + K  I+  LK +  P  ++NIV++  +S+IFI     Y S+TVP   A +L+ LR  A+
Sbjct: 15  VTKEDILAKLKTVKGPDLESNIVDLGLVSDIFIADGKAYFSLTVPAARARELEPLREAAE 74

Query: 64  QIIQNIPTVKNAVVTLTENKNP-------------------------PQQRNNL---NVK 95
           +  + +P ++ A+V LT  + P                         PQ R  +    VK
Sbjct: 75  RAAKTVPGIEGAMVALTAAREPGTSAPPPQSATPPAPPTPPATARAQPQGRAKMEVPGVK 134

Query: 96  KFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKK 155
             +AVASGKGGVGKSTT VN+A  L+  G +V +LDAD+YGPS+P+LL ISG+ E  + +
Sbjct: 135 TIIAVASGKGGVGKSTTAVNLALGLQASGLSVGVLDADIYGPSMPRLLGISGRPEQLEGR 194

Query: 156 FLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTG 215
            LKP ENYG+K+MSM  +V+E+  MIWRGPMV SA+  ML  V WG LD L++DMPPGTG
Sbjct: 195 MLKPMENYGLKVMSMGFMVEEDTPMIWRGPMVMSALNQMLREVAWGDLDVLVVDMPPGTG 254

Query: 216 DAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGK 275
           DA LT+AQ +PL+G VIVSTPQDLALID ++ ++M+ K+N+P++G++ENMS+FL  D G 
Sbjct: 255 DAQLTMAQNVPLAGAVIVSTPQDLALIDARKGLNMFNKVNVPVLGIVENMSFFLCPDCGG 314

Query: 276 KYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           ++D+FG+GGAR EA +IG+PFL  VP  M +R  SD G P+V    +   ++IY++I+
Sbjct: 315 RHDIFGHGGARDEAARIGVPFLGEVPLAMPIRETSDAGKPVVATAADGPHAKIYRDIA 372


>gi|218680548|ref|ZP_03528445.1| hypothetical protein RetlC8_17350 [Rhizobium etli CIAT 894]
          Length = 397

 Score =  352 bits (902), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 176/378 (46%), Positives = 248/378 (65%), Gaps = 45/378 (11%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           K Q++++LK +  P  +++IVE+  +S++FI   TVY SITVP   A +L+ +R  A+++
Sbjct: 4   KEQVLETLKTVRGPDLEHDIVELGMVSDVFISDGTVYFSITVPADRAKELEPMRLAAERV 63

Query: 66  IQNIPTVKNAVVTLTENK--------------------------------------NPPQ 87
           ++ +P VK A+V LT +K                                      + PQ
Sbjct: 64  VKAMPGVKGALVALTADKKAAAAAPAARPVPNPPHGHAGHDHADHDHRGHDHGSHAHAPQ 123

Query: 88  QRNNL-------NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIP 140
           Q+           +   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P
Sbjct: 124 QQPPRTGRIGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGILDADMYGPSMP 183

Query: 141 KLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVW 200
           +LLKISG+    D + + P ENYG+K+MSM  LVDE  AMIWRGPMVQSA++ ML  V W
Sbjct: 184 RLLKISGRPTQIDGRIINPMENYGLKVMSMGFLVDEETAMIWRGPMVQSALLQMLREVAW 243

Query: 201 GQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIG 260
           G+LD L++DMPPGTGDA LT+AQ++PL+G VIVSTPQDLALID ++ ++M++K+ +P++G
Sbjct: 244 GELDVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRKVEVPVLG 303

Query: 261 MIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHN 320
           ++ENMSYF+A DTG +YD+FG+GGAR EAE+IG+PFL  VP  M++R  SD G P+V   
Sbjct: 304 IVENMSYFIAPDTGTRYDIFGHGGARKEAERIGVPFLGEVPLTMNIRETSDAGTPLVASE 363

Query: 321 MNSATSEIYQEISDRIQQ 338
            N   + IY+ I+ ++ +
Sbjct: 364 PNGVVAGIYRGIAAKVWE 381


>gi|218463391|ref|ZP_03503482.1| hypothetical protein RetlK5_29930 [Rhizobium etli Kim 5]
          Length = 394

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 173/378 (45%), Positives = 245/378 (64%), Gaps = 40/378 (10%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + K Q++++LK +  P  +++IV +  +S++FI    VY SITVP   A +L+ +R 
Sbjct: 1   MTDVTKEQVLETLKTVRGPDLEHDIVALGMVSDVFISDGKVYFSITVPAERAKELEPMRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL---------------------------- 92
            A+++I+ +P VK A+VTLT ++                                     
Sbjct: 61  AAERVIKEMPGVKGALVTLTADRKAAAAAPAARPAPNPPHGHVGHDHGTHDHQHQAHAPQ 120

Query: 93  ------------NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIP 140
                        +   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P
Sbjct: 121 QQPPRAGKIGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGILDADIYGPSMP 180

Query: 141 KLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVW 200
           +LLKISG+    D + + P ENYG+K+MSM  LVDE  AMIWRGPMVQSA++ ML  V W
Sbjct: 181 RLLKISGRPTQIDGRIINPMENYGLKVMSMGFLVDEETAMIWRGPMVQSALLQMLREVAW 240

Query: 201 GQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIG 260
           G+LD L++DMPPGTGDA LT+AQ++PL+G VIVSTPQDLALID ++ ++M++K+ +P++G
Sbjct: 241 GELDVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRKVEVPVLG 300

Query: 261 MIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHN 320
           ++ENMSYF+A DTG +YD+FG+GGAR EAE+IG+PFL  VP  M++R  SD G P+V  +
Sbjct: 301 IVENMSYFIAPDTGTRYDIFGHGGARKEAERIGVPFLGEVPLTMNIRETSDAGTPLVASD 360

Query: 321 MNSATSEIYQEISDRIQQ 338
            N   + IY+ I+ ++ +
Sbjct: 361 PNGVVAGIYRGIAAKVWE 378


>gi|307945328|ref|ZP_07660664.1| putative mrp-like protein [Roseibium sp. TrichSKD4]
 gi|307771201|gb|EFO30426.1| putative mrp-like protein [Roseibium sp. TrichSKD4]
          Length = 394

 Score =  349 bits (895), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 160/373 (42%), Positives = 243/373 (65%), Gaps = 37/373 (9%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+  +K  +++ L  +  P  + ++V +  +S++F+    V  SITVP   A +L+ LR 
Sbjct: 1   MSDSIKQAVLEQLAKVKGPDLEGDLVSLGLVSDVFVSDGRVAFSITVPADRAQELEPLRQ 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNP-------------------------------PQQR 89
            A+++++++P V+NA+V LT  K P                               P + 
Sbjct: 61  AAEKVVKDVPGVENAMVALTAEKAPGAKSSTPPPARPAPSKAQMGAVPPPMQGRATPSEE 120

Query: 90  NNL------NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL 143
                     VK  +AVASGKGGVGKSTT  N+A  L+  G  V +LDAD+YGPS+P+L 
Sbjct: 121 QGAQKPGVPGVKTIIAVASGKGGVGKSTTTANLALGLQANGLKVGVLDADIYGPSVPRLF 180

Query: 144 KISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQL 203
           +++G+ E    + LKP E YG+K+MSM  +V+E   MIWRGPMV SA+  ML  V WG+L
Sbjct: 181 QVTGRPEPVSGRILKPLEGYGVKVMSMGFMVEEETPMIWRGPMVISALTQMLREVAWGEL 240

Query: 204 DFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIE 263
           D L++DMPPGTGDA LT+AQ++PL+G VIVSTPQDLALID ++ ++M++++++P++G++E
Sbjct: 241 DVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRRVDVPVLGIVE 300

Query: 264 NMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS 323
           NMSYFL  D G ++D+FG+GGAR EAEK+G+PFL  VP +M +R  SD G P+VV + + 
Sbjct: 301 NMSYFLCPDCGSRHDIFGHGGARAEAEKLGVPFLGEVPLNMQIRETSDAGTPVVVSDPDG 360

Query: 324 ATSEIYQEISDRI 336
             ++IY++I++++
Sbjct: 361 QHAKIYRDIAEKV 373


>gi|222147697|ref|YP_002548654.1| mrp protein [Agrobacterium vitis S4]
 gi|221734685|gb|ACM35648.1| mrp protein [Agrobacterium vitis S4]
          Length = 386

 Score =  348 bits (892), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 177/366 (48%), Positives = 240/366 (65%), Gaps = 33/366 (9%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           KN ++++LK +  P  + NIV++  +S++FI    VYLSI VP   A +L+ LR  A++ 
Sbjct: 5   KNTVLEALKTVRGPDLEGNIVDLGMVSDVFISDAKVYLSINVPAERARELEPLRQAAERS 64

Query: 66  IQNIPTVKNAVVTLTENK------NPPQQRNNL--------------------------- 92
           ++ +  VK A+V+LT  +       PP                                 
Sbjct: 65  VKALAGVKGALVSLTAERKAGSPSTPPAPSATSPSHSHSHGHSHAPAPSQPARPAKAGIP 124

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            +   +AVASGKGGVGKSTT VN+A AL   G  V ILDADVYGPS+P+LL ISG+ +  
Sbjct: 125 GIGAIIAVASGKGGVGKSTTAVNLALALLANGLKVGILDADVYGPSMPRLLGISGRPQQI 184

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D + + P ENYG+K MS+  LVDE  AMIWRGPMVQSA+M ML  V WG+LD L++DMPP
Sbjct: 185 DGRIIVPMENYGLKAMSIGFLVDEGTAMIWRGPMVQSALMQMLREVAWGELDVLVVDMPP 244

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGDA LT+AQ++PLSG VIVSTPQDLALID ++ I+M++K+ +P++G+IENMSYF+A D
Sbjct: 245 GTGDAQLTMAQQVPLSGAVIVSTPQDLALIDARKGINMFKKVEVPVLGVIENMSYFIAPD 304

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
           TG +YD+FG+GGA+ EAE IG PFL  VP  + +R  SD G P+VV    S  + +Y+EI
Sbjct: 305 TGARYDIFGHGGAKAEAEAIGAPFLGEVPLTISIREHSDAGTPVVVSEPESPQALVYREI 364

Query: 333 SDRIQQ 338
           + R+ +
Sbjct: 365 ATRVWR 370


>gi|46370362|gb|AAS89970.1| ATP-binding protein [Agrobacterium vitis]
          Length = 388

 Score =  347 bits (889), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 176/368 (47%), Positives = 240/368 (65%), Gaps = 35/368 (9%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           KN ++++LK +  P  + NIV++  +S++FI    VYLSI VP   A +L+ LR  A++ 
Sbjct: 5   KNTVLEALKTVRGPDLEGNIVDLGMVSDVFISDAKVYLSINVPAERARELEPLRQAAERS 64

Query: 66  IQNIPTVKNAVVTLTENKNP-----------------------------------PQQRN 90
           ++ +  VK A+V+LT  +                                     P +  
Sbjct: 65  VKALAGVKGALVSLTAERKAGSPSTPPAPSAPNPSHLHSHSHGHSHAPAPSQPARPAKAG 124

Query: 91  NLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVE 150
              +   +AVASGKGGVGKSTT VN+A AL   G  V ILDADVYGPS+P+LL ISG+ +
Sbjct: 125 IPGIGAIIAVASGKGGVGKSTTAVNLALALLANGLKVGILDADVYGPSMPRLLGISGRPQ 184

Query: 151 ISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDM 210
             D + + P ENYG+K MS+  LVDE  AMIWRGPMVQSA+M ML  V WG+LD L++DM
Sbjct: 185 QIDGRIIVPMENYGLKAMSIGFLVDEGTAMIWRGPMVQSALMQMLREVAWGELDVLVVDM 244

Query: 211 PPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLA 270
           PPGTGDA LT+AQ++PLSG VIVSTPQDLALID ++ I+M++K+ +P++G+IENMSYF+A
Sbjct: 245 PPGTGDAQLTMAQQVPLSGAVIVSTPQDLALIDARKGINMFKKVEVPVLGVIENMSYFIA 304

Query: 271 SDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQ 330
            DTG +YD+FG+GGA+ EAE IG PFL  VP  + +R  SD G P+VV    S  + +Y+
Sbjct: 305 PDTGARYDIFGHGGAKAEAEAIGAPFLGEVPLTISIREHSDAGTPVVVSEPESPQALVYR 364

Query: 331 EISDRIQQ 338
           EI+ R+ +
Sbjct: 365 EIATRVWR 372


>gi|90418466|ref|ZP_01226378.1| Mrp-related protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90338138|gb|EAS51789.1| Mrp-related protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 386

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 167/362 (46%), Positives = 232/362 (64%), Gaps = 32/362 (8%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I K  I++ LK +  P    NIV++  +S+IF+    V+ S+T+P   A +L+ LR+ A+
Sbjct: 3   IDKADILEQLKRVKGPDLTGNIVDLGLVSDIFVADGKVFFSLTIPADRAEELEPLRAAAE 62

Query: 64  QIIQNIPTVKNAVVTLTENKN-----------------------------PPQQRNNLNV 94
           +    +P V+ A V LT                                 PP+      V
Sbjct: 63  KAASGVPGVEKATVALTAEATKSSAKPVRPAPSPSQAAAVPPPMAGRAPQPPKAPEKAGV 122

Query: 95  K---KFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEI 151
                 +AVASGKGGVGKSTT VN+A  L+  G  V I+DAD+YGPS+P+LL ISG+ + 
Sbjct: 123 PGIGAIIAVASGKGGVGKSTTSVNLALGLQANGLKVGIMDADIYGPSMPRLLHISGRPQN 182

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
              + ++P E YG+K+MSM  LVDE   MIWRGPMV SA+  ML  V WG+LD L++DMP
Sbjct: 183 VSGRIIRPMEGYGLKVMSMGFLVDEETPMIWRGPMVISALTQMLREVEWGELDVLVVDMP 242

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA LT+AQ +PL+G VIVSTPQDLALID ++ ++M++K+++PI+G++ENMSYF+  
Sbjct: 243 PGTGDAQLTMAQNVPLAGAVIVSTPQDLALIDARKGLAMFRKVDVPILGIVENMSYFVCP 302

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
           D G ++D+FG+GGAR EAE+IG+PFL  VP DM +R  SD G PIV+   +S  S+ Y+E
Sbjct: 303 DCGGRHDIFGHGGARKEAERIGVPFLGEVPLDMQIRSTSDGGTPIVMSEPDSVHSKTYRE 362

Query: 332 IS 333
           I+
Sbjct: 363 IA 364


>gi|90418336|ref|ZP_01226248.1| putative mrp protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90338008|gb|EAS51659.1| putative mrp protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 387

 Score =  335 bits (860), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 161/367 (43%), Positives = 229/367 (62%), Gaps = 32/367 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M++  K++I+  LK +  P  K ++V    +S+IFI     + S++VP T A + +    
Sbjct: 1   MSEAQKSRILTILKAMDAPDGKGDVVSRDMVSDIFIADGKAFFSLSVPTTEAERFEPFCR 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENK--------------------------------NPPQQ 88
           + +  +  +  + +A+V LT  +                                 P Q+
Sbjct: 61  SIESAVAGVEGITSALVALTAERPAGSAPERPAPSARPGQAIRPGEAPSSPAPQRQPSQK 120

Query: 89  RNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGK 148
                + + VAVASGKGGVGKSTT VN+A      G  V ILDAD+YGPSIP+LL + GK
Sbjct: 121 PGIPGITRIVAVASGKGGVGKSTTAVNLALGFAAVGMKVGILDADIYGPSIPRLLNLKGK 180

Query: 149 VEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLI 208
              S  + + P E YG+K MSM  LV+E V MIWRGPMV SA+  ML  V WG+LD L++
Sbjct: 181 PRTSGGRAMIPLEAYGLKAMSMGFLVNEEVPMIWRGPMVMSALTQMLREVEWGELDILVV 240

Query: 209 DMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYF 268
           DMPPGTGDA LT+AQ +PL+G VIVSTPQDLALID ++ ++M+QK+++P++G++ENMSYF
Sbjct: 241 DMPPGTGDAQLTMAQNVPLAGAVIVSTPQDLALIDARKGLAMFQKVDVPVLGIVENMSYF 300

Query: 269 LASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEI 328
           +A DTG +YD+FG+GGAR EAE++G+PFL  VP +M +R  SD G P+V    +   + I
Sbjct: 301 IAPDTGHRYDIFGHGGARDEAERLGVPFLGEVPIEMAIRESSDSGHPVVAGEPDGPHAAI 360

Query: 329 YQEISDR 335
           Y++I+ R
Sbjct: 361 YKDIAAR 367


>gi|39935043|ref|NP_947319.1| ATP/GTP-binding-like protein [Rhodopseudomonas palustris CGA009]
 gi|39648894|emb|CAE27415.1| MRP protein(ATP/GTP-binding protein) homolog [Rhodopseudomonas
           palustris CGA009]
          Length = 370

 Score =  335 bits (858), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 164/360 (45%), Positives = 229/360 (63%), Gaps = 27/360 (7%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + + QI+DSL  ++ P     + +   LSEI I    VY SI V    A   +S+RS+A+
Sbjct: 3   VTQQQILDSLAKVATP-RGVPLTQAGVLSEIAITDGKVYFSINVDAAEARAWESVRSDAE 61

Query: 64  QIIQNIPTVKNAVVTLTENKNP---PQQRNNL-----------------------NVKKF 97
             ++  P VK+A+V LT  + P   P QR  +                        V   
Sbjct: 62  AAVRGTPGVKSALVALTAERQPGSAPAQRPGVAPVSAHRPAGAPGAGLPKQAGIPGVGAI 121

Query: 98  VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFL 157
           +AVASGKGGVGKSTT +N+A  L++ G  V +LDAD+YGPS+P+L  I+ K ++ D + +
Sbjct: 122 IAVASGKGGVGKSTTALNLALGLRDLGLKVGLLDADIYGPSVPRLTGINEKPQLDDSRRM 181

Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217
            P   +G+ IMS+  LVDE   MIWRGPMV SAI  ML +V WG+LD L++DMPPGTGDA
Sbjct: 182 IPIARFGLSIMSIGFLVDEEAPMIWRGPMVMSAITQMLRDVDWGKLDVLVVDMPPGTGDA 241

Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277
            LT+AQ +PL G VIVSTPQDLALID +R ++M+ K+N+P+IG+IENMSYFL  + G + 
Sbjct: 242 QLTLAQTVPLKGAVIVSTPQDLALIDARRGLAMFTKVNVPVIGIIENMSYFLCPECGTRS 301

Query: 278 DLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           D+FG+GGAR EAE++G+PFL  +P  M++R  SD G P+V    N   + IY+ I+ +++
Sbjct: 302 DVFGHGGARHEAERLGVPFLGEIPLHMEIRATSDAGRPVVESEPNGPHATIYRAIAGKVR 361


>gi|192290578|ref|YP_001991183.1| multidrug-resistance related protein [Rhodopseudomonas palustris
           TIE-1]
 gi|192284327|gb|ACF00708.1| putative multidrug-resistance related protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 370

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 164/360 (45%), Positives = 229/360 (63%), Gaps = 27/360 (7%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + + QI+DSL  ++ P     + +   LSEI I    VY SI V    A   +S+RS+A+
Sbjct: 3   VTQQQILDSLAKVATP-RGVPLTKAGVLSEIAITDGKVYFSINVDAAEARAWESVRSDAE 61

Query: 64  QIIQNIPTVKNAVVTLTENKNP---PQQRNNL-----------------------NVKKF 97
             ++  P VK+A+V LT  + P   P QR  +                        V   
Sbjct: 62  AAVRGTPGVKSALVALTAERQPGSAPAQRPGVAPVSAHRPAGAPGAGLPKQAGIPGVGAI 121

Query: 98  VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFL 157
           +AVASGKGGVGKSTT +N+A  L++ G  V +LDAD+YGPS+P+L  I+ K ++ D + +
Sbjct: 122 IAVASGKGGVGKSTTALNLALGLRDLGLKVGLLDADIYGPSVPRLTGINEKPQLDDSRRM 181

Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217
            P   +G+ IMS+  LVDE   MIWRGPMV SAI  ML +V WG+LD L++DMPPGTGDA
Sbjct: 182 IPIARFGLSIMSIGFLVDEEAPMIWRGPMVMSAITQMLRDVDWGKLDVLVVDMPPGTGDA 241

Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277
            LT+AQ +PL G VIVSTPQDLALID +R ++M+ K+N+P+IG+IENMSYFL  + G + 
Sbjct: 242 QLTLAQTVPLKGAVIVSTPQDLALIDARRGLAMFTKVNVPVIGIIENMSYFLCPECGTRS 301

Query: 278 DLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           D+FG+GGAR EAE++G+PFL  +P  M++R  SD G P+V    N   + IY+ I+ +++
Sbjct: 302 DVFGHGGARHEAERLGVPFLGEIPLHMEIRATSDAGRPVVESEPNGPHATIYRAIAGKVR 361


>gi|114704586|ref|ZP_01437494.1| mrp-related protein [Fulvimarina pelagi HTCC2506]
 gi|114539371|gb|EAU42491.1| mrp-related protein [Fulvimarina pelagi HTCC2506]
          Length = 382

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 167/362 (46%), Positives = 230/362 (63%), Gaps = 27/362 (7%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M + LK  I   L  +  P    ++V    +S+IF+     + S+TVP   A + +  R 
Sbjct: 1   MAEELKATIKAILGDMKAPDGGGDVVSRGMVSDIFVADGKAFFSLTVPAKDADKFEPFRK 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNP----------PQQRNNL----------------NV 94
            A++ I+ +  +  A+V LT  K            P Q  +L                NV
Sbjct: 61  EAERYIEQLDGITKAMVALTAEKQAGEPASKPSPIPAQPKSLTAGRDAAPRATKPGIPNV 120

Query: 95  KKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGK-VEISD 153
            K VAVASGKGGVGKSTT VN+A   ++ G  V ILDAD+YGPSIP+LL +  K  + + 
Sbjct: 121 DKIVAVASGKGGVGKSTTAVNLALGFRDLGLKVGILDADIYGPSIPRLLDLKDKKPQSAG 180

Query: 154 KKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPG 213
            + LKP E YGIK+MS+  LV E  AM+WRGPMV SA+  M+  V WG LD L++DMPPG
Sbjct: 181 GRLLKPLEAYGIKVMSIGLLVAEETAMVWRGPMVVSALNQMMREVEWGHLDLLVVDMPPG 240

Query: 214 TGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDT 273
           TGDA LT+AQ++PL+G VIVSTPQDL+LID +R I+M+QK+++PI+G++ENMSYF+A DT
Sbjct: 241 TGDAQLTMAQQVPLAGAVIVSTPQDLSLIDARRGITMFQKVDVPILGIVENMSYFIAPDT 300

Query: 274 GKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           G +YD+FG+GGA  EA K  +PFL ++P DM +RV SD G+PIV    +   +EIY++++
Sbjct: 301 GARYDIFGHGGAEAEAAKREVPFLGAMPLDMHIRVRSDEGVPIVQAEPDGPHAEIYRDMA 360

Query: 334 DR 335
            R
Sbjct: 361 SR 362


>gi|118590287|ref|ZP_01547690.1| probable ATP-binding protein (Mrp protein-like) [Stappia aggregata
           IAM 12614]
 gi|118437259|gb|EAV43897.1| probable ATP-binding protein (Mrp protein-like) [Stappia aggregata
           IAM 12614]
          Length = 384

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 159/363 (43%), Positives = 238/363 (65%), Gaps = 27/363 (7%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M   +K+ +++ L+ +  P  + +IV +  +S++F+    V  SITVP   A +L+ LR 
Sbjct: 1   MTDTIKSAVMERLRQIKGPDLEGDIVSLGLVSDVFVSDGRVVFSITVPAERAQELEPLRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENK-------NPPQQ---------RNNL-----------N 93
            A+++++ +  V+  +V LT  +        PPQ          R +             
Sbjct: 61  AAEKVVKEVDGVETVMVALTAERAAGSARNTPPQSAPKPAPQQPRRSAEEQAPAKPGVPG 120

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISD 153
           +K  VAVASGKGGVGKSTT  N+A A+   GK V +LDAD+YGPS+P+L  +SG+ E   
Sbjct: 121 IKHIVAVASGKGGVGKSTTTANLALAMAALGKRVGVLDADIYGPSVPRLFNVSGRPEALS 180

Query: 154 KKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPG 213
            + LKP E YGIK+MSM  +V+E   MIWRGPMV SA+  ML  V WG+LD L++DMPPG
Sbjct: 181 GRMLKPLEGYGIKVMSMGFMVEEETPMIWRGPMVISALTQMLREVAWGELDVLVVDMPPG 240

Query: 214 TGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDT 273
           TGDA LT+AQ++PL+G VIVSTPQDLALID ++ ++M++++++P++G++ENMSYF+  D 
Sbjct: 241 TGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFKRVDVPVLGIVENMSYFMCPDC 300

Query: 274 GKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           G ++D+FG+GGAR EA+++ +PFL  VP  M +R  SD G P+VV +   A + IY++I+
Sbjct: 301 GGRHDIFGHGGARAEADRLDVPFLGEVPLTMKIRETSDAGTPVVVSDPEGAVAGIYKDIA 360

Query: 334 DRI 336
            ++
Sbjct: 361 AKV 363


>gi|240850506|ref|YP_002971905.1| Mrp protein [Bartonella grahamii as4aup]
 gi|240267629|gb|ACS51217.1| Mrp protein [Bartonella grahamii as4aup]
          Length = 353

 Score =  333 bits (853), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 162/353 (45%), Positives = 243/353 (68%), Gaps = 13/353 (3%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+ I    + + L+ +  P  +++IV +  LSEI I    V+ SITVP     + +SLR 
Sbjct: 1   MDSITSEAVRNVLRKIKGPDLESDIVSLGLLSEILIADGKVFFSITVPDGGVQEWESLRR 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKN---PPQQRNNL--------NVKKFVAVASGKGGVGK 109
           +A++++  +  V++ VVTLT  K     P++R NL         V+  +AVASGKGGVGK
Sbjct: 61  SAEKMVCALEGVESVVVTLTAEKTTKAAPRRRANLLPIKMPIEGVRHVIAVASGKGGVGK 120

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLK-ISGKVEISDKKFLKPKENYGIKIM 168
           ST  +NIA AL++ G    ++DAD+YGPS+P+L   ++ K ++  +K ++P E +G+K+M
Sbjct: 121 STMAINIALALQDSGFKTGVMDADIYGPSLPRLTGLVNQKPQLIGEKKIQPLEKFGLKLM 180

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           SM  LV+E   ++WRGPMV +A+  +L +V+WG LD L++DMPPGTGDA LT+AQ++ L+
Sbjct: 181 SMGFLVEEEKPVVWRGPMVMAAVTQLLRDVLWGPLDVLVVDMPPGTGDAQLTLAQQVQLT 240

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFE 288
           G ++VSTPQDLAL+D ++AI M+ K+N+PI+G+IENMSYF+A DTGK+YD+FG GGAR E
Sbjct: 241 GALVVSTPQDLALVDARKAIEMFMKVNVPILGIIENMSYFIAPDTGKRYDIFGYGGARAE 300

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ-QFF 340
           AE+  +PFL  +P D  +R  SD GIPI V   +   +++Y++I D+I+ Q F
Sbjct: 301 AERREVPFLAEIPLDAALRFSSDEGIPIFVAKPSKEHTKLYRKIVDQIKNQLF 353


>gi|114706709|ref|ZP_01439609.1| hypothetical protein FP2506_17874 [Fulvimarina pelagi HTCC2506]
 gi|114537657|gb|EAU40781.1| hypothetical protein FP2506_17874 [Fulvimarina pelagi HTCC2506]
          Length = 393

 Score =  332 bits (852), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 166/374 (44%), Positives = 231/374 (61%), Gaps = 39/374 (10%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I K  I   L+ +  P   +NIV++  +SEIF     V+ S+TVP   A +L+ LR  A+
Sbjct: 3   IDKETIRQQLRRVKGPDLTSNIVDLGLVSEIFANDGKVFFSLTVPGDRAEELEPLRVAAE 62

Query: 64  QIIQNIPTVKNAVVTLTENKN--------------------------PPQQRNNL----- 92
           +   ++  V+ AVV LT                              PP   N       
Sbjct: 63  KAAMSVEGVEKAVVALTAEAKGSGSASANTPAQPVRPAPTRDQASAVPPPMANRAQAATP 122

Query: 93  --------NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK 144
                    +   +AVASGKGGVGKSTT VN+A  L   G+ V ILDAD+YGPS+P+LL 
Sbjct: 123 APEKAEVPGIGAIIAVASGKGGVGKSTTSVNLALGLAANGQRVGILDADIYGPSMPRLLH 182

Query: 145 ISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLD 204
           ISG+ +    + ++P E Y +K+MSM  LVDE   MIWRGPMV SAI  ML  V WG+LD
Sbjct: 183 ISGRPQPVSGRIIRPMEAYDLKVMSMGFLVDEETPMIWRGPMVISAITQMLREVEWGELD 242

Query: 205 FLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIEN 264
            L++DMPPGTGDA LT+AQ +PL+G VIVSTPQDLALID ++ ++M++K+++PI+G++EN
Sbjct: 243 VLVVDMPPGTGDAQLTMAQNVPLAGAVIVSTPQDLALIDARKGLAMFRKVDVPILGIVEN 302

Query: 265 MSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSA 324
           MSYFL  D G ++D+FG+GGA+ EAE+IG+PFL  +P D+ +R  SD G P+VV +   +
Sbjct: 303 MSYFLCPDCGGRHDIFGHGGAKREAERIGVPFLGEIPLDIRIRETSDGGTPVVVADAGGS 362

Query: 325 TSEIYQEISDRIQQ 338
            + IY++I+  + Q
Sbjct: 363 HAAIYRDIASTVWQ 376


>gi|254473427|ref|ZP_05086824.1| mrp protein [Pseudovibrio sp. JE062]
 gi|211957543|gb|EEA92746.1| mrp protein [Pseudovibrio sp. JE062]
          Length = 406

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 158/358 (44%), Positives = 237/358 (66%), Gaps = 20/358 (5%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + + ++++ LK +  P  K+NIV+   ++++F+    V  SI VP   A +L+ LR 
Sbjct: 30  MAGLTQERVLEVLKQVKSPDGKSNIVDQDLVADLFVADGRVVFSIKVPAERATELEGLRQ 89

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQ--------------------QRNNLNVKKFVAV 100
            A++++  +P  +  +V LT  K P                      +++   VK  +AV
Sbjct: 90  AAEKVVGVLPGAETVLVALTAEKQPGSPSTPPPAARKAPPQAAPLPAKQDVPGVKHIIAV 149

Query: 101 ASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPK 160
           ASGKGGVGKSTT  N+A AL   G  V +LDAD+YGPSIPKL+  SG+ E+++ + +KP 
Sbjct: 150 ASGKGGVGKSTTSANLALALSAMGLKVGLLDADIYGPSIPKLMGASGQPEVTENRIMKPL 209

Query: 161 ENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLT 220
           E +GIK+MS+  LV+E+ AMIWRGPMV SA+  ML  V WG+LD L++D+PPGTGD  LT
Sbjct: 210 EAHGIKLMSIGFLVEEDTAMIWRGPMVVSALNQMLREVDWGELDALIVDLPPGTGDVQLT 269

Query: 221 IAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLF 280
           +AQK+PL+G ++VSTPQDLAL+D +R I+M++K+ IP++G++ENMS+F+  D G  +++F
Sbjct: 270 MAQKVPLTGALVVSTPQDLALLDARRGIAMFEKVAIPVLGVVENMSHFICPDCGGTHEIF 329

Query: 281 GNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           G+GGA+ EAEK+ +PFL  VP  M++R  SD G+PI V N +S  ++ Y  I+  + Q
Sbjct: 330 GHGGAKAEAEKMKVPFLGEVPLTMEIRQQSDTGVPITVSNPDSPIAKAYGVIAAGLWQ 387


>gi|316934852|ref|YP_004109834.1| ATPase-like, ParA/MinD [Rhodopseudomonas palustris DX-1]
 gi|315602566|gb|ADU45101.1| ATPase-like, ParA/MinD [Rhodopseudomonas palustris DX-1]
          Length = 371

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 164/368 (44%), Positives = 227/368 (61%), Gaps = 32/368 (8%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
            + + QI+DSL  ++ P     + +   LSEI +    VY SI V    A   +S+RS+A
Sbjct: 2   SVTQQQILDSLAKVTTP-RGVPLTKAGVLSEIAVTDGKVYFSINVDAAEARAWESVRSDA 60

Query: 63  QQIIQNIPTVKNAVVTLTENKNP---------------------------PQQRNNLNVK 95
           +  ++  P V +A+V LT  + P                           P+Q     V 
Sbjct: 61  EAAVRATPGVASALVALTAERKPGSAPAPQRPGVAPVSAHRPAGAPGAGLPKQAEIPGVG 120

Query: 96  KFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKK 155
             +AVASGKGGVGKSTT +N+A  L++ G  V +LDAD+YGPS+P+L  I  K ++ D +
Sbjct: 121 AIIAVASGKGGVGKSTTALNLALGLRDLGLKVGLLDADIYGPSVPRLTGIHEKPQLDDSR 180

Query: 156 FLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTG 215
            + P   +G+ IMS+  LVDE   MIWRGPMV SAI  ML +V WG+LD L++DMPPGTG
Sbjct: 181 RMIPIARFGLSIMSIGFLVDEEAPMIWRGPMVMSAITQMLRDVDWGKLDVLVVDMPPGTG 240

Query: 216 DAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGK 275
           DA LT+AQ +PL G VIVSTPQDLALID +R ++M+ K+N+P+IG+IENMSYFL  + G 
Sbjct: 241 DAQLTLAQTVPLKGAVIVSTPQDLALIDARRGLAMFTKVNVPVIGVIENMSYFLCPECGT 300

Query: 276 KYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI--- 332
           + D+FG+GGAR EAE++G+PFL  +P  M++R  SD G P+V    N   + IY+ I   
Sbjct: 301 RSDIFGHGGARHEAERLGVPFLGEIPLHMEIRATSDAGRPVVETEPNGPHATIYRAIAAK 360

Query: 333 -SDRIQQF 339
            SDR++  
Sbjct: 361 VSDRLRSL 368


>gi|49475951|ref|YP_033992.1| mrp protein [Bartonella henselae str. Houston-1]
 gi|49238759|emb|CAF28020.1| mrp protein [Bartonella henselae str. Houston-1]
          Length = 364

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 163/364 (44%), Positives = 238/364 (65%), Gaps = 24/364 (6%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  I  + I ++L  +  P  +++IV +  LSEI +VH  V+ SITVP     + +SLR 
Sbjct: 1   MVSITSDAIRNALHKVKGPNFESDIVSLGLLSEILVVHGKVFFSITVPDGRVQEWESLRR 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNP--------------PQQRNNL--------NVKKFV 98
           + ++++  +  V+   VTLT  + P              P++R N          V+  V
Sbjct: 61  SVEEVVSALDGVEAVFVTLTTERRPEMSSQLQRDEVFFAPKRRANRLLEKMPIEGVRHVV 120

Query: 99  AVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK-ISGKVEISDKKFL 157
           AVASGKGGVGKST  +NIA AL++ G    ++DAD+YGPS+P+L   ++ K +  D K L
Sbjct: 121 AVASGKGGVGKSTMAINIALALQDSGFKTGLMDADIYGPSLPRLTGLVNQKPQYIDGKKL 180

Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217
            P E +G+K+MSM  LV+E   ++WRGPMV +A+  +L +V+WG LD L++DMPPGTGDA
Sbjct: 181 HPLEKFGLKLMSMGFLVEEENPVVWRGPMVMAAVTQLLRDVLWGPLDVLVVDMPPGTGDA 240

Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277
            LT+AQ++ L+G +IVSTPQDLAL+D ++A+ M+ K+N+PI+G+IENMSYF+A DTGK+Y
Sbjct: 241 QLTLAQQVQLTGALIVSTPQDLALVDARKAMEMFMKVNVPILGLIENMSYFIAPDTGKRY 300

Query: 278 DLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           D+FG GG R EA + G+PFL  VP D  +R  SD GIPI V   +   +++Y+ I  +I+
Sbjct: 301 DIFGYGGTRAEARRRGVPFLAEVPLDAALRSSSDDGIPIFVAKPDEEHTKLYRSIVGQIK 360

Query: 338 -QFF 340
            +FF
Sbjct: 361 NKFF 364


>gi|319408951|emb|CBI82608.1| ATP/GTP-binding protein [Bartonella schoenbuchensis R1]
          Length = 364

 Score =  326 bits (836), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 164/363 (45%), Positives = 237/363 (65%), Gaps = 23/363 (6%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + +  I + L+ +  P  +++IV +  LSEIFI  + V+ SITVP   A +L+ LR 
Sbjct: 1   MVPVTREAIREELRKVKGPNFESDIVSLGLLSEIFITGSKVFFSITVPRERAQELEPLRR 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPP-------------QQR--NNL-------NVKKFV 98
            A++++  +  V+  VVTLTE K  P             Q+R  N L       NV+  +
Sbjct: 61  TAEKVVCAMDGVEAVVVTLTEEKQSPTFFQTDKNAAFSMQKRKANALPMKMPIENVRHII 120

Query: 99  AVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK-ISGKVEISDKKFL 157
           AVASGKGGVGKST  +NIA AL++ G    ++DAD+YGPS+P+L   ++ K ++ D K +
Sbjct: 121 AVASGKGGVGKSTMAINIALALQDAGFKTGLMDADIYGPSLPRLTGLVNQKPQLVDGKKI 180

Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217
           +P E +G+K+MSM  LV+E   ++WRGPMV +A+  +L +V+WG LD L++DMPPGTGDA
Sbjct: 181 QPLEKFGLKLMSMGFLVEEEKPIVWRGPMVMAAVTQLLRDVLWGPLDVLVVDMPPGTGDA 240

Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277
            LT+AQ++PL+G +IVSTPQDLAL+D ++A+ M+ K+ +PI+G+IENMSYF+A DTGK+Y
Sbjct: 241 QLTLAQQVPLTGALIVSTPQDLALVDARKAVEMFTKVKVPILGLIENMSYFIAPDTGKRY 300

Query: 278 DLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           D+FG+G  R EAE   I FL  VP D   R  SD G+PI V       + +Y+ I  +I+
Sbjct: 301 DIFGHGTVRAEAESRDISFLAEVPLDATFRFSSDGGVPIFVAEPEGRHANLYRTIVHQIK 360

Query: 338 QFF 340
             F
Sbjct: 361 GRF 363


>gi|121602916|ref|YP_989320.1| hypothetical protein BARBAKC583_1045 [Bartonella bacilliformis
           KC583]
 gi|120615093|gb|ABM45694.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 364

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 164/363 (45%), Positives = 234/363 (64%), Gaps = 23/363 (6%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+ I    I + L+ +  P   ++IV +  LS+IFI    V+ SITVP   A +L+SLR 
Sbjct: 1   MSSITAEAIREELRKIKGPNFDSDIVSLGLLSDIFIADGKVFFSITVPGERAQELESLRR 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENK---NPPQQRNNLN-------------------VKKFV 98
           +A++ +  +  VK  VVTLT  K    P Q   N +                   V+  +
Sbjct: 61  SAEEAVYALGGVKTVVVTLTAEKKLETPFQAHKNESLSKQKRKMGALPVKMPIEGVRHVI 120

Query: 99  AVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK-ISGKVEISDKKFL 157
           AVASGKGGVGKSTT +NIA AL+  G    ++DAD+YGPS+P+L   +  K+++S+ K  
Sbjct: 121 AVASGKGGVGKSTTAINIALALQASGFKTGLMDADIYGPSLPRLTGLVDQKIQLSNDKKF 180

Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217
           +P + +G+K+MSM  LVDE   ++WRGPMV +AI   L +V WG LD L++DMPPGTGD 
Sbjct: 181 QPLQKFGLKLMSMGFLVDETKPVVWRGPMVMAAITQFLRDVSWGPLDILVVDMPPGTGDV 240

Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277
            LT+AQ++ L+G +IVSTPQDL+L+D ++AI M+ K+ +P++G+IENMSYF A DTGK+Y
Sbjct: 241 QLTLAQQVQLAGALIVSTPQDLSLVDARKAIEMFVKIGVPVLGLIENMSYFTAPDTGKRY 300

Query: 278 DLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           D+FG+GGAR EAE   IPFL  +P D  +R  SD G+PI V +     +EIY+ I ++++
Sbjct: 301 DIFGHGGARAEAESRRIPFLAEIPLDAVLRSSSDEGVPIFVADPEGEHAEIYRVIINQMK 360

Query: 338 QFF 340
             F
Sbjct: 361 DRF 363


>gi|312115718|ref|YP_004013314.1| ATPase-like, ParA/MinD [Rhodomicrobium vannielii ATCC 17100]
 gi|311220847|gb|ADP72215.1| ATPase-like, ParA/MinD [Rhodomicrobium vannielii ATCC 17100]
          Length = 363

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 158/340 (46%), Positives = 226/340 (66%), Gaps = 10/340 (2%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           K  ++ +LK +  PG   ++V    LSEI IV   VY +++VP   A   +++R  A++ 
Sbjct: 7   KETVLAALKSVRTPG-GVDLVSAGILSEIAIVKGKVYFALSVPPRDARAYEAVRREAEET 65

Query: 66  IQNIPTVKNAVVTLTENKNPPQQ---------RNNLNVKKFVAVASGKGGVGKSTTVVNI 116
           ++ +P V  A + LT +    +          R    V+  +AVASGKGGVGKSTT VNI
Sbjct: 66  VRALPGVAGATLVLTADAKEGEAAKQADAAIGRGISGVRHIIAVASGKGGVGKSTTAVNI 125

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           A  L   G  V +LDADVYGPS+P+LL IS K ++     L P E +G+K MS+  LV+E
Sbjct: 126 ALGLLANGLKVGLLDADVYGPSVPRLLAISEKPDLIGDNILAPIEKFGLKTMSIGFLVEE 185

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              MIWRGPMV SA+  ML++V WG+LD L++DMPPGTGDA LT+AQK  L+G V+VSTP
Sbjct: 186 ETPMIWRGPMVISALTQMLNDVAWGELDVLVVDMPPGTGDAQLTMAQKASLAGAVVVSTP 245

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QDLALID ++ + M++++N+P++G++ENMSYF+    G++ D+FG+GGA+ EA K+G+PF
Sbjct: 246 QDLALIDARKGLEMFKRVNVPVLGIVENMSYFICPKCGEQSDIFGHGGAKNEARKLGVPF 305

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L ++P  M VR  SD G PIVV +  S  +++Y+EI+  I
Sbjct: 306 LGALPLHMAVRETSDAGRPIVVSDPGSMHAKLYREIAASI 345


>gi|256158751|ref|ZP_05456621.1| nucleotide-binding protein-like protein [Brucella ceti M490/95/1]
 gi|265997248|ref|ZP_06109805.1| ATP-binding protein [Brucella ceti M490/95/1]
 gi|262551716|gb|EEZ07706.1| ATP-binding protein [Brucella ceti M490/95/1]
          Length = 289

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 145/264 (54%), Positives = 199/264 (75%), Gaps = 5/264 (1%)

Query: 80  TENKNPPQQRNNL-----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV 134
           +++++PPQ R         V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+
Sbjct: 8   SQHRHPPQPRPAAKPGVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADI 67

Query: 135 YGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHM 194
           YGPS+P+LL +SG+ E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  M
Sbjct: 68  YGPSMPRLLGLSGRPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQM 127

Query: 195 LHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKM 254
           L  V WG+LD L++DMPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+
Sbjct: 128 LREVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKV 187

Query: 255 NIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGI 314
           ++P++G++ENMSYF+A DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G 
Sbjct: 188 DVPLLGIVENMSYFIAPDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGT 247

Query: 315 PIVVHNMNSATSEIYQEISDRIQQ 338
           PI V   +S  ++IY++I+ ++ +
Sbjct: 248 PITVKEPDSEHAKIYRDIARKVWE 271


>gi|49474528|ref|YP_032570.1| mrp protein [Bartonella quintana str. Toulouse]
 gi|49240032|emb|CAF26451.1| mrp protein [Bartonella quintana str. Toulouse]
          Length = 361

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 159/361 (44%), Positives = 240/361 (66%), Gaps = 21/361 (5%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+ I +  I ++L+ +     +++IV +  LSEI I H  V+ SITVP     + +SLR 
Sbjct: 1   MDSITREAIRNALRKVKGLNVESDIVSLGLLSEILIAHGKVFFSITVPDGRVQEWESLRR 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENK------------NPPQQRNNL-------NVKKFVAVA 101
            A++++  +  V++ VVTLT  K               ++ N L        V+  VAVA
Sbjct: 61  AAEKVVSAMEGVESVVVTLTAEKKMKVASQAHRDVGSKRRANGLPVKMPIEGVRHVVAVA 120

Query: 102 SGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK-ISGKVEISDKKFLKPK 160
           SGKGGVGKST  +NIA AL++ G    ++DADVYGPS+P+L   ++ K ++   K L+P 
Sbjct: 121 SGKGGVGKSTMAINIALALQDSGFKTGLMDADVYGPSLPRLTGLVNQKAQLIGGKKLQPL 180

Query: 161 ENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLT 220
           E +G+K+MSM  LV+E   ++WRGPMV +A+  +L +V+WG LD L++DMPPGTGDA LT
Sbjct: 181 EKFGLKLMSMGFLVEEEKPVVWRGPMVMAAVTQLLRDVLWGPLDVLVVDMPPGTGDAQLT 240

Query: 221 IAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLF 280
           +AQ++ L+G +++STPQDLAL+D ++AI M+ K+++PI+G+IENMSYF+A DTGK+YD+F
Sbjct: 241 LAQQVQLTGALVISTPQDLALVDARKAIEMFMKVDVPILGLIENMSYFIAPDTGKRYDIF 300

Query: 281 GNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ-QF 339
           G GGAR EAE+  +PFL  VP D  +R  SD G+P++V       +++ + I D+++ +F
Sbjct: 301 GYGGARAEAERRALPFLAEVPLDAALRSSSDDGVPLLVAKPGGEHAKLCRAIIDQVKNKF 360

Query: 340 F 340
           F
Sbjct: 361 F 361


>gi|294850875|ref|ZP_06791561.1| ATP-binding protein [Brucella sp. NVSL 07-0026]
 gi|294821763|gb|EFG38749.1| ATP-binding protein [Brucella sp. NVSL 07-0026]
          Length = 285

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 145/264 (54%), Positives = 199/264 (75%), Gaps = 5/264 (1%)

Query: 80  TENKNPPQQRNNL-----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV 134
           +++++PPQ R         V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+
Sbjct: 4   SQHRHPPQPRPAAKPGVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADI 63

Query: 135 YGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHM 194
           YGPS+P+LL +SG+ E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  M
Sbjct: 64  YGPSMPRLLGLSGRPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQM 123

Query: 195 LHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKM 254
           L  V WG+LD L++DMPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+
Sbjct: 124 LREVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKV 183

Query: 255 NIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGI 314
           ++P++G++ENMSYF+A DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G 
Sbjct: 184 DVPLLGIVENMSYFIAPDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGT 243

Query: 315 PIVVHNMNSATSEIYQEISDRIQQ 338
           PI V   +S  ++IY++I+ ++ +
Sbjct: 244 PITVKEPDSEHAKIYRDIARKVWE 267


>gi|254703625|ref|ZP_05165453.1| nucleotide-binding protein-like protein [Brucella suis bv. 3 str.
           686]
          Length = 282

 Score =  323 bits (827), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 145/264 (54%), Positives = 199/264 (75%), Gaps = 5/264 (1%)

Query: 80  TENKNPPQQRNNL-----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV 134
           +++++PPQ R         V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+
Sbjct: 1   SQHRHPPQPRPAAKPGVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADI 60

Query: 135 YGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHM 194
           YGPS+P+LL +SG+ E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  M
Sbjct: 61  YGPSMPRLLGLSGRPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQM 120

Query: 195 LHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKM 254
           L  V WG+LD L++DMPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+
Sbjct: 121 LREVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKV 180

Query: 255 NIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGI 314
           ++P++G++ENMSYF+A DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G 
Sbjct: 181 DVPLLGIVENMSYFIAPDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGT 240

Query: 315 PIVVHNMNSATSEIYQEISDRIQQ 338
           PI V   +S  ++IY++I+ ++ +
Sbjct: 241 PITVKEPDSEHAKIYRDIARKVWE 264


>gi|209885658|ref|YP_002289515.1| MRP ATP/GTP-binding protein [Oligotropha carboxidovorans OM5]
 gi|209873854|gb|ACI93650.1| MRP ATP/GTP-binding protein [Oligotropha carboxidovorans OM5]
          Length = 364

 Score =  322 bits (826), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 154/353 (43%), Positives = 228/353 (64%), Gaps = 22/353 (6%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           K+ +++SL  +  PG    +   + LSEI      V+ S+TV    A   + +R+ A++ 
Sbjct: 3   KDDVLNSLAKIQTPG-GVPLTLAKVLSEITATDGKVFFSMTVDAAEARAWEGIRAQAEEA 61

Query: 66  IQNIPTVKNAVVTLTENKNPP---------------------QQRNNLNVKKFVAVASGK 104
           ++ IP VK A+V LT  + P                      +Q+    +K  VAVASGK
Sbjct: 62  VRAIPGVKTALVALTAERQPGSPSGIKPSASHRHGAGDSPMGKQKAIPGIKAIVAVASGK 121

Query: 105 GGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYG 164
           GGVGKSTT +NIA  L++ G  + +LDAD+YGPS+P+L  +    +++D K + P + +G
Sbjct: 122 GGVGKSTTAINIALGLRDLGFKIGLLDADIYGPSVPRLTGVKEMPKLTDDKKMIPLQRFG 181

Query: 165 IKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQK 224
           + +MS+  LV E  AMIWRGPM+QSA+  ML +V WG+LD L++DMPPGTGD  L++AQ 
Sbjct: 182 LSLMSIGFLVQEETAMIWRGPMIQSAVKQMLQDVAWGELDVLVVDMPPGTGDVQLSLAQH 241

Query: 225 IPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGG 284
           +PL+G VIVSTPQDLALID +R I+M++K+++P +G++ENMSYFL      + D+FG+GG
Sbjct: 242 VPLAGAVIVSTPQDLALIDARRGITMFKKVDVPTLGIVENMSYFLCPHCNTRSDIFGHGG 301

Query: 285 ARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           AR EAE++G+PFL  +P  M +R  SD G P+V  +   A +EIY+ I+D+I+
Sbjct: 302 ARHEAERLGVPFLGEIPLHMSIREGSDAGQPVVETDPTGAHAEIYRAIADKIK 354


>gi|256112561|ref|ZP_05453482.1| hypothetical protein Bmelb3E_07760 [Brucella melitensis bv. 3 str.
           Ether]
 gi|265994003|ref|ZP_06106560.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262764984|gb|EEZ10905.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 288

 Score =  322 bits (825), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 144/264 (54%), Positives = 198/264 (75%), Gaps = 5/264 (1%)

Query: 80  TENKNPPQQRNNL-----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV 134
           +++++PPQ R         V   +AVASGKGGVGKSTT VN+A  L   G    ILDAD+
Sbjct: 7   SQHRHPPQPRPAAKPGVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKAGILDADI 66

Query: 135 YGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHM 194
           YGPS+P+LL +SG+ E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  M
Sbjct: 67  YGPSMPRLLGLSGRPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQM 126

Query: 195 LHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKM 254
           L  V WG+LD L++DMPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+
Sbjct: 127 LREVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKV 186

Query: 255 NIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGI 314
           ++P++G++ENMSYF+A DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G 
Sbjct: 187 DVPLLGIVENMSYFIAPDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGT 246

Query: 315 PIVVHNMNSATSEIYQEISDRIQQ 338
           PI V   +S  ++IY++I+ ++ +
Sbjct: 247 PITVKEPDSEHAKIYRDIARKVWE 270


>gi|256045847|ref|ZP_05448722.1| hypothetical protein Bmelb1R_15174 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265992262|ref|ZP_06104819.1| ATP-binding protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263003328|gb|EEZ15621.1| ATP-binding protein [Brucella melitensis bv. 1 str. Rev.1]
          Length = 293

 Score =  322 bits (825), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 144/264 (54%), Positives = 198/264 (75%), Gaps = 5/264 (1%)

Query: 80  TENKNPPQQRNNL-----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV 134
           +++++PPQ R         V   +AVASGKGGVGKSTT VN+A  L   G    ILDAD+
Sbjct: 12  SQHRHPPQPRPAAKPGVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKAGILDADI 71

Query: 135 YGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHM 194
           YGPS+P+LL +SG+ E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  M
Sbjct: 72  YGPSMPRLLGLSGRPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQM 131

Query: 195 LHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKM 254
           L  V WG+LD L++DMPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+
Sbjct: 132 LREVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKV 191

Query: 255 NIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGI 314
           ++P++G++ENMSYF+A DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G 
Sbjct: 192 DVPLLGIVENMSYFIAPDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGT 251

Query: 315 PIVVHNMNSATSEIYQEISDRIQQ 338
           PI V   +S  ++IY++I+ ++ +
Sbjct: 252 PITVKEPDSEHAKIYRDIARKVWE 275


>gi|163868922|ref|YP_001610149.1| ATP/GTP-binding protein [Bartonella tribocorum CIP 105476]
 gi|161018596|emb|CAK02154.1| ATP/GTP-binding protein [Bartonella tribocorum CIP 105476]
          Length = 353

 Score =  322 bits (825), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 159/349 (45%), Positives = 237/349 (67%), Gaps = 12/349 (3%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+ I    + + L+ +  P  +++IV +  LSEI I +  V+ SITVP     + +SLR 
Sbjct: 1   MDLITSEAVRNVLRKIKGPDLESDIVSLGLLSEILIANGKVFFSITVPDGRVQEWESLRR 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNP---PQQRNNL--------NVKKFVAVASGKGGVGK 109
           +A++++  +  V++ VVTLT  K     P++R +L         V+  +AVASGKGGVGK
Sbjct: 61  SAEELVCALKGVESVVVTLTAEKTTKGVPRRRAHLLPVKMPIEGVRHVIAVASGKGGVGK 120

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLK-ISGKVEISDKKFLKPKENYGIKIM 168
           ST  +NIA AL++ G    ++DAD+YGPS+P+L   ++ K ++   K ++P E +G+K+M
Sbjct: 121 STMAINIALALQDAGFKTGVMDADIYGPSLPRLTGLVNQKPQLMGGKKIQPLEKFGLKLM 180

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           SM  LV+E   ++WRGPMV +AI  +L +VVW  LD L++DMPPGTGDA LT+AQ++ L+
Sbjct: 181 SMGFLVEEEKPVVWRGPMVMAAITQLLRDVVWAPLDVLVVDMPPGTGDAQLTLAQQVQLT 240

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFE 288
           G ++VSTPQDLAL+D ++AI M+ K+N+PI+G+IENMSYF+A DTGK+YD+FG+GGAR E
Sbjct: 241 GALVVSTPQDLALVDARKAIEMFMKVNVPILGLIENMSYFIAPDTGKRYDIFGHGGARGE 300

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           AE+  + FL  +P D  +R  SD G PI V   N   ++ Y+ I D+I+
Sbjct: 301 AERRKVLFLAEIPLDAALRFSSDEGNPIFVVQPNGEHAQRYRTIVDQIK 349


>gi|256254143|ref|ZP_05459679.1| nucleotide-binding protein-like protein [Brucella ceti B1/94]
          Length = 281

 Score =  322 bits (824), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 145/263 (55%), Positives = 198/263 (75%), Gaps = 5/263 (1%)

Query: 81  ENKNPPQQRNNL-----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVY 135
           ++++PPQ R         V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+Y
Sbjct: 1   QHRHPPQPRPAAKPGVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADIY 60

Query: 136 GPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHML 195
           GPS+P+LL +SG+ E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML
Sbjct: 61  GPSMPRLLGLSGRPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQML 120

Query: 196 HNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMN 255
             V WG+LD L++DMPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K++
Sbjct: 121 REVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVD 180

Query: 256 IPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIP 315
           +P++G++ENMSYF+A DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G P
Sbjct: 181 VPLLGIVENMSYFIAPDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTP 240

Query: 316 IVVHNMNSATSEIYQEISDRIQQ 338
           I V   +S  ++IY++I+ ++ +
Sbjct: 241 ITVKEPDSEHAKIYRDIARKVWE 263


>gi|254700871|ref|ZP_05162699.1| nucleotide-binding protein-like protein [Brucella suis bv. 5 str.
           513]
 gi|254709214|ref|ZP_05171025.1| nucleotide-binding protein-like protein [Brucella pinnipedialis
           B2/94]
 gi|254718277|ref|ZP_05180088.1| nucleotide-binding protein-like protein [Brucella sp. 83/13]
          Length = 280

 Score =  321 bits (823), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 197/262 (75%), Gaps = 5/262 (1%)

Query: 82  NKNPPQQRNNL-----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYG 136
           +++PPQ R         V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YG
Sbjct: 1   HRHPPQPRPAAKPGVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADIYG 60

Query: 137 PSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLH 196
           PS+P+LL +SG+ E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML 
Sbjct: 61  PSMPRLLGLSGRPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLR 120

Query: 197 NVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNI 256
            V WG+LD L++DMPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++
Sbjct: 121 EVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDV 180

Query: 257 PIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPI 316
           P++G++ENMSYF+A DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI
Sbjct: 181 PLLGIVENMSYFIAPDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPI 240

Query: 317 VVHNMNSATSEIYQEISDRIQQ 338
            V   +S  ++IY++I+ ++ +
Sbjct: 241 TVKEPDSEHAKIYRDIARKVWE 262


>gi|158424987|ref|YP_001526279.1| putative multidrug-resistance related protein [Azorhizobium
           caulinodans ORS 571]
 gi|158331876|dbj|BAF89361.1| putative multidrug-resistance related protein [Azorhizobium
           caulinodans ORS 571]
          Length = 407

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 154/361 (42%), Positives = 232/361 (64%), Gaps = 24/361 (6%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  I ++ +  +L  +  P E   +     LS I +    VYLS+TV    A   +S+R+
Sbjct: 30  MADITEDMVRSALGSVRTP-EGVALAVSPALSGIVVTSGKVYLSVTVDAAQARAWESVRA 88

Query: 61  NAQQIIQNIPTVKNAVVTLTENK--------------------NPPQQRNNL---NVKKF 97
            A+  ++ IP V +A+V LT  +                    + P +   +    V   
Sbjct: 89  EAEDAVRTIPGVASALVALTAERKAGARPAAPPPPAVGGHGHSHGPAKGGAIEVPGVASI 148

Query: 98  VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFL 157
           +AVASGKGGVGKST  +N+A AL++ G  V +LDAD+YGPS+P+L  + GK E+ D + +
Sbjct: 149 IAVASGKGGVGKSTVSINLALALRDLGLKVGLLDADIYGPSVPRLAGVHGKPEVEDGRMM 208

Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217
            P +N+G+++MS+  +V+E+  MIWRGPMV SAI  ML  V WG LD L++DMPPGTGDA
Sbjct: 209 LPMDNFGLQLMSIGFMVEEDTPMIWRGPMVMSAISQMLREVKWGPLDVLVVDMPPGTGDA 268

Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277
            LT+AQ++ L+G VIVSTPQDLALID +R I+M++++N+PI+G++ENM+ F+    G + 
Sbjct: 269 QLTMAQQVGLAGAVIVSTPQDLALIDARRGIAMFKRVNVPILGIVENMATFICPHCGGRS 328

Query: 278 DLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           D+FG+GGAR EAEK+G+PFL  +P  M +R +SD G+PI+V + +S  +E Y+ I+ +++
Sbjct: 329 DIFGHGGARAEAEKLGVPFLGEIPLHMRIREMSDAGVPILVSDPDSPQAEGYRAIAQQVR 388

Query: 338 Q 338
            
Sbjct: 389 S 389


>gi|256258622|ref|ZP_05464158.1| mrp-related protein [Brucella abortus bv. 9 str. C68]
 gi|260884936|ref|ZP_05896550.1| ATP-binding protein [Brucella abortus bv. 9 str. C68]
 gi|260874464|gb|EEX81533.1| ATP-binding protein [Brucella abortus bv. 9 str. C68]
          Length = 283

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 197/264 (74%), Gaps = 5/264 (1%)

Query: 80  TENKNPPQQRNNL-----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV 134
           +++++PPQ R         V   +AVASGKGGVGKSTT VN+A  L   G    ILDAD+
Sbjct: 2   SQHRHPPQPRPAAKPGVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKAGILDADI 61

Query: 135 YGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHM 194
           YGPS+P+LL +SG+ E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  M
Sbjct: 62  YGPSMPRLLGLSGRPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQM 121

Query: 195 LHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKM 254
           L  V WG+LD L++DMPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+
Sbjct: 122 LREVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKV 181

Query: 255 NIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGI 314
           ++P++G++ENMSYF+  DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G 
Sbjct: 182 DVPLLGIVENMSYFITPDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGT 241

Query: 315 PIVVHNMNSATSEIYQEISDRIQQ 338
           PI V   +S  ++IY++I+ ++ +
Sbjct: 242 PITVKEPDSEHAKIYRDIARKVWE 265


>gi|297247102|ref|ZP_06930823.1| ATP-binding protein involved in chromosome partitioning [Brucella
           abortus bv. 5 str. B3196]
 gi|297176066|gb|EFH35410.1| ATP-binding protein involved in chromosome partitioning [Brucella
           abortus bv. 5 str. B3196]
          Length = 282

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 197/264 (74%), Gaps = 5/264 (1%)

Query: 80  TENKNPPQQRNNL-----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV 134
           +++++PPQ R         V   +AVASGKGGVGKSTT VN+A  L   G    ILDAD+
Sbjct: 1   SQHRHPPQPRPAAKPGVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKAGILDADI 60

Query: 135 YGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHM 194
           YGPS+P+LL +SG+ E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  M
Sbjct: 61  YGPSMPRLLGLSGRPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQM 120

Query: 195 LHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKM 254
           L  V WG+LD L++DMPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+
Sbjct: 121 LREVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKV 180

Query: 255 NIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGI 314
           ++P++G++ENMSYF+  DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G 
Sbjct: 181 DVPLLGIVENMSYFITPDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGT 240

Query: 315 PIVVHNMNSATSEIYQEISDRIQQ 338
           PI V   +S  ++IY++I+ ++ +
Sbjct: 241 PITVKEPDSEHAKIYRDIARKVWE 264


>gi|254731398|ref|ZP_05189976.1| mrp-related protein [Brucella abortus bv. 4 str. 292]
          Length = 296

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 197/264 (74%), Gaps = 5/264 (1%)

Query: 80  TENKNPPQQRNNL-----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV 134
           +++++PPQ R         V   +AVASGKGGVGKSTT VN+A  L   G    ILDAD+
Sbjct: 15  SQHRHPPQPRPAAKPGVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKAGILDADI 74

Query: 135 YGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHM 194
           YGPS+P+LL +SG+ E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  M
Sbjct: 75  YGPSMPRLLGLSGRPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQM 134

Query: 195 LHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKM 254
           L  V WG+LD L++DMPPGTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+
Sbjct: 135 LREVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKV 194

Query: 255 NIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGI 314
           ++P++G++ENMSYF+  DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G 
Sbjct: 195 DVPLLGIVENMSYFITPDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGT 254

Query: 315 PIVVHNMNSATSEIYQEISDRIQQ 338
           PI V   +S  ++IY++I+ ++ +
Sbjct: 255 PITVKEPDSEHAKIYRDIARKVWE 278


>gi|218508180|ref|ZP_03506058.1| hypothetical protein RetlB5_11587 [Rhizobium etli Brasil 5]
          Length = 258

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 141/241 (58%), Positives = 189/241 (78%)

Query: 98  VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFL 157
           +AVASGKGGVGKSTT VN+A  +   G  V ILDAD+YGPS+P+LLKISG+    D + +
Sbjct: 2   IAVASGKGGVGKSTTAVNLALGVLANGLRVGILDADIYGPSMPRLLKISGRPTQIDGRII 61

Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217
            P ENYG+K+MSM  LVDE  AMIWRGPMVQSA++ ML  V WG+LD L++DMPPGTGDA
Sbjct: 62  NPMENYGLKVMSMGFLVDEETAMIWRGPMVQSALLQMLREVAWGELDVLVVDMPPGTGDA 121

Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277
            LT+AQ++PL+G VIVSTPQDLALID ++ ++M++K+ +P++G++ENMSYF+A DTG +Y
Sbjct: 122 QLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRKVEVPVLGIVENMSYFIAPDTGTRY 181

Query: 278 DLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           D+FG+GGAR EAE+IG+PFL  VP  M++R  SD G P+V  + N   + IY+ I+ ++ 
Sbjct: 182 DIFGHGGARKEAERIGVPFLGEVPLTMNIRETSDAGTPLVASDPNGVVAGIYRGIATKVW 241

Query: 338 Q 338
           +
Sbjct: 242 E 242


>gi|254714863|ref|ZP_05176674.1| nucleotide-binding protein-like protein [Brucella ceti M644/93/1]
 gi|261322665|ref|ZP_05961862.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261295355|gb|EEX98851.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 274

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 190/246 (77%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P+LL +SG+ E  
Sbjct: 11  GVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADIYGPSMPRLLGLSGRPETV 70

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++DMPP
Sbjct: 71  EGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVDMPP 130

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+A D
Sbjct: 131 GTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFIAPD 190

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
           TG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V   +S  ++IY++I
Sbjct: 191 TGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVKEPDSEHAKIYRDI 250

Query: 333 SDRIQQ 338
           + ++ +
Sbjct: 251 ARKVWE 256


>gi|260567296|ref|ZP_05837766.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261221287|ref|ZP_05935568.1| ATP-binding protein [Brucella ceti B1/94]
 gi|261316717|ref|ZP_05955914.1| ATP-binding protein [Brucella pinnipedialis B2/94]
 gi|261751383|ref|ZP_05995092.1| ATP-binding protein [Brucella suis bv. 5 str. 513]
 gi|261754260|ref|ZP_05997969.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|265983238|ref|ZP_06095973.1| ATP-binding protein [Brucella sp. 83/13]
 gi|260156814|gb|EEW91894.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260919871|gb|EEX86524.1| ATP-binding protein [Brucella ceti B1/94]
 gi|261295940|gb|EEX99436.1| ATP-binding protein [Brucella pinnipedialis B2/94]
 gi|261741136|gb|EEY29062.1| ATP-binding protein [Brucella suis bv. 5 str. 513]
 gi|261744013|gb|EEY31939.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|264661830|gb|EEZ32091.1| ATP-binding protein [Brucella sp. 83/13]
          Length = 263

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 189/241 (78%)

Query: 98  VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFL 157
           +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+P+LL +SG+ E  + + L
Sbjct: 5   IAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADIYGPSMPRLLGLSGRPETVEGRIL 64

Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217
           KP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++DMPPGTGDA
Sbjct: 65  KPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVDMPPGTGDA 124

Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277
            LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+A DTG +Y
Sbjct: 125 QLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFIAPDTGTRY 184

Query: 278 DLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           D+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V   +S  ++IY++I+ ++ 
Sbjct: 185 DIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVKEPDSEHAKIYRDIARKVW 244

Query: 338 Q 338
           +
Sbjct: 245 E 245


>gi|256060199|ref|ZP_05450377.1| nucleotide-binding protein-like protein [Brucella neotomae 5K33]
 gi|261324175|ref|ZP_05963372.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261300155|gb|EEY03652.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 277

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 144/259 (55%), Positives = 193/259 (74%), Gaps = 5/259 (1%)

Query: 85  PPQQRNNL-----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSI 139
           PPQ R         V   +AVASGKGGVGKSTT VN+A  L   G  V ILDAD+YGPS+
Sbjct: 1   PPQPRPAAKPGVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDADIYGPSM 60

Query: 140 PKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVV 199
           P+LL +SG+ E  + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V 
Sbjct: 61  PRLLGLSGRPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVA 120

Query: 200 WGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPII 259
           WG+LD L++DMPPGTGDA LT+AQ++PL+G V+V TPQDLALID ++ ++M++K+++P++
Sbjct: 121 WGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVVVLTPQDLALIDARKGLNMFRKVDVPLL 180

Query: 260 GMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVH 319
           G++ENMSYF+A DTG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V 
Sbjct: 181 GIVENMSYFIAPDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVK 240

Query: 320 NMNSATSEIYQEISDRIQQ 338
             +S  ++IY++I+ ++ +
Sbjct: 241 EPDSEHAKIYRDIARKVWK 259


>gi|209965276|ref|YP_002298191.1| mrp protein, putative [Rhodospirillum centenum SW]
 gi|209958742|gb|ACI99378.1| mrp protein, putative [Rhodospirillum centenum SW]
          Length = 377

 Score =  316 bits (809), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 147/360 (40%), Positives = 227/360 (63%), Gaps = 22/360 (6%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M ++ + Q++ +L  +  P    +IV +  +S + I +  V  SI V       L+ LR 
Sbjct: 1   MAEVTEAQVLAALGTVKDPDRGTDIVSLGMISGLAIKNGNVGFSIEVDPRRGPALEPLRQ 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL----------------------NVKKFV 98
            A++ +  +  V +    LT ++  PQ +                          V+  V
Sbjct: 61  AAEKAVDRLAGVLSVTAVLTAHRPAPQMQAGAQSAPGPGANSAPRAAGPKPAVPGVRAIV 120

Query: 99  AVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLK 158
           AVASGKGGVGKSTT VN+A AL  +G  + +LDAD+YGPS+P+L+ +SG+    D + L+
Sbjct: 121 AVASGKGGVGKSTTAVNLALALAGRGLRIGLLDADIYGPSLPRLMGLSGRPPARDGRTLE 180

Query: 159 PKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAH 218
           P   +G+K+MS+  LV E+  MIWRGPMVQSAI  ML +V WG+LD L++DMPPGTGDA 
Sbjct: 181 PLTGHGVKVMSIGFLVAEDTPMIWRGPMVQSAIQQMLRDVAWGELDVLVVDMPPGTGDAQ 240

Query: 219 LTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYD 278
           LT+AQ++PL+G VIVSTPQD+AL+D ++ ++M++++++P++G++ENMSYF   + G + D
Sbjct: 241 LTLAQQVPLAGAVIVSTPQDIALLDARKGLNMFRRVDVPVLGIVENMSYFCCPNCGHRSD 300

Query: 279 LFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           +FG+GGAR EA ++G+ FL  +P D+ +R  SD G PIV  + + A +  Y+ I++ + Q
Sbjct: 301 IFGHGGARAEAGRLGVDFLGEIPLDIAIRETSDGGTPIVATDPDGAHARAYRAIAETVWQ 360


>gi|319405209|emb|CBI78814.1| ATP/GTP-binding protein [Bartonella sp. AR 15-3]
          Length = 366

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 157/363 (43%), Positives = 228/363 (62%), Gaps = 28/363 (7%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  I +  I   L  +  P  +N+IV +  LSEIFI    V+ SITVP     + + LR 
Sbjct: 1   MGSITREAIRQELHKVKSPSFENDIVSLGLLSEIFIADGKVFFSITVPDGCVQEFEPLRC 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNP---------------PQQRNN---------LNVKK 96
            A++++  I  VK  +VTLT  K P               P+++             V+ 
Sbjct: 61  AAEEVVSAIEGVKAVMVTLTAEKKPRVFSSHVNKNTTVYTPKRKGGGALLMKTPVEGVRH 120

Query: 97  FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK-ISGKVEISDKK 155
            +AVASGKGGVGKS   +NIA AL++ G    ++DAD+YGPS+P+L+  I+ +  I + K
Sbjct: 121 VLAVASGKGGVGKSIMAINIALALQDAGFKTGLMDADIYGPSLPRLIGLINQRTRIVNGK 180

Query: 156 FLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTG 215
            L+P E +G+K+MSM  L++E   ++WRGPMV +A+  +L +V+WG LD L++DMPPGTG
Sbjct: 181 KLQPLEKFGLKLMSMGFLIEEEKPIVWRGPMVMAAVTQLLRDVLWGPLDVLVVDMPPGTG 240

Query: 216 DAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGK 275
           D  LT+ Q++ L+G +IVSTPQDLAL+D ++AI M+ K+ +PI+G++ENMSYF+A DTG+
Sbjct: 241 DTQLTLVQQVQLTGALIVSTPQDLALVDARKAIEMFMKVEVPILGLVENMSYFIAPDTGR 300

Query: 276 KYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
           +YD+FG GG R EAE  GIPFL  +P D  +R  SD G+PI V +     + +Y+ +   
Sbjct: 301 RYDIFGYGGVRSEAESRGIPFLAEMPLDAILRSSSDDGVPIFVADPEGEYANLYRTM--- 357

Query: 336 IQQ 338
           IQQ
Sbjct: 358 IQQ 360


>gi|218532902|ref|YP_002423718.1| Mrp protein [Methylobacterium chloromethanicum CM4]
 gi|218525205|gb|ACK85790.1| Mrp protein [Methylobacterium chloromethanicum CM4]
          Length = 375

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 154/354 (43%), Positives = 228/354 (64%), Gaps = 21/354 (5%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFI-VHNTVYLSITVPHTIAHQLQSLRSNA 62
           I ++ ++ +L  +++      + +  RLS++ I   N V  SI +  + A + + +R  A
Sbjct: 3   ITRDDVLKALSTVTVDRGGTTLPDSGRLSQVVIDPGNRVMFSIRIDPSEAERFEPVRREA 62

Query: 63  QQIIQNIPTVKNAVVTLTENKNP-------------------PQQRNNL-NVKKFVAVAS 102
           +  +  +  V + + +LT  + P                   P+Q N L  V+  VAVAS
Sbjct: 63  EGRVLALSGVSSVLASLTSERAPNAPAPGVAPRQPAGGPGAPPRQGNALPGVRHIVAVAS 122

Query: 103 GKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKEN 162
           GKGGVGKSTT  N+A AL  +G  V +LDAD+YGPS+PKLL +SGK  + + K L+P + 
Sbjct: 123 GKGGVGKSTTACNLALALSAQGLKVGLLDADIYGPSVPKLLGLSGKPRVIEGKTLEPLQA 182

Query: 163 YGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIA 222
           YG+K MS+  L++   AMIWRGPMVQSAI  ML +V WG+LD L++DMPPGTGDA LT+A
Sbjct: 183 YGLKAMSIGLLIEPESAMIWRGPMVQSAITQMLRDVAWGELDVLIVDMPPGTGDAQLTMA 242

Query: 223 QKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGN 282
           Q  PLSG VIVSTPQDLALID +R ++M++K+++PI+G+IENM+ F+  + G    +FG+
Sbjct: 243 QATPLSGAVIVSTPQDLALIDARRGVTMFRKVSVPILGVIENMATFICPNCGAASAIFGH 302

Query: 283 GGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           GGAR EAE++ +PFL  +P  M +R  SD G P+V  + +   ++IY+EI+ ++
Sbjct: 303 GGARHEAERLEVPFLGEIPLTMAIRETSDAGRPVVATDPDGPQAKIYREIAGKL 356


>gi|260563137|ref|ZP_05833623.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260153153|gb|EEW88245.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
          Length = 263

 Score =  315 bits (808), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 139/241 (57%), Positives = 188/241 (78%)

Query: 98  VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFL 157
           +AVASGKGGVGKSTT VN+A  L   G    ILDAD+YGPS+P+LL +SG+ E  + + L
Sbjct: 5   IAVASGKGGVGKSTTAVNLALGLAANGLKAGILDADIYGPSMPRLLGLSGRPETVEGRIL 64

Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217
           KP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++DMPPGTGDA
Sbjct: 65  KPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVDMPPGTGDA 124

Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277
            LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+A DTG +Y
Sbjct: 125 QLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFIAPDTGTRY 184

Query: 278 DLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           D+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V   +S  ++IY++I+ ++ 
Sbjct: 185 DIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVKEPDSEHAKIYRDIARKVW 244

Query: 338 Q 338
           +
Sbjct: 245 E 245


>gi|240141415|ref|YP_002965895.1| antiporter inner membrane protein [Methylobacterium extorquens AM1]
 gi|240011392|gb|ACS42618.1| antiporter inner membrane protein [Methylobacterium extorquens AM1]
          Length = 375

 Score =  315 bits (807), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 154/354 (43%), Positives = 228/354 (64%), Gaps = 21/354 (5%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFI-VHNTVYLSITVPHTIAHQLQSLRSNA 62
           I ++ ++ +L  +++      + +  RLS++ I   N V  SI +  + A + + +R  A
Sbjct: 3   ITRDDVLKALSTVTVDRGGTTLPDSGRLSQVVIDPGNRVMFSIRIDPSEAERFEPVRREA 62

Query: 63  QQIIQNIPTVKNAVVTLTENKN-------------------PPQQRNNL-NVKKFVAVAS 102
           +  +  +  V + + +LT  +                    PP+Q N L  V+  VAVAS
Sbjct: 63  EGRVLALSGVSSVLASLTSERAPNAPAPGAAPRQPAGGPGAPPRQGNALPGVRHIVAVAS 122

Query: 103 GKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKEN 162
           GKGGVGKSTT  N+A AL  +G  V +LDAD+YGPS+PKLL +SGK  + + K L+P + 
Sbjct: 123 GKGGVGKSTTACNLALALSAQGLKVGLLDADIYGPSVPKLLGLSGKPRVIEGKTLEPLQA 182

Query: 163 YGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIA 222
           YG+K MS+  L++   AMIWRGPMVQSAI  ML +V WG+LD L++DMPPGTGDA LT+A
Sbjct: 183 YGLKAMSIGLLIEPESAMIWRGPMVQSAITQMLRDVAWGELDVLIVDMPPGTGDAQLTMA 242

Query: 223 QKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGN 282
           Q  PLSG VIVSTPQDLALID +R ++M++K+++PI+G+IENM+ F+  + G    +FG+
Sbjct: 243 QATPLSGAVIVSTPQDLALIDARRGVTMFRKVSVPILGVIENMATFICPNCGAASAIFGH 302

Query: 283 GGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           GGAR EAE++ +PFL  +P  M +R  SD G P+V  + +   ++IY+EI+ ++
Sbjct: 303 GGARHEAERLEVPFLGEIPLTMAIRETSDAGRPVVATDPDGPQAKIYREIAGKL 356


>gi|319898445|ref|YP_004158538.1| ATP/GTP-binding protein [Bartonella clarridgeiae 73]
 gi|319402409|emb|CBI75950.1| ATP/GTP-binding protein [Bartonella clarridgeiae 73]
          Length = 378

 Score =  315 bits (807), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 163/378 (43%), Positives = 233/378 (61%), Gaps = 39/378 (10%)

Query: 1   MNQILKNQIVDSLKVLSIPG----EKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQ 56
           M+ I +  I   L  + +P       +NIV +  LSEIFI    V+ SITVP   A + +
Sbjct: 1   MDPITREAIRKELHKVKVPNFESDSNSNIVSLGLLSEIFIADGKVFFSITVPDECAQEFE 60

Query: 57  SLRSNAQQIIQNIPTVKNAVVTLTE-----------NKNPPQQRNN-------------- 91
            LR  A++++  +  VK  +VTLT            N+N   Q N               
Sbjct: 61  PLRRAAEEVVSAMEGVKAVMVTLTAEKKSRTFSSQVNENTSSQVNENTTVFAPRRKAGGA 120

Query: 92  -------LNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK 144
                    V+  +AVASGKGGVGKS   +N+A AL++ G    ++DAD+YGPS+P+L+ 
Sbjct: 121 LLMKTPIEGVRHVIAVASGKGGVGKSIMAINVALALQDAGFKTGLMDADIYGPSLPRLIG 180

Query: 145 ISGKVE--ISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQ 202
           +  +    I+D+KF +P E +G+K+MSM  L++E   ++WRGPMV +A+  +L  V+WG 
Sbjct: 181 LVNQKPRMINDRKF-QPLEKFGLKLMSMGFLIEEEKPIVWRGPMVMAAVTKLLRGVLWGP 239

Query: 203 LDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMI 262
           LD L++DMPPGTGDA LT+ Q++ L+GV+IVSTPQDLALID ++AI M+ K+ +PI+G+I
Sbjct: 240 LDILVVDMPPGTGDAQLTLVQQVQLTGVLIVSTPQDLALIDARKAIEMFMKVEVPILGLI 299

Query: 263 ENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMN 322
           ENMSYF+A DTG++YD+FG GGAR EAE  GIPFL  VP D  +R  SD G+PI V +  
Sbjct: 300 ENMSYFIAPDTGRRYDIFGYGGARSEAESRGIPFLAEVPLDAALRSSSDDGVPIFVADPE 359

Query: 323 SATSEIYQEISDRIQQFF 340
              S +Y+ I  +++  F
Sbjct: 360 GEHSNLYRTIIHQMKDRF 377


>gi|254690368|ref|ZP_05153622.1| mrp-related protein [Brucella abortus bv. 6 str. 870]
          Length = 272

 Score =  315 bits (806), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 139/246 (56%), Positives = 188/246 (76%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            V   +AVASGKGGVGKSTT VN+A  L   G    ILDAD+YGPS+P+LL +SG+ E  
Sbjct: 9   GVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKAGILDADIYGPSMPRLLGLSGRPETV 68

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           + + LKP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++DMPP
Sbjct: 69  EGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVDMPP 128

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGDA LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+  D
Sbjct: 129 GTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFITPD 188

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
           TG +YD+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V   +S  ++IY++I
Sbjct: 189 TGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVKEPDSEHAKIYRDI 248

Query: 333 SDRIQQ 338
           + ++ +
Sbjct: 249 ARKVWE 254


>gi|254563930|ref|YP_003071025.1| antiporter inner membrane protein [Methylobacterium extorquens DM4]
 gi|254271208|emb|CAX27220.1| antiporter inner membrane protein [Methylobacterium extorquens DM4]
          Length = 375

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 153/354 (43%), Positives = 227/354 (64%), Gaps = 21/354 (5%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFI-VHNTVYLSITVPHTIAHQLQSLRSNA 62
           I ++ ++ +L  +++      + +  RLS++ I   N V  SI +  + A + + +R  A
Sbjct: 3   ITRDDVLKALSTVTVDRNGTTLPDSGRLSQVVIDPGNRVMFSIRIDPSEAERFEPVRREA 62

Query: 63  QQIIQNIPTVKNAVVTLTENKNP-------------------PQQRNNL-NVKKFVAVAS 102
           +  +  +  V + + +LT  + P                   P+Q N L  V+  VAVAS
Sbjct: 63  EGRVLALSGVSSVLASLTSERAPNAPAPGVAPRQPAGGPGAPPRQGNALPGVRHIVAVAS 122

Query: 103 GKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKEN 162
           GKGGVGKSTT  N+A  L  +G  V +LDAD+YGPS+PKLL +SGK  + + K L+P + 
Sbjct: 123 GKGGVGKSTTACNLALGLSAQGLRVGLLDADIYGPSVPKLLGLSGKPRVIEGKTLEPLQA 182

Query: 163 YGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIA 222
           YG+K MS+  L++   AMIWRGPMVQSAI  ML +V WG+LD L++DMPPGTGDA LT+A
Sbjct: 183 YGLKAMSIGLLIEPESAMIWRGPMVQSAITQMLRDVAWGELDVLIVDMPPGTGDAQLTMA 242

Query: 223 QKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGN 282
           Q  PLSG VIVSTPQDLALID +R ++M++K+++PI+G+IENM+ F+  + G    +FG+
Sbjct: 243 QATPLSGAVIVSTPQDLALIDARRGVTMFRKVSVPILGVIENMATFICPNCGAASAIFGH 302

Query: 283 GGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           GGAR EAE++ +PFL  +P  M +R  SD G P+V  + +   ++IY+EI+ ++
Sbjct: 303 GGARHEAERLEVPFLGEIPLTMAIRETSDAGRPVVATDPDGPQAKIYREIAGKL 356


>gi|188584268|ref|YP_001927713.1| MRP protein-like protein [Methylobacterium populi BJ001]
 gi|179347766|gb|ACB83178.1| MRP protein-like protein [Methylobacterium populi BJ001]
          Length = 373

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 153/352 (43%), Positives = 226/352 (64%), Gaps = 19/352 (5%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFI-VHNTVYLSITVPHTIAHQLQSLRSNA 62
           I ++ ++ +L  +++      +    RLS + I   N V  SI +  + A + + +R  A
Sbjct: 3   ITRDDVLKALSTVTVDRGGTTLPGSGRLSPVVIDPGNRVMFSILIDPSEAERFEPVRREA 62

Query: 63  QQIIQNIPTVKNAVVTLTENKN-----------------PPQQRNNL-NVKKFVAVASGK 104
           +  +  +P V + + +LT  +                  PP+Q N L  V+  VAVASGK
Sbjct: 63  EGRVLALPGVSSVLASLTSERAPNAPPPGAAPRAPGPGVPPRQGNALPGVRHIVAVASGK 122

Query: 105 GGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYG 164
           GGVGKSTT  N+A  L  +G  V +LDAD+YGPS+PKLL +SGK  + + K L+P + YG
Sbjct: 123 GGVGKSTTACNLALGLSAQGLRVGLLDADIYGPSVPKLLGLSGKPRVLEGKTLEPMQAYG 182

Query: 165 IKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQK 224
           +K MS+  L++   AMIWRGPMVQSAI  ML +V WG+LD L++DMPPGTGDA LT+AQ 
Sbjct: 183 LKAMSIGFLIEPESAMIWRGPMVQSAITQMLRDVAWGELDVLVVDMPPGTGDAQLTMAQA 242

Query: 225 IPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGG 284
            PLSG VIVSTPQDLALID +R ++M++K+++PI+G+IENM+ F+  + G    +FG+GG
Sbjct: 243 TPLSGAVIVSTPQDLALIDARRGVTMFRKVSVPILGVIENMATFICPNCGAASAIFGHGG 302

Query: 285 ARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           AR EAE++ +PFL  +P  M +R  SD G P+V  + +   +++Y+EI+ ++
Sbjct: 303 ARHEAERLEVPFLGEIPLTMAIRETSDAGRPVVATDPDGPQAKVYREIAQKL 354


>gi|260755914|ref|ZP_05868262.1| ATP-binding protein [Brucella abortus bv. 6 str. 870]
 gi|260759138|ref|ZP_05871486.1| ATP-binding protein [Brucella abortus bv. 4 str. 292]
 gi|260669456|gb|EEX56396.1| ATP-binding protein [Brucella abortus bv. 4 str. 292]
 gi|260676022|gb|EEX62843.1| ATP-binding protein [Brucella abortus bv. 6 str. 870]
          Length = 263

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 187/241 (77%)

Query: 98  VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFL 157
           +AVASGKGGVGKSTT VN+A  L   G    ILDAD+YGPS+P+LL +SG+ E  + + L
Sbjct: 5   IAVASGKGGVGKSTTAVNLALGLAANGLKAGILDADIYGPSMPRLLGLSGRPETVEGRIL 64

Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217
           KP ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++DMPPGTGDA
Sbjct: 65  KPMENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVDMPPGTGDA 124

Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277
            LT+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+  DTG +Y
Sbjct: 125 QLTMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFITPDTGTRY 184

Query: 278 DLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           D+FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V   +S  ++IY++I+ ++ 
Sbjct: 185 DIFGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVKEPDSEHAKIYRDIARKVW 244

Query: 338 Q 338
           +
Sbjct: 245 E 245


>gi|319403772|emb|CBI77356.1| ATP/GTP-binding protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 366

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 157/362 (43%), Positives = 230/362 (63%), Gaps = 25/362 (6%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  I +  I   L  +  P  +++IV +  LSEIFIV   V+ SITVP     + +SLR 
Sbjct: 1   MVSITREAIRKELHKVKGPNFESDIVSLGLLSEIFIVDGKVFFSITVPDGCLQEFESLRC 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLN------------------------VKK 96
            A++++  +  VK+ +VTLT  K      + +N                        V+ 
Sbjct: 61  TAEEVVSAMEGVKSVIVTLTAEKKSKTFSSQVNKNTTVHGPKRKVGGALLRKTPIEGVRH 120

Query: 97  FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK-ISGKVEISDKK 155
            +AVASGKGGVGKS   +NIA AL++ G    ++DAD+YGPS+P+L   ++ + E+   K
Sbjct: 121 VLAVASGKGGVGKSIMAMNIALALQDAGFKTGLMDADIYGPSLPRLTGLVNQQPEMIHGK 180

Query: 156 FLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTG 215
            L+P E +G+K+MSM  L++E   ++WRGPMV +A+  +L +V+WG LD L++DMPPGTG
Sbjct: 181 KLQPLEKFGLKLMSMGFLIEEEKPIVWRGPMVMAAVTQLLRDVLWGPLDVLVVDMPPGTG 240

Query: 216 DAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGK 275
           D  LT+ Q++ L+G +IVSTPQDLALID ++AI M+ K+ +PI+G+IENMSYF+A DTG+
Sbjct: 241 DTQLTLVQQVQLTGALIVSTPQDLALIDARKAIEMFMKVEVPILGVIENMSYFIAPDTGR 300

Query: 276 KYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
           +YD+FG GGAR EAE  GIPFL  VP D  +R  SD G+PI V +     +++Y+ I  +
Sbjct: 301 RYDIFGYGGARSEAESRGIPFLAEVPLDPVLRSSSDDGVPIFVADPGGEHAQLYRTIIHQ 360

Query: 336 IQ 337
           ++
Sbjct: 361 VK 362


>gi|86750504|ref|YP_487000.1| MRP-like protein (ATP/GTP-binding protein) [Rhodopseudomonas
           palustris HaA2]
 gi|86573532|gb|ABD08089.1| MRP-like protein (ATP/GTP-binding protein) [Rhodopseudomonas
           palustris HaA2]
          Length = 372

 Score =  313 bits (801), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 158/362 (43%), Positives = 221/362 (61%), Gaps = 29/362 (8%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + + QI DSL  +  P     + +   LSEI +    VY SI V    A   +S+R+ A+
Sbjct: 3   VTQQQIRDSLAKVMTP-RGVALTQADVLSEIAVTDGKVYFSINVDAAEARSWESVRAAAE 61

Query: 64  QIIQNIPTVKNAVVTLTENKNP----------------------------PQQRNNLNVK 95
              + +P V +A+  LT  + P                             +Q     V+
Sbjct: 62  AAARAVPGVVSALAALTAERRPGAAQPPRSGVAPAAAHRPAPAGGAQSPMAKQAEIPGVR 121

Query: 96  KFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKK 155
             +AVASGKGGVGKSTT +N+A  L++ G  V +LDAD+YGPS+P+L  I  K ++ D +
Sbjct: 122 AVIAVASGKGGVGKSTTSLNLALGLRDLGLRVGLLDADIYGPSVPRLTGIQEKPQLDDSR 181

Query: 156 FLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTG 215
            + P   +G+ IMS+  LVDE   MIWRGPMV SAI  ML +V WGQLD L++DMPPGTG
Sbjct: 182 RMIPIRRFGLSIMSIGFLVDEEAPMIWRGPMVMSAITQMLRDVDWGQLDVLVVDMPPGTG 241

Query: 216 DAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGK 275
           DA LT+AQ +PL G VIVSTPQDLALID +R ++M+ K+N+P++G+IENMSYFL    G 
Sbjct: 242 DAQLTLAQNVPLKGAVIVSTPQDLALIDARRGLAMFTKVNVPVLGIIENMSYFLCPHCGT 301

Query: 276 KYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
           + D+FG+GGAR EAE++ +PFL  +P  MD+R  SD G P+V    +   +EIY+ I+ +
Sbjct: 302 RSDIFGHGGARHEAERLAVPFLGEIPLHMDIRASSDAGTPVVESEPSGPHAEIYRAIAAQ 361

Query: 336 IQ 337
           ++
Sbjct: 362 VR 363


>gi|217977250|ref|YP_002361397.1| nucleotide-binding protein-like protein [Methylocella silvestris
           BL2]
 gi|217502626|gb|ACK50035.1| nucleotide-binding protein-like protein [Methylocella silvestris
           BL2]
          Length = 364

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 154/347 (44%), Positives = 228/347 (65%), Gaps = 18/347 (5%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           +  ++ +L+ +  P  +  +     ++ + I    VY+SI++    +  ++ +R  A+  
Sbjct: 4   EQDVLTALEAVPGPDGETPLARSGAIAGVSIRDGKVYVSISIDPQRSAAMEPMRVAAETA 63

Query: 66  IQNIPTVKNAVVTLTENKNPPQQR------------NNL---NVKKFVAVASGKGGVGKS 110
           ++ +  V +A+V+LT N+   +QR             NL    V   +AVASGKGGVGKS
Sbjct: 64  LRKLRGVSSALVSLTANRT--EQRPPPPPAAKPQAGRNLAIPGVAHIIAVASGKGGVGKS 121

Query: 111 TTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSM 170
           TT VN+A +LK+ G  + ILDAD+YGPS+P+LL +  K   S+ + L P E YG+K MS+
Sbjct: 122 TTAVNLALSLKDLGWRIGILDADIYGPSLPRLLGLKDKPR-SEGRTLIPLEAYGVKAMSI 180

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGV 230
             LV E  AMIWRGPMV  A+  ML +V WG+LD L++DMPPGTGDA LT+AQ + L+G 
Sbjct: 181 GFLVGEEEAMIWRGPMVMGALQQMLRDVAWGELDCLVVDMPPGTGDAQLTMAQSVALAGA 240

Query: 231 VIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAE 290
           VIVSTPQDLALID +R ++M+ K+++ I+G++ENMSYF+    G + D+FG+GGAR EAE
Sbjct: 241 VIVSTPQDLALIDARRGVAMFNKVDVAILGIVENMSYFVCPHCGGRSDIFGHGGARREAE 300

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           + G+PFL  VP DMD+R  SD G PIVV +   A +++Y+E++ +I+
Sbjct: 301 RYGVPFLGEVPLDMDIREQSDAGRPIVVSDPGGAHAKVYRELAAQIK 347


>gi|90423569|ref|YP_531939.1| MRP ATP/GTP-binding protein [Rhodopseudomonas palustris BisB18]
 gi|90105583|gb|ABD87620.1| MRP ATP/GTP-binding protein [Rhodopseudomonas palustris BisB18]
          Length = 373

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 153/363 (42%), Positives = 225/363 (61%), Gaps = 30/363 (8%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + + QI+D L  ++ P     + +   LSEI +    VY +I V        +++R+ A+
Sbjct: 3   VTQQQILDGLAKVASP-RGVALTKANVLSEISVNDGKVYFAINVEAAEVRAWEAVRNAAE 61

Query: 64  QIIQNIPTVKNAVVTLTENKNP-----------------------------PQQRNNLNV 94
             +  IP VK+A++ LT  + P                              +Q     +
Sbjct: 62  AAVTAIPGVKSAMIALTAERKPGSSPAAPRAGVAPAAAHRPPPGPGPASPMSKQAEIPGI 121

Query: 95  KKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDK 154
              +AVASGKGGVGKSTT +N+A +L++ G  V +LDAD+YGPS+PKL  I+ + ++ D 
Sbjct: 122 TSIIAVASGKGGVGKSTTALNLALSLRDLGLKVGLLDADIYGPSVPKLTGINERPQLDDA 181

Query: 155 KFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGT 214
           + + P   +G+ IMS+  LV+EN AMIWRGPMV SAI  ML +VVWG LD L++DMPPGT
Sbjct: 182 RKMIPIMRFGLSIMSIGFLVEENSAMIWRGPMVMSAITQMLRDVVWGTLDVLVVDMPPGT 241

Query: 215 GDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTG 274
           GDA LT+AQ +PL G VIVSTPQDLALID +R ++M+ K+ +P++G++ENMSYF   + G
Sbjct: 242 GDAQLTLAQNVPLKGAVIVSTPQDLALIDARRGLAMFTKVGVPVLGIVENMSYFQCPECG 301

Query: 275 KKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISD 334
            + D+FG+GGAR EAE++G+PFL  VP  M +R  SD G P+V    +   + IY+ I++
Sbjct: 302 ARSDIFGHGGARQEAERLGVPFLGEVPLHMSIRSNSDAGTPVVESEPSGVHAAIYRAIAE 361

Query: 335 RIQ 337
           +++
Sbjct: 362 KVR 364


>gi|319406780|emb|CBI80413.1| ATP/GTP-binding protein [Bartonella sp. 1-1C]
          Length = 366

 Score =  311 bits (798), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 156/362 (43%), Positives = 230/362 (63%), Gaps = 25/362 (6%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  I +  I   L  +  P  +++IV +  LSEIFIV   V+ SITVP     + +SLR 
Sbjct: 1   MVSITREAIRKELHKVKGPNFESDIVSLGLLSEIFIVDGKVFFSITVPDGCLQEFESLRC 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLN------------------------VKK 96
            A++++  +  VK+ +VTLT  K      + +N                        V+ 
Sbjct: 61  AAEEVVSAMEGVKSVIVTLTAEKKSKTFSSQVNKNTTVHGPKRKVGGALLRKTPIEGVRH 120

Query: 97  FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK-ISGKVEISDKK 155
            +AVASGKGGVGKS   +NIA AL++ G    ++DAD+YGPS+P+L   ++ + E+   K
Sbjct: 121 VLAVASGKGGVGKSIMAMNIALALQDAGFKTGLMDADIYGPSLPRLTGLVNQQPEMIHGK 180

Query: 156 FLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTG 215
            L+P E +G+K+MSM  L++E   ++WRGPMV +A+  +L +V+WG LD L++DMPPGTG
Sbjct: 181 KLQPLEKFGLKLMSMGFLIEEEKPIVWRGPMVMAAVTQLLRDVLWGPLDVLVVDMPPGTG 240

Query: 216 DAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGK 275
           D  LT+ Q++ L+G +IVSTPQDLALID ++AI M+ K+ +PI+G+IENMSYF+A DTG+
Sbjct: 241 DTQLTLVQQVQLTGALIVSTPQDLALIDARKAIEMFMKVEVPILGVIENMSYFIAPDTGR 300

Query: 276 KYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
           +YD+FG GGAR EAE  GIPFL  VP D  +R  SD G+PI V +     +++Y+ +  +
Sbjct: 301 RYDIFGYGGARSEAESRGIPFLAEVPLDPVLRSSSDDGVPIFVADPRGEHAQLYRTMIHQ 360

Query: 336 IQ 337
           ++
Sbjct: 361 VK 362


>gi|265999691|ref|ZP_05467424.2| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|263095347|gb|EEZ18974.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
          Length = 257

 Score =  311 bits (797), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 186/239 (77%)

Query: 100 VASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKP 159
           +ASGKGGVGKSTT VN+A  L   G    ILDAD+YGPS+P+LL +SG+ E  + + LKP
Sbjct: 1   MASGKGGVGKSTTAVNLALGLAANGLKAGILDADIYGPSMPRLLGLSGRPETVEGRILKP 60

Query: 160 KENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHL 219
            ENYGIK+MSM  +VDE   MIWRGPMV SA+  ML  V WG+LD L++DMPPGTGDA L
Sbjct: 61  MENYGIKVMSMGFMVDEETPMIWRGPMVMSALTQMLREVAWGELDVLVVDMPPGTGDAQL 120

Query: 220 TIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDL 279
           T+AQ++PL+G V+VSTPQDLALID ++ ++M++K+++P++G++ENMSYF+A DTG +YD+
Sbjct: 121 TMAQQVPLAGAVVVSTPQDLALIDARKGLNMFRKVDVPLLGIVENMSYFIAPDTGTRYDI 180

Query: 280 FGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           FG+GGAR EAE++ +PFL  VP  MDVR  SD G PI V   +S  ++IY++I+ ++ +
Sbjct: 181 FGHGGARREAERLNVPFLGEVPLHMDVRAYSDNGTPITVKEPDSEHAKIYRDIARKVWE 239


>gi|182678757|ref|YP_001832903.1| nucleotide-binding protein-like protein [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634640|gb|ACB95414.1| nucleotide-binding protein-like protein [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 361

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 151/344 (43%), Positives = 228/344 (66%), Gaps = 11/344 (3%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
             ++++L  +  P  K  + +   ++ + I  + VYLSI +    A  L+ +R+ A+ ++
Sbjct: 5   QDVLNALGTVLGPDGKTPLPQSGAIAGLSIKDDKVYLSIAIDPQQAGALEPMRAAAEAVV 64

Query: 67  QNIPTVKNAVVTLTENKNPPQQRNNL----------NVKKFVAVASGKGGVGKSTTVVNI 116
           + +  V NA+V+LT  K  P                 +   +AV+SGKGGVGKSTT VNI
Sbjct: 65  KKLKGVGNALVSLTAEKQTPPPAPPKPQAPRSIAIPGITHIIAVSSGKGGVGKSTTSVNI 124

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           A AL + G  V ILDAD+YGPS+P+LL + G+ E S+ +F+KP E +GIK +S+  +VDE
Sbjct: 125 ALALASLGWKVGILDADIYGPSLPRLLGLKGQPE-SEGRFMKPLEAFGIKAISIGFMVDE 183

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              M+WRGPMV +A+  +L +V WG+LD L++DMPPGTGDA LT+AQ +PL+G V+VSTP
Sbjct: 184 EEPMVWRGPMVMAAVQQLLRDVTWGELDCLVVDMPPGTGDAQLTLAQNVPLAGAVVVSTP 243

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QDLALID +R I+M+ K+++P++G++ENMSYFL    G + D+F +GGAR EAE++G+PF
Sbjct: 244 QDLALIDARRGIAMFNKVDVPVLGIVENMSYFLCPHCGGRSDIFAHGGARAEAERLGVPF 303

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
           L  VP  M +R  +D G P+VV   +S  +++Y +I+ +I+   
Sbjct: 304 LGEVPLHMTIRERADSGKPVVVSEPDSPYAKVYLDIAGQIKAML 347


>gi|163853961|ref|YP_001642004.1| MRP protein-like protein [Methylobacterium extorquens PA1]
 gi|163665566|gb|ABY32933.1| MRP protein-like protein [Methylobacterium extorquens PA1]
          Length = 378

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 154/357 (43%), Positives = 228/357 (63%), Gaps = 24/357 (6%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFI-VHNTVYLSITVPHTIAHQLQSLRSNA 62
           I ++ ++ +L  +++      + +  RLS++ I   N V  SI +  + A + + +R  A
Sbjct: 3   ITRDDVLKALSTVTVDRNGTTLPDSGRLSQVVIDPGNRVMFSIRIDPSEAERFEPVRREA 62

Query: 63  QQIIQNIPTVKNAVVTLTENKNP----------------------PQQRNNL-NVKKFVA 99
           +  +  +  V + + +LT  + P                      P+Q N L  V+  VA
Sbjct: 63  EGRVLALSGVSSVLASLTSERAPNAPSPGAAPRQPAGAAGGPGAPPRQGNALPGVRHIVA 122

Query: 100 VASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKP 159
           VASGKGGVGKSTT  N+A AL  +G  V +LDAD+YGPS+PKLL +SGK  + + K L+P
Sbjct: 123 VASGKGGVGKSTTACNLALALSAQGLKVGLLDADIYGPSVPKLLGLSGKPRVIEGKTLEP 182

Query: 160 KENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHL 219
            + YG+K MS+  L++   AMIWRGPMVQSAI  ML +V WG+LD L++DMPPGTGDA L
Sbjct: 183 LQAYGLKAMSIGLLIEPESAMIWRGPMVQSAITQMLRDVAWGELDVLIVDMPPGTGDAQL 242

Query: 220 TIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDL 279
           T+AQ  PLSG VIVSTPQDLALID +R ++M++K+++PI+G+IENM+ F+  + G    +
Sbjct: 243 TMAQATPLSGAVIVSTPQDLALIDARRGVTMFRKVSVPILGVIENMATFICPNCGAASAI 302

Query: 280 FGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           FG+GGAR EAE++ +PFL  +P  M +R  SD G P+V  + +   ++IY+EI+ ++
Sbjct: 303 FGHGGARHEAERLEVPFLGEIPLTMAIRQTSDAGRPVVATDPDGPQAKIYREIAGKL 359


>gi|115523993|ref|YP_780904.1| MRP-like protein (ATP/GTP-binding protein) [Rhodopseudomonas
           palustris BisA53]
 gi|115517940|gb|ABJ05924.1| MRP-like protein (ATP/GTP-binding protein) [Rhodopseudomonas
           palustris BisA53]
          Length = 388

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 150/360 (41%), Positives = 222/360 (61%), Gaps = 29/360 (8%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           + Q++DSL  ++ P     + +   LSEI +    VY +I V        + +R+ A+  
Sbjct: 21  QQQVLDSLSKVTSP-RGVALTKAGVLSEISLTDGKVYFAINVDAAEVRAWEDVRAKAEAA 79

Query: 66  IQNIPTVKNAVVTLTENKNP---PQQRNNL-------------------------NVKKF 97
           ++ +P + +A+V LT  + P   P  R  +                          V   
Sbjct: 80  VRAVPGITSAMVALTAERKPGATPAARPGVAPASAHRPPPGPGPQSPMSRQAEIPGVAAV 139

Query: 98  VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFL 157
           +AVASGKGGVGKSTT +N+A  L++ G  V +LDAD+YGPS+PKL+ I+ K  + D + +
Sbjct: 140 IAVASGKGGVGKSTTALNVALGLRDLGLRVGLLDADIYGPSVPKLIGINEKPRLDDDRRM 199

Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217
            P   +G+ +MS+  LVD +  MIWRGPMV SAI  ML +V WG LD L++DMPPGTGDA
Sbjct: 200 IPVARFGLAVMSIGFLVDPDSPMIWRGPMVMSAITQMLRDVNWGSLDVLVVDMPPGTGDA 259

Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277
            LT+AQ +PL G VIVSTPQDLALID +R ++M+ K+++P++G+IENMSYF     G + 
Sbjct: 260 QLTLAQNVPLKGAVIVSTPQDLALIDARRGLAMFTKVDVPVLGIIENMSYFQCPHCGTRS 319

Query: 278 DLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           D+FG+GGAR EAE++G+PFL  +P  M +R  SD G P++V +     +E Y+ I+++++
Sbjct: 320 DIFGHGGARHEAERLGVPFLGEIPLHMAIRATSDSGEPVMVSDPQGPHAEAYRAIAEKVR 379


>gi|91976525|ref|YP_569184.1| MRP ATP/GTP-binding protein [Rhodopseudomonas palustris BisB5]
 gi|91682981|gb|ABE39283.1| MRP ATP/GTP-binding protein [Rhodopseudomonas palustris BisB5]
          Length = 372

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 157/362 (43%), Positives = 224/362 (61%), Gaps = 29/362 (8%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + + QI DSL  +  P     + +   LSEI +    VY SI V    A   +S+R+ A+
Sbjct: 3   VTQQQIRDSLAKVMTP-RGVALTQADVLSEIAVTDGKVYFSINVDAAEARSWESVRAAAE 61

Query: 64  QIIQNIPTVKNAVVTLTENKNP----------------------------PQQRNNLNVK 95
             ++ +P V +A+  LT  + P                             +Q     V+
Sbjct: 62  AAVRAVPGVTSALAALTAERRPGAAQPPRSGVAPAAAHRPAPAGGAQSPMSKQAEIPGVR 121

Query: 96  KFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKK 155
             +AVASGKGGVGKSTT +N+A  L++ G  V +LDAD+YGPS+P+L  I  K ++ D +
Sbjct: 122 AVIAVASGKGGVGKSTTSLNLALGLRDLGLRVGLLDADIYGPSVPRLTGIQEKPQLDDSR 181

Query: 156 FLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTG 215
            + P + +G+ IMS+  LV+E   MIWRGPMV SAI  ML +V WGQLD L++DMPPGTG
Sbjct: 182 RMIPIKRFGLSIMSIGFLVEEEAPMIWRGPMVMSAITQMLRDVDWGQLDVLVVDMPPGTG 241

Query: 216 DAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGK 275
           DA LT+AQ +PL G VIVSTPQDLALID +R ++M+ K+++P++G+IENMSYFL  + G 
Sbjct: 242 DAQLTLAQNVPLKGAVIVSTPQDLALIDARRGLAMFTKVDVPVLGIIENMSYFLCPECGT 301

Query: 276 KYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
           + D+FG+GGAR EAE++G+PFL  VP  +D+R  SD G P+V    N   + IY+ I+ +
Sbjct: 302 RSDIFGHGGARHEAERLGVPFLGEVPLHIDIRAASDAGRPVVESEPNGPHAGIYRAIAGQ 361

Query: 336 IQ 337
           ++
Sbjct: 362 VR 363


>gi|170748563|ref|YP_001754823.1| MRP protein-like protein [Methylobacterium radiotolerans JCM 2831]
 gi|170655085|gb|ACB24140.1| MRP protein-like protein [Methylobacterium radiotolerans JCM 2831]
          Length = 382

 Score =  308 bits (789), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 152/361 (42%), Positives = 227/361 (62%), Gaps = 28/361 (7%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFI-VHNTVYLSITVPHTIAHQLQSLRSNA 62
           I ++ ++ +L  +++      +    RLS++ +  +N V  SI V  + A + + +R  A
Sbjct: 3   ITRDDVLKALAGITVDAAGTTLPGSGRLSQVVVDPNNRVMFSILVDPSEAERFEPVRRQA 62

Query: 63  QQIIQNIPTVKNAVVTLTENKNP--PQQRNNL-------------------------NVK 95
           +  +  +P V     +LT  +N   P Q +                            V+
Sbjct: 63  EGRVLQMPGVSGVFASLTSERNQSHPAQSSAAPRPVTPPPVAPPRPGAPPNQGPQIAGVR 122

Query: 96  KFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKK 155
             VAVASGKGGVGKSTT  N+A AL+ +G  V +LDAD+YGPS+PKL  +SGK  + D K
Sbjct: 123 HIVAVASGKGGVGKSTTACNLALALQAQGLKVGLLDADIYGPSVPKLFGLSGKPNVVDNK 182

Query: 156 FLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTG 215
            ++P   YG+K+MS+  L++   AMIWRGPMVQSAI  ML +V+WG+LD LL+DMPPGTG
Sbjct: 183 AMEPMIGYGLKVMSIGFLIEPETAMIWRGPMVQSAITQMLRDVLWGELDVLLVDMPPGTG 242

Query: 216 DAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGK 275
           DA LT+AQ  PLSG VIVSTPQDLALID +R ++M++K+ +PI+G+IENM+ F+  + G 
Sbjct: 243 DAQLTMAQATPLSGAVIVSTPQDLALIDARRGVTMFKKVAVPILGVIENMATFVCPNCGH 302

Query: 276 KYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
              +FG+GGAR EA+++G+PFL  VP +M +R  SD G P+V  + +   +++Y++I+ +
Sbjct: 303 ASHIFGHGGARIEAQRLGVPFLGEVPLNMTIRETSDSGQPVVATDPDGPHAKVYRDIAAQ 362

Query: 336 I 336
           +
Sbjct: 363 L 363


>gi|299133596|ref|ZP_07026790.1| ATPase-like, ParA/MinD [Afipia sp. 1NLS2]
 gi|298591432|gb|EFI51633.1| ATPase-like, ParA/MinD [Afipia sp. 1NLS2]
          Length = 369

 Score =  308 bits (789), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 145/358 (40%), Positives = 228/358 (63%), Gaps = 25/358 (6%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + K+ +++SL  +  P +   +   + LSEI      V+ S+TV    A   +++R+ A+
Sbjct: 3   VTKDDVLNSLAKIQTP-KGVPLPAAKVLSEITATDGKVFFSLTVDAAEARAWEAIRAQAE 61

Query: 64  QIIQNIPTVKNAVVTLTENKNPP------------------------QQRNNLNVKKFVA 99
           + ++ +P +K  +V LT  + P                         +Q+    +K  +A
Sbjct: 62  ETVRALPGIKTVMVALTAERRPGSGPTGGVKPAAAHHHGAGGDSPMGKQKAIPGIKTIIA 121

Query: 100 VASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKP 159
           VASGKGGVGKSTT +N+A  L++ G    +LDAD+YGPS+P+L  +    +++D K + P
Sbjct: 122 VASGKGGVGKSTTALNLALGLRDLGLKTGLLDADIYGPSVPRLTGVKEMPKLTDDKKMIP 181

Query: 160 KENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHL 219
            + +G+ +MS+  LV E  AMIWRGPM+QSA+  ML +V WG LD L++DMPPGTGD  L
Sbjct: 182 LQRFGLTLMSIGFLVAEETAMIWRGPMIQSAVKQMLQDVAWGDLDVLVVDMPPGTGDVQL 241

Query: 220 TIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDL 279
           ++AQ++PL+G VIVSTPQDLALID +R I+M++K+++P +G+IENMSYF+      + D+
Sbjct: 242 SLAQQVPLAGAVIVSTPQDLALIDARRGITMFKKVDVPTLGIIENMSYFMCPHCNTRSDI 301

Query: 280 FGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           FG+GGAR EAE++G+PFL  +P D+ +R  SD G P++  + +   +EIY+ I+ +I+
Sbjct: 302 FGHGGARHEAERVGVPFLGEIPLDIAIREGSDEGRPVLETDPSGKHAEIYRAIAGKIK 359


>gi|304393215|ref|ZP_07375143.1| putative protein mrp-like protein [Ahrensia sp. R2A130]
 gi|303294222|gb|EFL88594.1| putative protein mrp-like protein [Ahrensia sp. R2A130]
          Length = 402

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 160/384 (41%), Positives = 237/384 (61%), Gaps = 52/384 (13%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFI----VHNTVYLSITVPHTIAHQLQSLR 59
           I   Q++ +L  + +P  + NIV ++ +S+ FI      + + LS+TVP  +A QL+ +R
Sbjct: 3   ITSEQVLAALSAIRLPNSEENIVSLKMVSDPFISEGDAGSKIMLSLTVPADLAQQLEPVR 62

Query: 60  SNAQQIIQNIPTVKNAVVTLTENK-------------------NPPQQ------------ 88
           + AQ  ++ +P V +A+V +T  +                   NP  +            
Sbjct: 63  AQAQGALEALPGVASAMVAMTAERKLGQGVSSAGMAPPPPPRMNPTAKVGPAATKAPPAQ 122

Query: 89  -----------RNNL-NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYG 136
                       N++  VK  +AVASGKGGVGKSTT +N+A  L N+G  V +LDAD+YG
Sbjct: 123 PGPPPQAAPPKPNHVEGVKHIIAVASGKGGVGKSTTAINLALGLVNQGLKVGVLDADIYG 182

Query: 137 PSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLH 196
           PS+P+L+  + K E ++ + L+P E +G+K+MS+  LV E+  MIWRGPMV SA+  +L 
Sbjct: 183 PSVPRLVGSNVKPE-AEGRVLQPIEAHGLKVMSIGFLVAEDSPMIWRGPMVISALTQLLR 241

Query: 197 NVVWGQ----LDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQ 252
            V WG     LD L++DMPPGTGDA LT+AQ++PL+G VIVSTPQDLALID ++ ISM+ 
Sbjct: 242 EVAWGTTENPLDVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGISMFN 301

Query: 253 KMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDL 312
           K+++PI+G++ENMS F+    G++ D+FG+GGA  EA++IG PFL +VP  MD+R  SD 
Sbjct: 302 KVSVPILGVVENMSTFICPKCGERSDIFGHGGAEEEAKRIGAPFLGAVPLHMDIRSQSDA 361

Query: 313 GIPIVVHNMNSATSEIYQEISDRI 336
           G P+ V   +   ++IY EI  +I
Sbjct: 362 GTPVTVSAPDGPHAKIYNEIGAKI 385


>gi|146341632|ref|YP_001206680.1| MinD/MRP family ATPase [Bradyrhizobium sp. ORS278]
 gi|146194438|emb|CAL78463.1| putative ATPase of the MinD/MRP superfamily
           (mrp-like)(ATP/GTP-binding protein) [Bradyrhizobium sp.
           ORS278]
          Length = 390

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 151/366 (41%), Positives = 225/366 (61%), Gaps = 33/366 (9%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + + Q++++LK +  P     + +   LS I      V++SI V  + A   +  R+ A+
Sbjct: 16  VTQQQVIEALKRVRSP-RGVALPDAGVLSPITANDGKVFVSINVEASEARAWEDTRAQAE 74

Query: 64  QIIQNIPTVKNAVVTLTENK---------------------NPPQQRNNLN--------- 93
             ++ IP V  A++ LT  +                      P Q RN  +         
Sbjct: 75  AAVRAIPGVTMAMIALTAERKAGAPAAPPPRPGGVQPVAAHRPHQHRNQADSPMSRQAPI 134

Query: 94  --VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEI 151
             +   +AVASGKGGVGKSTT +N+A  L++ G  V +LDAD+YGPS+P+L  +  K E+
Sbjct: 135 PGIAAVIAVASGKGGVGKSTTAINLALGLRDLGLKVGLLDADIYGPSVPRLTGLQEKPEL 194

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           + +K + P   +G+ IMS+  LVDE+ A++WRGPMV SAI  ML +V WG LD L++DMP
Sbjct: 195 TPEKKMIPLSRFGLSIMSIGFLVDEDSALVWRGPMVMSAINQMLRDVAWGTLDVLVVDMP 254

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA LT+AQ +PL G VIVSTPQDL+LID +R ++M++K+N+P++G+IENMSYF   
Sbjct: 255 PGTGDAQLTLAQNVPLKGAVIVSTPQDLSLIDARRGLAMFRKVNVPVLGIIENMSYFQCP 314

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
           + G + D+FG+GGAR EAE++G+PFL  +P  MD+R  SD G P+V    +   + IY+ 
Sbjct: 315 ECGTRSDIFGHGGARHEAERLGVPFLGEIPLHMDIRSTSDAGRPVVESEPSGPHATIYRT 374

Query: 332 ISDRIQ 337
           I+  ++
Sbjct: 375 IASAVR 380


>gi|154247255|ref|YP_001418213.1| MRP-like protein (ATP/GTP-binding protein) [Xanthobacter
           autotrophicus Py2]
 gi|154161340|gb|ABS68556.1| MRP-like protein (ATP/GTP-binding protein) [Xanthobacter
           autotrophicus Py2]
          Length = 415

 Score =  305 bits (782), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 148/331 (44%), Positives = 217/331 (65%), Gaps = 24/331 (7%)

Query: 31  LSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKN------ 84
           LS + +    VYLSI V    A   + +R+ A+  ++ +P V +A+VTLT  +       
Sbjct: 66  LSGVVVTSGKVYLSINVDPAQARAWEGVRAAAEDAVKAVPGVVSALVTLTAERKMAPPAP 125

Query: 85  -----------------PPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNV 127
                             P+  +   V   +AVASGKGGVGKSTT +N+A AL++ G  V
Sbjct: 126 APQAAHGHGHGHSHGAPAPRGISVPGVASIIAVASGKGGVGKSTTSINLALALRDLGLKV 185

Query: 128 AILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPM 186
            +LDAD+YGPS+P+L  ++ K E + D K + P EN+G+++MS+  LV+E+  MIWRGPM
Sbjct: 186 GLLDADIYGPSVPRLSGVAQKPETTADGKTMIPLENFGLQLMSIGFLVEEDTPMIWRGPM 245

Query: 187 VQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKR 246
           V SAI  ML  V WG LD L++DMPPGTGDA LT+AQ++ L+G VIVSTPQDLALID +R
Sbjct: 246 VMSAISQMLKEVKWGPLDVLVVDMPPGTGDAQLTMAQQVNLAGAVIVSTPQDLALIDARR 305

Query: 247 AISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDV 306
            ++M++K+NIPI+G++ENMS+F+    G + D+FG+GGA  EA+K+G+PFL  +P  M +
Sbjct: 306 GVAMFEKVNIPILGVVENMSHFICPHCGGRSDIFGHGGAHAEADKMGVPFLGEIPLHMRI 365

Query: 307 RVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           R +SD G+PIV+ +  S  +  Y+ ++  ++
Sbjct: 366 REMSDAGLPIVISDPESPQTAAYRHVAQGVK 396


>gi|300024255|ref|YP_003756866.1| ATPase-like, ParA/MinD [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526076|gb|ADJ24545.1| ATPase-like, ParA/MinD [Hyphomicrobium denitrificans ATCC 51888]
          Length = 512

 Score =  305 bits (780), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 160/384 (41%), Positives = 231/384 (60%), Gaps = 51/384 (13%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I K +++ +L+ +  P   +NIV++  +SEI I  N  Y SITVP   AH+L+ LR  A+
Sbjct: 3   IEKAEVLTALRRVKGPDLTSNIVDLGLVSEILIKDNRAYFSITVPAARAHELEQLRLAAE 62

Query: 64  QIIQNIPTVKNAVVTLTENK---NPPQQRNNL---------------------------- 92
            ++  +  ++     LT      +P  +R  L                            
Sbjct: 63  AVVAELKGIQGVTAVLTAEATEGSPAPKRTVLPIGRAEHPRVQAARAKGATGDGSGPRQA 122

Query: 93  ----------------NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYG 136
                            VK+ +AVASGKGGVGKST  VN+A  L+  G  V I+DAD+YG
Sbjct: 123 AAAAAAGQGVKAQAVPGVKQIIAVASGKGGVGKSTIAVNLALGLQAIGLKVGIIDADIYG 182

Query: 137 PSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLH 196
           PS P+LL +SGK +I+  K +KP E +G+K+MSM  LVDE+  ++WRGPMV SA+  ML 
Sbjct: 183 PSQPRLLGVSGKPQIAHDKVIKPLEGWGVKVMSMGFLVDEDTPVVWRGPMVVSALSQMLR 242

Query: 197 NVVWGQ----LDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQ 252
              WG     LD L+IDMPPGTGD  L+I+Q +PLSG VIVSTPQDLALID ++ I+M++
Sbjct: 243 ETEWGGEGGELDALIIDMPPGTGDIQLSISQGVPLSGAVIVSTPQDLALIDARKGIAMFK 302

Query: 253 KMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDL 312
           ++ +PI+G++ENMSYFL    G++ D+FG+GGAR EA K+G+PFL  VP  M++R  SD 
Sbjct: 303 RVEVPILGIVENMSYFLCPKCGERSDIFGHGGARDEARKLGVPFLGEVPLRMEIREASDA 362

Query: 313 GIPIVVHNMNSATSEIYQEISDRI 336
           G P+ V    S  ++++++I+ ++
Sbjct: 363 GKPVTVAEPESKYAQLFRDIAGQV 386


>gi|85715392|ref|ZP_01046374.1| ATP-binding protein involved in chromosome partitioning
           [Nitrobacter sp. Nb-311A]
 gi|85697813|gb|EAQ35688.1| ATP-binding protein involved in chromosome partitioning
           [Nitrobacter sp. Nb-311A]
          Length = 359

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 149/340 (43%), Positives = 211/340 (62%), Gaps = 33/340 (9%)

Query: 31  LSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNP----- 85
           LSEI I    V+ SI V        + +R+NA+  ++ IP V   +V LT  + P     
Sbjct: 9   LSEIAITGGKVFFSINVEAAETKMWEDVRANAEAAVRAIPGVSVVMVALTAERKPDSSAA 68

Query: 86  ------------------PQ----------QRNNLNVKKFVAVASGKGGVGKSTTVVNIA 117
                             PQ          Q +   V   +AVASGKGGVGKSTT +N+A
Sbjct: 69  SLSPRSEQGIPHVSTRRSPQNPLSNSPMARQADIPGVAAVIAVASGKGGVGKSTTALNLA 128

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDEN 177
             L++ G  V +LDAD+YGPSIP+L  I  K +++D K + P   +G+ IMS+  L++E 
Sbjct: 129 LGLRDSGLRVGLLDADIYGPSIPRLTGICEKPQLTDDKKMAPIGRFGLAIMSVGFLIEEE 188

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            A+IWRGPMV SAI  ML +V WG+LD L++DMPPGTGDA LT+AQ +PL G VI+STPQ
Sbjct: 189 SAVIWRGPMVTSAIRQMLRDVAWGKLDVLVVDMPPGTGDAQLTLAQNVPLKGAVIISTPQ 248

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           DL+LID +R ++M++K+N+P++G+IENMS+F     G + D+FG+GGAR EAE++G+PFL
Sbjct: 249 DLSLIDARRGLAMFRKVNVPVLGIIENMSFFQCPHCGARSDIFGHGGARHEAERLGVPFL 308

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
             +P  M +R  SD G P+V    +   + IY+ I++ I+
Sbjct: 309 GEIPLHMSIRQTSDSGHPVVESQPDGPHAAIYRVIAEGIR 348


>gi|148254879|ref|YP_001239464.1| MinD/MRP family ATPase [Bradyrhizobium sp. BTAi1]
 gi|146407052|gb|ABQ35558.1| putative ATPase of the MinD/MRP superfamily
           (mrp-like)(ATP/GTP-binding protein) [Bradyrhizobium sp.
           BTAi1]
          Length = 376

 Score =  302 bits (773), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 150/365 (41%), Positives = 220/365 (60%), Gaps = 32/365 (8%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + + Q++++LK +  P     + +   LS I      V+ SI V  + A   +  R+ A+
Sbjct: 3   VTQQQVLEALKRVRSP-RGVALTDAGVLSPITANEGKVFFSINVEASEARGWEDTRAQAE 61

Query: 64  QIIQNIPTVKNAVVTLTENKNP-------------------PQQRNNL------------ 92
             ++ IP V  A++ LT  + P                   P Q  +             
Sbjct: 62  AAVRAIPGVTMAMIALTAERKPGAAPPPPRSSGVQPVSAHRPHQHQHPADSPMSRQAAIP 121

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            +   +AVASGKGGVGKSTT +N+A  L++ G  V +LDAD+YGPS+PKL  +  K +++
Sbjct: 122 GIGAVIAVASGKGGVGKSTTAINLALGLRDLGLKVGLLDADIYGPSVPKLTGLHEKPQLT 181

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
             K + P   +G+ IMS+  LV+E+  MIWRGPMV SAI  ML  V WG LD L++DMPP
Sbjct: 182 PDKKMIPLSRFGLAIMSIGFLVEEDSPMIWRGPMVMSAINQMLREVAWGTLDVLVVDMPP 241

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGDA LT+AQ +PL G VIVSTPQDL+LID +R ++M++K+N+P++G+IENMSYF    
Sbjct: 242 GTGDAQLTLAQNVPLKGAVIVSTPQDLSLIDARRGLAMFRKVNVPVLGIIENMSYFQCPQ 301

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G + D+FG+GGAR EAE++G+PFL  +P  MD+R  SD G P+V  + +   + IY+ I
Sbjct: 302 CGTRSDIFGHGGARHEAERLGVPFLGEIPLHMDIRSTSDAGTPVVESDPSGPHAAIYRTI 361

Query: 333 SDRIQ 337
           +  ++
Sbjct: 362 AASVR 366


>gi|117924001|ref|YP_864618.1| hypothetical protein Mmc1_0691 [Magnetococcus sp. MC-1]
 gi|117607757|gb|ABK43212.1| protein of unknown function DUF59 [Magnetococcus sp. MC-1]
          Length = 357

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 152/337 (45%), Positives = 222/337 (65%), Gaps = 6/337 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+Q+ + Q+ D+L+++  P    +IV    +S I I    V   +      A  L+ L+ 
Sbjct: 1   MSQVSEPQVRDALRMVVDPVAGRDIVSAGYVSGIEIHAGEVAFQLQFRPESADYLKQLQE 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIAC 118
              Q++  IP V+   VT+  + NP QQ   L   VKK +AVASGKGGVGKSTT +N+A 
Sbjct: 61  QCAQVLGAIPGVER--VTVNMSGNPQQQAEPLIPGVKKVIAVASGKGGVGKSTTTMNLAL 118

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISG--KVEISDKKFLKPKENYGIKIMSMASLVDE 176
           AL+  G  V ILDAD+YGPS+P+++ + G  ++E    + + P E YG+KIMSM   + E
Sbjct: 119 ALQQLGAKVGILDADIYGPSLPRMMGVHGIPRMEAEKGQKVTPMEKYGVKIMSMGFFMPE 178

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           +  MIWRGPMV  A+  +L ++ WG+LD+L+ID+PPGTGDA LT+ QK+PLSGVVIVSTP
Sbjct: 179 DTPMIWRGPMVGMAVEQLLRDIDWGELDYLVIDLPPGTGDAQLTLTQKVPLSGVVIVSTP 238

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QD+AL DV++ I+M++K+ +P++G+IENMSY+L ++ G + ++F +GGA  EA   G+ F
Sbjct: 239 QDVALADVRKGINMFKKVEVPVLGIIENMSYYLCTECGHRAEIFSHGGAEKEAANSGMTF 298

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           L  +P   D+R  SD G PIVV   +S  ++ Y EI+
Sbjct: 299 LGHIPISEDIRKDSDAGKPIVVARPDSPQAQQYLEIA 335


>gi|92117025|ref|YP_576754.1| ATP-binding protein involved in chromosome partitioning
           [Nitrobacter hamburgensis X14]
 gi|91799919|gb|ABE62294.1| ATP-binding protein involved in chromosome partitioning
           [Nitrobacter hamburgensis X14]
          Length = 394

 Score =  299 bits (766), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 148/340 (43%), Positives = 215/340 (63%), Gaps = 33/340 (9%)

Query: 31  LSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNP----- 85
           LSEI +  + V+ SI V  +     + +R++A+  ++ IP V  A+V LT  + P     
Sbjct: 45  LSEIVVNGDKVFFSINVEASEIRAWEEVRTHAEAAVRAIPGVSVAMVALTAERKPGSTAA 104

Query: 86  ------------------PQ---------QRNNL-NVKKFVAVASGKGGVGKSTTVVNIA 117
                             PQ         +R ++  +   +AVASGKGGVGKSTT +N+A
Sbjct: 105 SSPPRSAQGIPHVSTHRTPQNPASGSPMARRADIPGIAAVIAVASGKGGVGKSTTALNLA 164

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDEN 177
             L++    V +LDAD+YGPSIP+L  I  K  ++D+K + P   +G+ IMS+  LV+E 
Sbjct: 165 LGLRDLDLRVGLLDADIYGPSIPRLTGIREKPHLNDEKKMVPIGRFGLAIMSVGFLVEEE 224

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AMIWRGPMV SAI  ML +V WG+LD L++DMPPGTGDA LT+AQ +PL G VIVSTPQ
Sbjct: 225 SAMIWRGPMVTSAIKQMLRDVAWGELDVLVVDMPPGTGDAQLTLAQTVPLKGAVIVSTPQ 284

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           DL+LID +R ++M++K+++P++G++ENMS+F     G + D+FG+GGAR EAE++G+PFL
Sbjct: 285 DLSLIDARRGLAMFRKVDVPVLGIVENMSFFQCPHCGTRSDIFGHGGARQEAERLGVPFL 344

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
             +P  M +R  SD G P+V    +   + IY+ I+ RI+
Sbjct: 345 GEIPLHMSIRETSDSGHPVVESEPDGPHAAIYRAIAGRIR 384


>gi|67906750|gb|AAY82813.1| predicted ATPase [uncultured bacterium MedeBAC46A06]
          Length = 380

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 142/358 (39%), Positives = 226/358 (63%), Gaps = 20/358 (5%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  I ++ ++ +L  +  P +  ++VE+  +S I I  + +  ++ VP      ++ +R 
Sbjct: 10  MADITEDDVIAALSEVVDPSQGRSVVELGMVSAIHIKQSNISFALEVPAHRGPAMEPVRK 69

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPP--------------------QQRNNLNVKKFVAV 100
            A+   + IP V +A V +T +                        ++ +++ +++FVAV
Sbjct: 70  AAETAARAIPGVTSATVVVTAHSGAGAGGGEAANEAAEDGADDGVIEKVHDIKIRRFVAV 129

Query: 101 ASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPK 160
           ASGKGGVGKSTT VN+A AL+ +G  V +LDADVYGPS+P++L +SG+   +    ++P 
Sbjct: 130 ASGKGGVGKSTTAVNLAIALRLEGLRVGLLDADVYGPSLPRMLGVSGRPASAGGDMVRPL 189

Query: 161 ENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLT 220
           ENYG+ +MSM  LV ++ AMIWRGPMVQSA+  ML +V WG LD ++ID+PPGTGD  ++
Sbjct: 190 ENYGVHLMSMGLLVPDDTAMIWRGPMVQSALTQMLDSVAWGTLDVIVIDLPPGTGDIQIS 249

Query: 221 IAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLF 280
           +AQ++ L+G V+VSTPQD+AL+DV +AI+M+ K  +PI+GM++NM+Y+   D G+   +F
Sbjct: 250 LAQQVNLTGAVVVSTPQDIALLDVVKAITMFDKAEVPILGMVQNMAYWACPDCGRTDHIF 309

Query: 281 GNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           G+GG   EA K GI  L  +P  ++VR   D G P+VV +  S  ++ Y+ I+ R+ +
Sbjct: 310 GDGGVADEAGKRGIELLGEIPLSLEVRTGGDSGTPVVVASPRSEQAKTYRSIARRLME 367


>gi|163793365|ref|ZP_02187340.1| ATPase involved in chromosome partitioning [alpha proteobacterium
           BAL199]
 gi|159181167|gb|EDP65682.1| ATPase involved in chromosome partitioning [alpha proteobacterium
           BAL199]
          Length = 381

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 142/362 (39%), Positives = 221/362 (61%), Gaps = 24/362 (6%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + +  + ++L  ++ PG    +  +  +S + I    +  ++ V      QL+ LR 
Sbjct: 1   MASVSEEAVREALAGVTDPGGAGGLPVLAAVSGVVIKDGNIGFALEVDPARGPQLEGLRK 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNP------------------------PQQRNNLNVKK 96
            A+  +  I  V +A   LT ++                          P + N   ++ 
Sbjct: 61  AAEAAVLAIDGVTSATAVLTAHRQGAGQTRAPAPAAQGHRHAHGGQGAGPSKVNVDGIRS 120

Query: 97  FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKF 156
            VAVASGKGGVGKST   N+A AL  +G  + +LDADVYGPS+P+++ I+GK +  D K 
Sbjct: 121 IVAVASGKGGVGKSTVATNLALALSAQGLRIGLLDADVYGPSLPRMMAITGKPQSKDGKT 180

Query: 157 LKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGD 216
           L P  N+GIK MS+  +V E+   IWRGPMV SA+  ML +V WG+LD L++DMPPGTGD
Sbjct: 181 LIPLVNHGIKCMSIGFMVAEDTPTIWRGPMVMSALEQMLRDVEWGELDMLVVDMPPGTGD 240

Query: 217 AHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKK 276
           A LT+AQ++PL+G VIVSTPQD+AL+D ++ ++M++++++P++G++ENMSYFL    G++
Sbjct: 241 AQLTMAQRVPLTGSVIVSTPQDIALLDARKGLNMFRRVDVPVLGIVENMSYFLCPHCGER 300

Query: 277 YDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            ++FG+GGAR EAE++G+PFL  +P  + +RV  D G PIV    +S  S  +  ++D +
Sbjct: 301 SEIFGHGGARQEAERLGVPFLGEIPLHLSIRVAGDSGTPIVAAEPDSPHSLAFSAVADAV 360

Query: 337 QQ 338
            +
Sbjct: 361 WR 362


>gi|83312586|ref|YP_422850.1| chromosome partitioning ATPase [Magnetospirillum magneticum AMB-1]
 gi|82947427|dbj|BAE52291.1| ATPase involved in chromosome partitioning [Magnetospirillum
           magneticum AMB-1]
          Length = 390

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 221/351 (62%), Gaps = 15/351 (4%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M ++ + QI+++L  +  P  K +IV +  +S + +    V  +I V       L+ LR 
Sbjct: 21  MAEVTEQQIIEALSRIIDPDRKADIVGLGMVSGLTLKGGHVAFAIEVDPQRGPHLEPLRK 80

Query: 61  NAQQIIQNIPTVKNAVVTLTENKN-------PPQQRNN--------LNVKKFVAVASGKG 105
            A++ + ++P V +    LT  +N        PQ  +          NVK  VA+ASGKG
Sbjct: 81  AAEKAVHDLPGVLSVSAVLTAERNTQGGPKGAPQGGHGHQAEKPLLPNVKAIVAIASGKG 140

Query: 106 GVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGI 165
           GVGKSTT  NIA AL   G  V + DAD++GPS+P++L I+G+    D + + P ENYG+
Sbjct: 141 GVGKSTTATNIAMALSRMGLKVGLFDADIFGPSMPRMLGITGEPVSPDGQTMMPMENYGV 200

Query: 166 KIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKI 225
           K MSM  LV E+  +IWRGPMV  A+  +L +V WG+LD ++IDMPPGTGD  LT+ Q++
Sbjct: 201 KCMSMGFLVPEDSPIIWRGPMVMGALEQLLRDVHWGELDVMIIDMPPGTGDTQLTMTQRV 260

Query: 226 PLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGA 285
           PL+G VIVSTPQD+AL+D  + ++M++K+++P++G+IENMSY++    G +  +FG+GGA
Sbjct: 261 PLTGAVIVSTPQDIALLDATKGLNMFRKVDVPVLGIIENMSYYICPKCGDEAHIFGHGGA 320

Query: 286 RFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           + EA ++   FL  +P D+ +R  +D G PIV+   NS  +++Y EI+ RI
Sbjct: 321 KAEAARLSADFLGEIPLDISIRQTADAGEPIVISKPNSPHAKVYMEIAARI 371


>gi|170744038|ref|YP_001772693.1| MRP protein-like protein [Methylobacterium sp. 4-46]
 gi|168198312|gb|ACA20259.1| MRP protein-like protein [Methylobacterium sp. 4-46]
          Length = 374

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 148/355 (41%), Positives = 217/355 (61%), Gaps = 24/355 (6%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFI-VHNTVYLSITVPHTIAHQLQSLRSNA 62
           I +  ++ +L  +++  +   +    RLSEI I   + V  SI +  + A   +++R  A
Sbjct: 3   ITREDVLQALSGVTVDQKGTPLPASGRLSEIVIGPGDRVMFSIGIDPSEAEAFEAVRRAA 62

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL------------------NVKKFVAVASGK 104
           +  +  +P V  A+ +LT  +  PQ R                      ++  VAVASGK
Sbjct: 63  EVAVLRLPGVTGALASLTSER--PQARPQPPKRPAGPGGAPRPGPALPGIRHVVAVASGK 120

Query: 105 GGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGK---VEISDKKFLKPKE 161
           GGVGKSTT  N+A ALK +G  V +LDAD+YGPS+PKL  +  K   V   + + + P  
Sbjct: 121 GGVGKSTTACNLALALKAQGLKVGLLDADIYGPSVPKLFGLDRKPETVSTPEGQRIVPLS 180

Query: 162 NYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTI 221
            YG+ +MS+  L+    AMIWRGPMVQSA+  +L  V WG LD L++DMPPGTGDA LT+
Sbjct: 181 GYGMPVMSIGFLIQAETAMIWRGPMVQSALTQLLREVAWGDLDVLVVDMPPGTGDAQLTL 240

Query: 222 AQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFG 281
           AQ  PL+G VIVSTPQDLALID +R ++M++++ +PI+G++ENM+ F+    G+   +FG
Sbjct: 241 AQATPLAGAVIVSTPQDLALIDARRGVTMFKRVEVPILGIVENMATFVCPHCGQASAIFG 300

Query: 282 NGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +GGAR EAE++G+PFL  VP  M +R  SD G P+V  + +   + IY+EI+ R+
Sbjct: 301 HGGARHEAERLGVPFLGEVPLTMAIRESSDAGRPVVAVDPDGPQAAIYREIAARL 355


>gi|296447131|ref|ZP_06889063.1| ATPase-like, ParA/MinD [Methylosinus trichosporium OB3b]
 gi|296255400|gb|EFH02495.1| ATPase-like, ParA/MinD [Methylosinus trichosporium OB3b]
          Length = 364

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 148/346 (42%), Positives = 221/346 (63%), Gaps = 16/346 (4%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           +  I+ +L+ +S PG K+ IV    +S I +    V++S++     A +L+ L    +  
Sbjct: 4   EAAILKALESVSGPGGKS-IVAAGLVSGINVSGGKVFVSLSGDPARAKELEVLAVAVEGA 62

Query: 66  IQNIPTVKNAVVTLTENKNPPQQRNNL-------------NVKKFVAVASGKGGVGKSTT 112
           ++ +P V+ A+VTLT  K P                     +K  VAV+SGKGGVGKSTT
Sbjct: 63  VKTVPGVEAAIVTLTAEKAPAPAAPPPGQAPQRKPIAAIEKIKYIVAVSSGKGGVGKSTT 122

Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMA 171
             N+A  L   G  V +LDAD++GPS P+L  + G K E+ D + + P E YG+K+MS+ 
Sbjct: 123 SANLALGLSALGWRVGLLDADIFGPSAPRLFGLGGQKPEVVDNRLV-PLEAYGVKVMSIG 181

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
            LVDE+V MIWRGPMV  A+  +L  V WG+LD L++DMPPGTGD  LT+AQ++PL+G V
Sbjct: 182 FLVDEDVPMIWRGPMVVQALGQLLGEVAWGELDALVVDMPPGTGDVQLTMAQQVPLAGAV 241

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEK 291
           +VSTPQDLALID +R ++M+Q++  PI+G++ENMSYFL    G + D+F +GGAR +AE 
Sbjct: 242 VVSTPQDLALIDARRGVAMFQRVETPILGVVENMSYFLCPHCGGRTDIFSHGGARQDAEA 301

Query: 292 IGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           +G+PFL  VP D+ +R  SD G P+V  +     + +Y +++++++
Sbjct: 302 LGVPFLGEVPLDLAIRETSDAGTPVVATDPKGKYAAVYIDLAEKVK 347


>gi|75675408|ref|YP_317829.1| ATP-binding protein involved in chromosome partitioning
           [Nitrobacter winogradskyi Nb-255]
 gi|74420278|gb|ABA04477.1| ATP-binding protein involved in chromosome partitioning
           [Nitrobacter winogradskyi Nb-255]
          Length = 379

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 154/340 (45%), Positives = 211/340 (62%), Gaps = 33/340 (9%)

Query: 31  LSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNP----- 85
           LSEI I  + V+ SI+V    +   + +R NAQ  ++ IP V   +V LT  + P     
Sbjct: 29  LSEIAINGDKVFFSISVEAEESKSWEEVRVNAQAAVRAIPGVSAVMVALTAERKPDRATA 88

Query: 86  ------------------PQ----------QRNNLNVKKFVAVASGKGGVGKSTTVVNIA 117
                             PQ          Q +   V   VAVASGKGGVGKSTT +N+A
Sbjct: 89  GLPPGSEQGIPHVSTRRSPQHPASGSPMARQADIPGVAAVVAVASGKGGVGKSTTALNLA 148

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDEN 177
             L++ G  V +LDAD+YGPSIP+L  I  K  ++D K + P E +G+ IMS+  L++E 
Sbjct: 149 LGLRDSGLRVGLLDADIYGPSIPRLTGIREKPRLTDDKKIVPIERFGLAIMSVGFLIEEE 208

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            A+IWRGPMV SAI  ML +VVWG LD L++DMPPGTGDA LT+AQ +PL G VIVSTPQ
Sbjct: 209 SAVIWRGPMVTSAIRQMLRDVVWGDLDVLVVDMPPGTGDAQLTLAQNVPLKGAVIVSTPQ 268

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           DL+LID +R ++M++K+N+P+ G+IENMS+F     G + D+FG+GGAR EAE++G+PFL
Sbjct: 269 DLSLIDARRGLAMFRKVNVPVFGIIENMSFFQCPHCGGRSDIFGHGGARHEAERLGVPFL 328

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
             VP  M +R  SD G P+V    +   + IY+ ++  I+
Sbjct: 329 GEVPLHMSIRETSDSGDPVVESEPDGPHAAIYRAMAASIR 368


>gi|23015795|ref|ZP_00055562.1| COG0489: ATPases involved in chromosome partitioning
           [Magnetospirillum magnetotacticum MS-1]
          Length = 372

 Score =  295 bits (755), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 145/353 (41%), Positives = 222/353 (62%), Gaps = 17/353 (4%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M ++ + QIV++L  +  P  K +IV +  +S + + +  V  +I V       L+ LR 
Sbjct: 1   MAEVTEQQIVEALSRIIDPDRKADIVSLGMVSGLAVKNGHVAFAIEVDAQRGPHLEPLRK 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKN-------PPQQRNNL----------NVKKFVAVASG 103
            A++ + ++P V +    LT  +N        PQ  +            +VK  VA+ASG
Sbjct: 61  AAEKAVHDLPGVLSVSAVLTAERNTQGGPKGAPQGGHGHGHQAEQPLLPSVKAIVAIASG 120

Query: 104 KGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENY 163
           KGGVGKSTT  NIA AL   G  V + DAD++GPS+P++L I+G+    D + + P ENY
Sbjct: 121 KGGVGKSTTATNIAMALSRMGLKVGLFDADIFGPSMPRMLGITGEPVSPDGQTMMPMENY 180

Query: 164 GIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQ 223
           G+K MSM  LV E+  +IWRGPMV  A+  +L +V WG+LD ++IDMPPGTGD  LT+ Q
Sbjct: 181 GVKCMSMGFLVPEDSPIIWRGPMVMGALEQLLRDVHWGELDVMIIDMPPGTGDTQLTMTQ 240

Query: 224 KIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNG 283
           ++PL+G VIVSTPQD+AL+D  + ++M++K+++P++G+IENMSY++    G +  +FG+G
Sbjct: 241 RVPLTGAVIVSTPQDIALLDATKGLNMFRKVDVPVLGIIENMSYYICPKCGDEAHIFGHG 300

Query: 284 GARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           GA+ EA ++   FL  VP D+ +R  +D G PIV+   NS  +++Y EI+ +I
Sbjct: 301 GAKAEAARLSADFLGEVPLDISIRQTADAGEPIVISKPNSPHAKVYMEIAAKI 353


>gi|288958199|ref|YP_003448540.1| ATP-binding protein involved in chromosome partitioning
           [Azospirillum sp. B510]
 gi|288910507|dbj|BAI71996.1| ATP-binding protein involved in chromosome partitioning
           [Azospirillum sp. B510]
          Length = 389

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 153/371 (41%), Positives = 225/371 (60%), Gaps = 33/371 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M QI + Q++ +LK +  P    +IV +  LS + +    V  SI V      Q + +R 
Sbjct: 1   MAQISEAQVMQALKTVIDPDRGGDIVSLGMLSGLVVRDGHVAFSIEVDPKRGAQAEPVRH 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENK---------------------------------NPPQ 87
            A++ +  +P V +    LT ++                                   PQ
Sbjct: 61  AAEKAVDALPGVLSVTAVLTAHRAAAPQAAPQQGHSHGGPGHSHGHSHGHSQGAPQTDPQ 120

Query: 88  QRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG 147
           +     VK  VAVASGKGGVGKSTT  N+A AL   G  V +LDAD+YGPS+P+++ I+G
Sbjct: 121 KPLVPGVKAIVAVASGKGGVGKSTTSANLALALAANGLKVGLLDADIYGPSMPRMMGIAG 180

Query: 148 KVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLL 207
           +    D K L+P ENYG+K+MSM  LV E+  MIWRGPMV SA+  ML +V WG LD L+
Sbjct: 181 RPNSPDGKRLEPMENYGVKVMSMGFLVAEDTPMIWRGPMVMSALQQMLRDVNWGTLDVLV 240

Query: 208 IDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSY 267
           +DMPPGTGDA LT+AQ++PL+G VIVSTPQD+AL+D ++ ++M++++++P++G+IENMSY
Sbjct: 241 VDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDIALLDARKGLNMFRRVDVPVLGIIENMSY 300

Query: 268 FLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSE 327
           F   + G + D+F +GGAR EA+ +G+ FL  +P  + +R  SD G PIVV   +S  ++
Sbjct: 301 FCCPNCGHRTDIFSHGGARKEADDLGMEFLGEIPLHLSIRETSDQGQPIVVSQPDSEHAQ 360

Query: 328 IYQEISDRIQQ 338
            Y+ I+ R+ +
Sbjct: 361 SYRRIATRLWE 371


>gi|323136468|ref|ZP_08071550.1| ATPase-like, ParA/MinD [Methylocystis sp. ATCC 49242]
 gi|322398542|gb|EFY01062.1| ATPase-like, ParA/MinD [Methylocystis sp. ATCC 49242]
          Length = 374

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 143/304 (47%), Positives = 194/304 (63%), Gaps = 27/304 (8%)

Query: 63  QQIIQNIPTVKNAVVTLTENKNP---------------------PQQRNNL-----NVKK 96
           +  ++ I  V+ AVVTLT  + P                     P  R  L      ++ 
Sbjct: 58  ETAVKAIAGVEAAVVTLTAERAPRAAGHSHAHDHHGHSHGAPAAPPPRKGLAPALEKIRF 117

Query: 97  FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKF 156
            +AVASGKGGVGKSTT  N+A  L  +G  V +LDAD+YGPS+P+L  +S K  +   K 
Sbjct: 118 IIAVASGKGGVGKSTTSANLALGLAAQGWRVGLLDADIYGPSMPRLFGLSQKPAVEGGKL 177

Query: 157 LKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGD 216
           + P E YGIKIMSM  LVDENV M+WRGPMV  A+  ML  V WG+LD L++DMPPGTGD
Sbjct: 178 V-PLEAYGIKIMSMGLLVDENVPMVWRGPMVTQALTQMLGEVKWGELDALVVDMPPGTGD 236

Query: 217 AHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKK 276
             LT+AQ++PL+G VIVSTPQDLALID +RA++M+QK+  P++G+IENMSYFL    G +
Sbjct: 237 VQLTLAQQVPLAGAVIVSTPQDLALIDARRAVAMFQKVEAPVLGIIENMSYFLCPHCGGR 296

Query: 277 YDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            ++F +GGAR +AEK+G+PFL   P D+ +R  SD G P+V    NS  + +Y  ++ ++
Sbjct: 297 SEIFAHGGARHDAEKMGVPFLGEAPLDIKIRETSDSGRPVVGAEPNSPQAAVYLNLAAKV 356

Query: 337 QQFF 340
           +   
Sbjct: 357 KTLL 360


>gi|84514363|ref|ZP_01001727.1| probable multidrug-resistance related protein [Loktanella
           vestfoldensis SKA53]
 gi|84511414|gb|EAQ07867.1| probable multidrug-resistance related protein [Loktanella
           vestfoldensis SKA53]
          Length = 363

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 150/341 (43%), Positives = 210/341 (61%), Gaps = 10/341 (2%)

Query: 2   NQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSN 61
           N+ L + I   L  + +P +   +    R++ +      V LSI +    A     LR  
Sbjct: 5   NRDLDDDISGVLGAMLLP-DGQPLGTSGRIAGLNQSGGRVSLSIQITPEEAGAFAPLRDT 63

Query: 62  AQQIIQNIPTVKNAVVTLT-ENKNPPQQRNNL--------NVKKFVAVASGKGGVGKSTT 112
            +  ++ +  V +A V LT E   PP+             +V+  +AVASGKGGVGKSTT
Sbjct: 64  LEARLRTLAGVTSAFVVLTAERAAPPKLVAQTPAKIDPLDSVRHVIAVASGKGGVGKSTT 123

Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMAS 172
            VN+  AL   G  V ILDAD+YGPS+P LL + GK  + + + L+P   YG++ MSM  
Sbjct: 124 TVNLGLALVAMGLRVGILDADIYGPSLPTLLGLHGKPGMGEGRKLRPMRAYGLQAMSMGL 183

Query: 173 LVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVI 232
           LV+   AM+WRGPMV SAI  M+ +V WG LD LL+DMPPGTGDA L +AQ   L+G VI
Sbjct: 184 LVEPETAMVWRGPMVMSAITQMMADVEWGALDVLLVDMPPGTGDAQLALAQGTRLAGAVI 243

Query: 233 VSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKI 292
           VSTPQDL+LIDV+R I+M++K+++PI+G+IENMS F+  D G  + +FG+GGAR EA ++
Sbjct: 244 VSTPQDLSLIDVRRGIAMFRKVDVPILGVIENMSQFICPDCGSSHAIFGDGGARTEATRL 303

Query: 293 GIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
            +PFL +VP  M +R  SD G PIV  + +     IY++I+
Sbjct: 304 AVPFLGAVPLTMALRAASDAGQPIVARDPDGPLGRIYKDIA 344


>gi|298290888|ref|YP_003692827.1| ATPase-like, ParA/MinD [Starkeya novella DSM 506]
 gi|296927399|gb|ADH88208.1| ATPase-like, ParA/MinD [Starkeya novella DSM 506]
          Length = 396

 Score =  291 bits (745), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 149/368 (40%), Positives = 219/368 (59%), Gaps = 45/368 (12%)

Query: 13  LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTV 72
           L  +S P +   + E   LSEI +    VY+SITV    A   + +R+  ++ ++  P V
Sbjct: 11  LAQVSAP-DGRPVTETGALSEILVSDGKVYMSITVDAGEAQAWEPVRAAVERTVRGTPGV 69

Query: 73  KNAVVTLTENK------------------------------------------NPPQQRN 90
            +A+V LT  +                                          +P ++  
Sbjct: 70  TSALVALTAERKAGSAPAGGSSTQPVRVSGQGGQGGGHAGHSHAGHAHAQPPADPQKESP 129

Query: 91  NL-NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV 149
            L  V   +AVASGKGGVGKST   N+A  L   G  V +LDAD+YGPS+P+L+ + G+ 
Sbjct: 130 GLPGVGAIIAVASGKGGVGKSTLAANLALGLAASGLRVGLLDADIYGPSVPRLMGLKGRP 189

Query: 150 EISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID 209
           ++   + + P   +G+K+MS+  LVDE   MIWRGPMV SAI  +L  V W  LD L++D
Sbjct: 190 DV-QGRMITPMHAFGLKVMSIGFLVDEETPMIWRGPMVMSAISQLLKEVNWAPLDVLVVD 248

Query: 210 MPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFL 269
           MPPGTGDA LT+AQ++PL+G VIVSTPQDLALID +R I+M++K+N+P++G++ENMSYFL
Sbjct: 249 MPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARRGIAMFEKVNVPVLGIVENMSYFL 308

Query: 270 ASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
               G + D+FG+GGAR EA++  +PFL  VP  + +R  SD G+PIV    +S  ++IY
Sbjct: 309 CPHCGGRSDIFGHGGARHEAQRFNVPFLGEVPLHLSIRETSDAGLPIVATRPDSHEAQIY 368

Query: 330 QEISDRIQ 337
           ++I++ ++
Sbjct: 369 RDIANSVR 376


>gi|144897722|emb|CAM74586.1| Protein of unknown function DUF59 [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 372

 Score =  289 bits (740), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 144/352 (40%), Positives = 224/352 (63%), Gaps = 16/352 (4%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  I ++Q++++LK +  P +  +IV +  +S + +    V  +I V      +L+ LR 
Sbjct: 1   MAVISESQVIEALKTIVDPDKGADIVSLGMVSGVVVKDGHVTFAIEVEPERGPKLEPLRK 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKN---------------PPQQRNNL-NVKKFVAVASGK 104
            A++ + ++  V      LT  ++               P  +R  L +VK  +AVASGK
Sbjct: 61  AAEKAVHDLAGVLTVSAVLTAERHVHGGPKGGHDHGHGQPGAERPLLPDVKAIIAVASGK 120

Query: 105 GGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYG 164
           GGVGKSTT  N+A AL  +G  V + DAD+YGPS+P++L I G+    D + L P E+YG
Sbjct: 121 GGVGKSTTATNLAMALSQQGLKVGLFDADIYGPSMPRMLGIEGEPVSPDGQTLLPMESYG 180

Query: 165 IKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQK 224
           +K MS+  LV E+  +IWRGPMV  AI  +L +V WG+LD ++IDMPPGTGD  LTI+Q 
Sbjct: 181 VKCMSIGFLVPEDSPIIWRGPMVMGAIQQLLRDVQWGELDVMVIDMPPGTGDTQLTISQN 240

Query: 225 IPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGG 284
           +PL+G VIVSTPQD+AL+D ++ ++M++K++IP++G+IENMSY++    G +  +FG+GG
Sbjct: 241 LPLTGAVIVSTPQDIALLDARKGLNMFRKVDIPVLGIIENMSYYICPKCGDEAHIFGHGG 300

Query: 285 ARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           A+ EA K+   FL  VP D+ +R  +D G PIVV   +S+ ++ Y++I+ ++
Sbjct: 301 AKAEAAKLSCDFLGEVPLDIVIRETADRGEPIVVSKPSSSHAKAYRDIAKKV 352


>gi|27378853|ref|NP_770382.1| multidrug-resistance related protein [Bradyrhizobium japonicum USDA
           110]
 gi|27352002|dbj|BAC49007.1| mrp [Bradyrhizobium japonicum USDA 110]
          Length = 389

 Score =  289 bits (740), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 151/367 (41%), Positives = 217/367 (59%), Gaps = 34/367 (9%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + + Q++DSL  +  P     +     LS I      V+ SI V    A   +++R+ A+
Sbjct: 14  VTQQQVLDSLARIKSP-RGVALPNANVLSAISASDGKVFFSINVDAAEARAWEAVRAEAE 72

Query: 64  QIIQNIPTVKNAVVTLTENKN-------------------------PPQ--------QRN 90
             ++ IP     +V LT  +                          PPQ        Q  
Sbjct: 73  AAVRAIPGATTVMVALTAERKPGSAPPPPPTPSRGTPGVQPVHAHKPPQGGGSPMARQSE 132

Query: 91  NLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVE 150
              V   +AVASGKGGVGKSTT +N+A  L++ G  V +LDAD+YGPS+P+L  +  K E
Sbjct: 133 IPGVAAVIAVASGKGGVGKSTTALNLALGLRDLGLKVGLLDADIYGPSVPRLTGLRDKPE 192

Query: 151 ISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDM 210
           +  ++ + P   +G+ IMS+  LV+E  AMIWRGPMV SA+  ML +V WG LD L++DM
Sbjct: 193 LDGERKMIPLRRFGLAIMSIGFLVEEETAMIWRGPMVMSAVTQMLRDVAWGSLDVLVVDM 252

Query: 211 PPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLA 270
           PPGTGDA LT+AQ +PL G VIVSTPQDL+LID +R ++M++K+N+P++G++ENMSYF  
Sbjct: 253 PPGTGDAQLTLAQNVPLKGAVIVSTPQDLSLIDARRGLAMFRKVNVPVLGIVENMSYFQC 312

Query: 271 SDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQ 330
              G K D+FG+GGAR EAEK+G+PFL  +P  M +R  SD G P+V    +   + IY+
Sbjct: 313 PHCGTKSDIFGHGGARHEAEKLGVPFLGEIPLHMAIRATSDAGNPVVDSEPDGPHAAIYR 372

Query: 331 EISDRIQ 337
            I+ +++
Sbjct: 373 AIAGQVR 379


>gi|119094132|gb|ABL60962.1| ATPase [uncultured marine bacterium HF10_19P19]
          Length = 366

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 223/351 (63%), Gaps = 18/351 (5%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  + + QI+ +L  +  P +  +IV +  +  I I  + +   + VP      ++ +R 
Sbjct: 1   MQAVTEEQILAALSAVQDPSQNKDIVALGLVQAIQIKDSNISFMLVVPPHRGPAMEPIRK 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPP---------------QQRNNL---NVKKFVAVAS 102
            A+Q+  +I  V +A V +T +++                 Q +  +    V++F+AVAS
Sbjct: 61  RAEQVALSIEGVTSATVLVTAHESRADGLSASSSSGGAADRQVKEKILESKVRRFIAVAS 120

Query: 103 GKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKEN 162
           GKGGVGKSTT VN+A ALK +G  V +LDADVYGPS P++L +SGK        + P EN
Sbjct: 121 GKGGVGKSTTAVNLAIALKLEGLRVGLLDADVYGPSQPRMLGVSGKPPAVGGDMVAPLEN 180

Query: 163 YGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIA 222
           YGIK+MSM  LV ++ AMIWRGPMVQSA+  ML++V WG+LD ++ID+PPGTGD  +++A
Sbjct: 181 YGIKLMSMGLLVPDDTAMIWRGPMVQSALTQMLNSVAWGELDVIVIDLPPGTGDIQISLA 240

Query: 223 QKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGN 282
           Q++ L+G VIVSTPQD+AL+DV +A++M++K  +PI+GMI+NM+ +   D G+   +FG 
Sbjct: 241 QQVNLAGAVIVSTPQDIALLDVVKALTMFEKAKVPILGMIQNMAVWHCPDCGRVDHIFGE 300

Query: 283 GGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           GGA  EA + GI  +  +P  + VR  SD G+P+++   +SA +  Y++I+
Sbjct: 301 GGAAEEASRRGIDLIGDIPLSLAVRQGSDSGLPVILSEPHSAHAAAYKQIA 351


>gi|159043062|ref|YP_001531856.1| MRP-like protein [Dinoroseobacter shibae DFL 12]
 gi|157910822|gb|ABV92255.1| MRP-like protein [Dinoroseobacter shibae DFL 12]
          Length = 348

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 152/322 (47%), Positives = 203/322 (63%), Gaps = 10/322 (3%)

Query: 30  RLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKN--PP- 86
           ++S   +    + LSI      A  L   RS A+  ++ IP  + A VTLT +    PP 
Sbjct: 12  QVSGPVLSGGRISLSIMTTAAGAASLGETRSKAEAALRAIPGAETAFVTLTNDAAAAPPV 71

Query: 87  -QQRNNLN------VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSI 139
            +Q N         V   VAVASGKGGVGKSTT VN+A  L+  G  V ILDAD++GPSI
Sbjct: 72  LKQPNAAKPAVLAEVAHVVAVASGKGGVGKSTTAVNLALGLRANGLKVGILDADIHGPSI 131

Query: 140 PKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVV 199
           P LL + G+  +   + L P ++ GI  MSM  +VD   AM+WRGPMV SAI  ML  V 
Sbjct: 132 PTLLALHGQPRMGKDRRLLPMQSNGISAMSMGMMVDAETAMVWRGPMVMSAITQMLAEVN 191

Query: 200 WGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPII 259
           WG LD L++DMPPGTGDA L IAQ   L+G VIVSTPQDLALID +R I+M++K+++PI+
Sbjct: 192 WGALDVLIVDMPPGTGDAQLAIAQGTKLAGAVIVSTPQDLALIDARRGIAMFKKVDVPIL 251

Query: 260 GMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVH 319
           G+IENM++F  +D GK++ LFG GGA  EA+++ +PFL +VP  MD+R  SD G PIVV 
Sbjct: 252 GLIENMAHFTCNDCGKQHALFGTGGAEAEAKRLNVPFLGAVPLTMDLRAASDSGQPIVVR 311

Query: 320 NMNSATSEIYQEISDRIQQFFV 341
           +      ++Y E++  +    V
Sbjct: 312 DPEGPLGKLYVEMAGALWANLV 333


>gi|56696679|ref|YP_167040.1| Mrp/NBP35 family protein [Ruegeria pomeroyi DSS-3]
 gi|56678416|gb|AAV95082.1| Mrp/NBP35 family protein [Ruegeria pomeroyi DSS-3]
          Length = 353

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 137/342 (40%), Positives = 216/342 (63%), Gaps = 13/342 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+  ++ +LK ++ P    +IV    +  + +  +TV   I +   +A +++ +R+ A++
Sbjct: 3   LREAVLANLKKITDPVSGQDIVSAGIVRALNVEGDTVRFVIEIDPKLAERMEPVRAAAEK 62

Query: 65  IIQNIPTVK--NAVVTLTENKNPPQQRNNL-----------NVKKFVAVASGKGGVGKST 111
             Q +  V   +A++T   +K PP+ +               V + VAVASGKGGVGKST
Sbjct: 63  AAQMVEGVAKVSAMMTAHSDKAPPELKPRAKAAPQGPQPVAGVDRIVAVASGKGGVGKST 122

Query: 112 TVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMA 171
              N+ACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MSM 
Sbjct: 123 VSANLACALAAEGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPLRNHGVTMMSMG 182

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
            + +E  A++WRGPM+  A+  M++ V WG LD L++D+PPGTGD  LT++QK  + G +
Sbjct: 183 LMTNEGQAVVWRGPMLMGALQQMMNQVQWGGLDVLIVDLPPGTGDVQLTLSQKFAVDGAI 242

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEK 291
           IVSTPQD+ALID ++ I M++++  PI+GMIENMS  + S+ G +  +FG+GG   EAEK
Sbjct: 243 IVSTPQDVALIDARKGIDMFRQLKTPILGMIENMSTHICSNCGHEEHVFGHGGVAAEAEK 302

Query: 292 IGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           +G+P L  +P  +D+RV +D G PIVV   +S  +E ++ I+
Sbjct: 303 LGVPLLGEIPLHLDIRVAADGGAPIVVSKPDSPQAEAFRRIA 344


>gi|258543541|ref|YP_003188974.1| iron-sulfur cluster assembly/repair protein ApbC [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256634619|dbj|BAI00595.1| iron-sulfur cluster assembly/repair protein ApbC [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256637675|dbj|BAI03644.1| iron-sulfur cluster assembly/repair protein ApbC [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256640729|dbj|BAI06691.1| iron-sulfur cluster assembly/repair protein ApbC [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643784|dbj|BAI09739.1| iron-sulfur cluster assembly/repair protein ApbC [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646839|dbj|BAI12787.1| iron-sulfur cluster assembly/repair protein ApbC [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649892|dbj|BAI15833.1| iron-sulfur cluster assembly/repair protein ApbC [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652882|dbj|BAI18816.1| iron-sulfur cluster assembly/repair protein ApbC [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655936|dbj|BAI21863.1| iron-sulfur cluster assembly/repair protein ApbC [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 371

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 211/345 (61%), Gaps = 24/345 (6%)

Query: 19  PGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVT 78
           P    N++    L    +    + ++  V    A  + +L ++A + ++ +P V++A + 
Sbjct: 22  PQTGKNLLAYGHLEGCSLTEGKLSVAFAVAREHAQTISALCNDAARQLETLPGVQSASII 81

Query: 79  LTENKN--------------------PPQQRNNL---NVKKFVAVASGKGGVGKSTTVVN 115
           LT ++                      P   N      VK  +AVASGKGGVGKSTT  N
Sbjct: 82  LTAHRPAGAAAKPKAATGGHRPLGGMAPADGNAPILPGVKTIIAVASGKGGVGKSTTATN 141

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVD 175
           +A  L  +G  V +LDAD++GPS+ ++L  +GK E+ D K L+P E +GIK +S+  LVD
Sbjct: 142 LAVGLGLEGLKVGLLDADIHGPSLHRMLGATGKPEVIDGK-LQPVEAWGIKAVSLGMLVD 200

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
           E  AMIWRGPMV  AI  +L +V WG LD +++D+PPGTGDA L++ QK+PL+G VIVST
Sbjct: 201 EKAAMIWRGPMVMGAINQLLTDVTWGDLDVMVVDLPPGTGDAQLSLTQKVPLTGAVIVST 260

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQD+ALID +R ++M++K+N+P++G+IENMSYF   + G   +LFG+GGA+ EAE +G+P
Sbjct: 261 PQDIALIDARRGVTMFEKVNVPVLGLIENMSYFCCPNCGHNTELFGHGGAKKEAEAMGVP 320

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
           FL  VP   D+R   D G+P ++ N +   ++ ++ I+  + +  
Sbjct: 321 FLGEVPLLADIRASGDKGVPGIIENPDGEGAKAWRHIAHTVAEML 365


>gi|329113254|ref|ZP_08242037.1| Protein Mrp-like protein [Acetobacter pomorum DM001]
 gi|326697395|gb|EGE49053.1| Protein Mrp-like protein [Acetobacter pomorum DM001]
          Length = 389

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 208/345 (60%), Gaps = 24/345 (6%)

Query: 19  PGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVT 78
           P    N++    L    +    + ++  V    A  + +L   A + ++ +P V++A + 
Sbjct: 40  PQTGKNLLAYGHLEGCSLTEGKLSVAFAVAREHAQTISALCDGAARQLETLPGVQSASII 99

Query: 79  LTENK--------------------NPPQQRNNL---NVKKFVAVASGKGGVGKSTTVVN 115
           LT ++                      P   N      VK  +AVASGKGGVGKSTT  N
Sbjct: 100 LTAHRPAGAAAKPKSASGGHRPLGGTAPADGNAPILPGVKTIIAVASGKGGVGKSTTATN 159

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVD 175
           +A  L  +G  V +LDAD++GPS+ ++L   GK E+ D K L+P E +GIK +S+  LVD
Sbjct: 160 LAVGLGLEGLKVGLLDADIHGPSLHRMLGARGKPEVVDGK-LQPVEAWGIKAVSLGMLVD 218

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
           E  AMIWRGPMV  AI  +L +V WG LD +++D+PPGTGDA L++ QK+PL+G VIVST
Sbjct: 219 EKAAMIWRGPMVMGAINQLLTDVTWGNLDVMVVDLPPGTGDAQLSLTQKVPLTGAVIVST 278

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQD+ALID +R ++M++K+N+P++G+IENMSYF   + G   +LFG+GGA+ EAE +G+P
Sbjct: 279 PQDIALIDARRGVTMFEKVNVPVLGLIENMSYFCCPNCGHNTELFGHGGAKKEAEAMGVP 338

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
           FL  VP   D+R   D G+P ++ N +   ++ ++ I+  + +  
Sbjct: 339 FLGEVPLLADIRASGDKGVPGIIENPDGEGAKAWRHIAHTVAEML 383


>gi|220927042|ref|YP_002502344.1| MRP protein-like protein [Methylobacterium nodulans ORS 2060]
 gi|219951649|gb|ACL62041.1| MRP protein-like protein [Methylobacterium nodulans ORS 2060]
          Length = 374

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 141/353 (39%), Positives = 217/353 (61%), Gaps = 20/353 (5%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFI-VHNTVYLSITVPHTIAHQLQSLRSNA 62
           I +  ++ +L  +++  +   +    RLSEI I   N V  SI +  + A   +++R  A
Sbjct: 3   ITREDVLRALSGVTVDAKGTPLPTSGRLSEIVIDPGNRVMFSIAIDPSEAKAFEAVRQAA 62

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNLN----------------VKKFVAVASGKGG 106
           +  +  +  VK+ + +LT  +   + +                    ++  +AVASGKGG
Sbjct: 63  EIAVLKVGGVKSVLASLTAERPQARAQAAPRPAGPGGGPRPGPALPGIRHVIAVASGKGG 122

Query: 107 VGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGK---VEISDKKFLKPKENY 163
           VGKSTT  N+A ALK +G  V +LDAD+YGPS+PKL  +  K   V     + + P   Y
Sbjct: 123 VGKSTTACNLALALKAQGLKVGLLDADIYGPSVPKLFGLDQKPETVSTPQGQRIVPLNGY 182

Query: 164 GIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQ 223
           G+ +MS+  L+  + AMIWRGPMVQSA+  +L  V WG+LD L++DMPPGTGDA LT+AQ
Sbjct: 183 GMPVMSIGFLIQADTAMIWRGPMVQSALTQLLREVAWGELDILVVDMPPGTGDAQLTLAQ 242

Query: 224 KIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNG 283
             PL+G VIVSTPQDLALID +R ++M++++ +PI+G++ENM+ F+  + G    +FG+G
Sbjct: 243 ATPLAGAVIVSTPQDLALIDARRGVTMFRRVEVPILGIVENMATFICPNCGTASPIFGHG 302

Query: 284 GARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           GAR EAE++G+PFL  VP  M +R  SD G P+V  + +   + IY++++ ++
Sbjct: 303 GARHEAERLGVPFLGEVPLTMAIRESSDAGRPVVAVDPDGPQAAIYRDMAAKL 355


>gi|294084288|ref|YP_003551046.1| hypothetical protein SAR116_0719 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663861|gb|ADE38962.1| protein of unknown function DUF59 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 365

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 148/344 (43%), Positives = 217/344 (63%), Gaps = 13/344 (3%)

Query: 2   NQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSN 61
           N++   +I D+L  +   G   +IV    +S I I    V  SI +        + L+  
Sbjct: 3   NELNDIKIRDALSKIMASGADTDIVTSGAVSGIVIKDGHVGFSIEIDPKDKDAAEPLKRA 62

Query: 62  AQQIIQNIPTVKNAVVTLTENK----------NPPQQRNNL--NVKKFVAVASGKGGVGK 109
           A++ +  +  V +A   LT ++          +PPQ  +         +AVASGKGGVGK
Sbjct: 63  AEKAVLALDGVLSATALLTAHQAAPTQQAAPQSPPQGDHGTLQPATHVIAVASGKGGVGK 122

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMS 169
           STT +N+A AL   GK V ILDAD+YGPS+P+L+  + K E S+ K +KP E +G++ MS
Sbjct: 123 STTAINLALALAETGKKVGILDADIYGPSLPRLIGENRKPE-SEGKKIKPIEVWGLQTMS 181

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           +  LV E    IWRGPMV SA+  ML +V W  LD L+IDMPPGTGDA L+++Q+  L+G
Sbjct: 182 IGYLVAEETPTIWRGPMVMSALEQMLRDVAWNGLDILVIDMPPGTGDAQLSLSQRASLAG 241

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEA 289
            VIVSTPQDLALID ++ ++M++K+N+P++G++ENMS+F   D G ++++FG+GGA  EA
Sbjct: 242 AVIVSTPQDLALIDARKGLNMFKKVNVPLLGIVENMSFFSCPDCGSRHNIFGHGGAAAEA 301

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           +K+G+PFL  VP +MD+R  SD G PIV    +S  +  Y++I+
Sbjct: 302 KKLGVPFLGEVPLEMDIRETSDSGKPIVASAPDSPHAAHYRKIA 345


>gi|99080236|ref|YP_612390.1| Mrp/NBP35 family protein [Ruegeria sp. TM1040]
 gi|99036516|gb|ABF63128.1| Mrp/NBP35 family protein [Ruegeria sp. TM1040]
          Length = 354

 Score =  282 bits (722), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 135/343 (39%), Positives = 214/343 (62%), Gaps = 13/343 (3%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I ++ ++D+LK L+ P   ++IV    +  + +  +TV   + +    +     +R  A+
Sbjct: 3   ITRDAVLDALKTLNDPVSGSDIVAAGIVRALTLEGSTVRFVLEIDPAKSDAYAPVRDQAE 62

Query: 64  QIIQNIPTVK--NAVVTLTENKNPPQQRNNL-----------NVKKFVAVASGKGGVGKS 110
            ++  +  V+  +A++T    K PP  + N             + K +AVASGKGGVGKS
Sbjct: 63  AVVSALAGVEKVSALMTAHSTKAPPDLKPNKPAEPQGPQKIPGIAKIIAVASGKGGVGKS 122

Query: 111 TTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSM 170
           T   N+ACAL   G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS+
Sbjct: 123 TVSANLACALAQAGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPLRNHGVTMMSI 182

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGV 230
             + +++ A++WRGPM+  A+  M+  V WG LD L++D+PPGTGD  +T+AQK  + G 
Sbjct: 183 GLMTNDDQAVVWRGPMLMGALQQMMMQVQWGALDVLIVDLPPGTGDVQMTLAQKAQVDGA 242

Query: 231 VIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAE 290
           ++VSTPQD+ALID ++ I M+ K+N+PI+G+IENMS  + S+ G +  +FG+GG   EAE
Sbjct: 243 IVVSTPQDVALIDARKGIDMFHKLNVPILGLIENMSTHICSNCGHEEHIFGHGGVAAEAE 302

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           K+ +P L  VP  +DVR+ +D G PIVV   +SA +  +Q+I+
Sbjct: 303 KLNVPLLAEVPLHLDVRLAADGGAPIVVSKPDSAQARAFQDIA 345


>gi|330991052|ref|ZP_08315006.1| Iron-sulfur protein NUBPL [Gluconacetobacter sp. SXCC-1]
 gi|329761873|gb|EGG78363.1| Iron-sulfur protein NUBPL [Gluconacetobacter sp. SXCC-1]
          Length = 383

 Score =  281 bits (720), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 140/343 (40%), Positives = 206/343 (60%), Gaps = 31/343 (9%)

Query: 24  NIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ-IIQNIPTVKNAVVTLTEN 82
           ++ ++ RL    +    ++++I      A  LQ L    ++ ++  +P    A V LT +
Sbjct: 24  SVADLGRLDAFMLRDGVLHVAIATERGHAPALQPLLPELERGLVHAVPGCTGASVILTAH 83

Query: 83  K-----------------------------NPPQQRNNLNVKKFVAVASGKGGVGKSTTV 113
           +                              P        V   +AVASGKGGVGKSTT 
Sbjct: 84  RATPSPAPAPTAPAPAGGGHRPLNLGGGAPKPATGPLPPGVGVVIAVASGKGGVGKSTTA 143

Query: 114 VNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASL 173
           VN+A  L  +G  V ++DADV+GPS+P+++ ++ + E+ D + + P + +GI  MS+  L
Sbjct: 144 VNLAVGLGLEGLKVGLMDADVHGPSLPRMMGMNAQPEVRDSRLIPPHK-WGISAMSIGML 202

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           VDE  AMIWRGPMV  AI  +L +V WG LD L++DMPPGTGDA LT+AQK  L+G VIV
Sbjct: 203 VDEGKAMIWRGPMVMGAINQLLGDVDWGALDVLVVDMPPGTGDAQLTLAQKTALAGAVIV 262

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           STPQD+AL+D +R I+M++KMN+P++GM+ENMSYF   +   + +LFG+GGAR EAEK+G
Sbjct: 263 STPQDIALLDARRGIAMFEKMNVPVLGMVENMSYFCCPNCNHRTELFGHGGARAEAEKMG 322

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +PFL  VP   D+R  +D G PIV+   +SA  + Y+ ++  +
Sbjct: 323 VPFLGEVPLLADIRASADAGAPIVIAAPDSAAGQAYRALAHTV 365


>gi|162146703|ref|YP_001601162.1| hypothetical protein GDI_0881 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161785278|emb|CAP54824.1| conserved protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 368

 Score =  281 bits (720), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 138/340 (40%), Positives = 207/340 (60%), Gaps = 27/340 (7%)

Query: 23  NNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTEN 82
             I++   L    +   T+++++      A +++ L   A++ ++ +P V  A V LT +
Sbjct: 22  TTILDHAALDATTLRDGTLHVALATDRAGAGRIEPLLPQAERALRTLPGVTAASVILTAH 81

Query: 83  K----------------------NPPQQRNN----LNVKKFVAVASGKGGVGKSTTVVNI 116
           +                        P Q         VK  +AVASGKGGVGKSTT VN+
Sbjct: 82  RAAPAAAPSPGAAGGGHRPLNLGGAPGQAAQGKLLPGVKTVIAVASGKGGVGKSTTAVNL 141

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           A  L  +G  V +LDADV+GPS+P+++ +  +  +  +  + P + +GI+ MS+  LVDE
Sbjct: 142 AVGLGMEGLRVGLLDADVHGPSLPRMMGLH-QPPVVHEGRMTPLDAWGIRAMSIGLLVDE 200

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
             AMIWRGPMV  A+  +L +V WG LD L++DMPPGTGDA LT+AQKI L+G ++VSTP
Sbjct: 201 RQAMIWRGPMVMGALGQLLGDVDWGVLDVLVVDMPPGTGDAQLTLAQKIALAGAIVVSTP 260

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QD+AL+D +R I+M++KMN+P++GM+ENMSYF   + G + DLFG+GGAR EA  +G+PF
Sbjct: 261 QDIALLDARRGITMFEKMNVPVLGMVENMSYFCCPNCGHRTDLFGHGGARAEAAAMGVPF 320

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L  +P   D+R  +D G PIV+   +S   + Y+ ++  I
Sbjct: 321 LGEIPLLADIRASADSGAPIVIGAPDSPAGQAYRALAGTI 360


>gi|296114527|ref|ZP_06833180.1| hypothetical protein GXY_02076 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978883|gb|EFG85608.1| hypothetical protein GXY_02076 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 375

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 146/359 (40%), Positives = 217/359 (60%), Gaps = 27/359 (7%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M QI ++ I   L+ +  P      +++  L    +    V+++I      A  ++ + +
Sbjct: 1   MAQITQSAIEQVLRDVRDPRTGACALDLGTLDATTVRDGVVHVAIATDRDRAEHIRPMIA 60

Query: 61  NAQ-QIIQNIPTVKNAVVTLTENKNP------PQQRN----NL---------------NV 94
           + + ++  +I  VK A V LT ++ P      PQ       NL               NV
Sbjct: 61  DIEARLAHDIAGVKGASVILTSHRAPAAATPSPQGGGHRPLNLGAKPGSAQPTGPLPPNV 120

Query: 95  KKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDK 154
              +AVASGKGGVGKSTT VN+A  L  +G  V +LDADV+GPS+P+++ +  + E+ D 
Sbjct: 121 GLVIAVASGKGGVGKSTTAVNLAVGLGLEGLRVGLLDADVHGPSLPRMMGMDSQPEVRDG 180

Query: 155 KFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGT 214
           + L+P   +GI  MS+  LV+E  AMIWRGPMV  AI  +L +V WG+LD L++DMPPGT
Sbjct: 181 R-LQPLHGHGITAMSIGMLVEETKAMIWRGPMVMGAIGQLLSDVDWGELDVLVVDMPPGT 239

Query: 215 GDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTG 274
           GDA LT+AQK  L+G VIVSTPQD+AL+D +R ++M++KM +P++G++ENMSYF   +  
Sbjct: 240 GDAQLTLAQKTALAGAVIVSTPQDIALLDARRGVAMFEKMRVPVLGIVENMSYFCCPNCN 299

Query: 275 KKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
            + +LFG+GGAR EAEK G+PFL  +P   D+R   D G PIV+   +S   + Y+ ++
Sbjct: 300 HRTELFGHGGARAEAEKTGVPFLGEIPLLADIRASGDNGAPIVISAPDSPAGKAYRTLA 358


>gi|209543307|ref|YP_002275536.1| hypothetical protein Gdia_1138 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530984|gb|ACI50921.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 368

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 138/338 (40%), Positives = 207/338 (61%), Gaps = 27/338 (7%)

Query: 25  IVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENK- 83
           I++   L    +   T+++++      A +++ L   A++ ++ +P V  A V LT ++ 
Sbjct: 24  ILDHAALDATTLRDGTLHVALATDRAGAGRIEPLLPQAERALRTLPGVTAASVILTAHRA 83

Query: 84  ---------------------NPPQQRNN----LNVKKFVAVASGKGGVGKSTTVVNIAC 118
                                  P Q         VK  +AVASGKGGVGKSTT VN+A 
Sbjct: 84  APAAAPSPGAAGGGHRPLNLGGAPGQAAQGKLLPGVKTVIAVASGKGGVGKSTTAVNLAV 143

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENV 178
            L  +G  V +LDADV+GPS+P+++ +  +  +  +  + P + +GI+ MS+  LVDE  
Sbjct: 144 GLGMEGLRVGLLDADVHGPSLPRMMGLH-QPPVVHEGRMTPLDAWGIRAMSIGLLVDERQ 202

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
           AMIWRGPMV  A+  +L +V WG LD L++DMPPGTGDA LT+AQKI L+G ++VSTPQD
Sbjct: 203 AMIWRGPMVMGALGQLLGDVDWGVLDVLVVDMPPGTGDAQLTLAQKIALAGAIVVSTPQD 262

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +AL+D +R I+M++KMN+P++GM+ENMSYF   + G + DLFG+GGAR EA  +G+PFL 
Sbjct: 263 IALLDARRGITMFEKMNVPVLGMVENMSYFCCPNCGHRTDLFGHGGARAEAAAMGVPFLG 322

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +P   D+R  +D G PIV+   +S   + Y+ ++  I
Sbjct: 323 EIPLLADIRASADSGAPIVIGAPDSPAGQAYRALAGTI 360


>gi|154252899|ref|YP_001413723.1| hypothetical protein Plav_2457 [Parvibaculum lavamentivorans DS-1]
 gi|154156849|gb|ABS64066.1| protein of unknown function DUF59 [Parvibaculum lavamentivorans
           DS-1]
          Length = 382

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 143/360 (39%), Positives = 212/360 (58%), Gaps = 24/360 (6%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M ++ ++ I  +L  ++      +++    +  + +    V  S+ V        + LR 
Sbjct: 1   MTRVTRDDIAAALAGVTDDESGKDVMSAGIVQGLVVREGHVGFSLEVDPAKGAAKEPLRK 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPP------------------QQRNNLN------VKK 96
             +  ++ +P V +    LT ++                     QQR          VK 
Sbjct: 61  ACEYAVKQLPGVLSVTAVLTAHRGTASPAATKGHSHPHSHGGERQQRAPQGAISIPGVKA 120

Query: 97  FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKF 156
            +AVASGKGGVGKST  VN+A AL   G+ V +LDAD+YGPSIP+++ I GK E  D K 
Sbjct: 121 IIAVASGKGGVGKSTVAVNLALALSKLGRRVGLLDADIYGPSIPRMMGIKGKPESRDGKK 180

Query: 157 LKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGD 216
           L P +NYGI+ MS+  LV E+   IWRGPMVQSA+  M+ +V W +LD L++DMPPGTGD
Sbjct: 181 LIPMKNYGIETMSIGYLVAEDAPAIWRGPMVQSALTQMMMDVEWSELDVLVVDMPPGTGD 240

Query: 217 AHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKK 276
           A LT+AQ++PL+G VIVSTPQD+ALID ++  +M++K ++P+ G++ENM+YF++  +G+K
Sbjct: 241 AQLTMAQRVPLAGAVIVSTPQDIALIDARKGYAMFEKTHVPVFGIVENMAYFISPGSGEK 300

Query: 277 YDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +FG GGAR  AE +G  FL  VP  M +R  SD G P+V    +S  +  + EI+ R+
Sbjct: 301 SYIFGQGGARRMAETLGCDFLGEVPLHMTIREKSDNGEPVVATAPDSEEARPFIEIARRV 360


>gi|254467267|ref|ZP_05080678.1| Mrp/NBP35 family protein [Rhodobacterales bacterium Y4I]
 gi|206688175|gb|EDZ48657.1| Mrp/NBP35 family protein [Rhodobacterales bacterium Y4I]
          Length = 356

 Score =  279 bits (713), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 136/348 (39%), Positives = 210/348 (60%), Gaps = 15/348 (4%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + +  ++++L+ ++ P   ++IV       + +   TV   + +    +     +R  A 
Sbjct: 3   VTRETVLEALRTITDPASGSDIVSAGIARAVTVEGGTVRFVLEIDPGKSGAYGPVRDKAD 62

Query: 64  QIIQNIPTVK--NAVVTLTENKNPPQQRNNL-------------NVKKFVAVASGKGGVG 108
             +  +P V+  +A++T    K PP  +                 V + +AVASGKGGVG
Sbjct: 63  AAVAALPGVEKVSAMLTAHSGKAPPDLKPQKAAQPQQQAPQKVPGVARILAVASGKGGVG 122

Query: 109 KSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIM 168
           KST   NIACAL  +G+ V +LDADVYGPS PK+L +SG+    D K + P  N+G+ +M
Sbjct: 123 KSTVSANIACALAMQGRKVGLLDADVYGPSQPKMLGVSGRPASPDGKTILPLRNHGVTMM 182

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           SM  +  E+ A+IWRGPM+  A+  ML  V WG LD L++D+PPGTGD  +T+AQK  + 
Sbjct: 183 SMGLMTGEDQAVIWRGPMLMGALQQMLLQVQWGDLDVLIVDLPPGTGDVQMTLAQKTHVD 242

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFE 288
           G ++VSTPQD+ALID ++ I M++KMN+P++GMIENMS  + S+ G +  +FG+GG   E
Sbjct: 243 GAIVVSTPQDVALIDARKGIDMFRKMNVPVLGMIENMSTHICSNCGHEEHIFGHGGVAQE 302

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           A+K+G+P L  VP  +DVR+  D G PIV     SA ++++  I+ ++
Sbjct: 303 AKKLGVPLLGEVPLHLDVRLAGDSGTPIVAAKPGSAQAKVFLGIATQL 350


>gi|259416435|ref|ZP_05740355.1| Mrp protein [Silicibacter sp. TrichCH4B]
 gi|259347874|gb|EEW59651.1| Mrp protein [Silicibacter sp. TrichCH4B]
          Length = 354

 Score =  279 bits (713), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 134/343 (39%), Positives = 210/343 (61%), Gaps = 13/343 (3%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I ++ ++D+LK L  P    +IV    +  + I  + V   + +    +     +R  A+
Sbjct: 3   ITRDAVLDALKTLKDPVSGGDIVAAGIVRALTIEGSNVRFVLEIHPAKSEAYAPVRDQAE 62

Query: 64  QIIQNIPTVK--NAVVTLTENKNPPQQRNNL-----------NVKKFVAVASGKGGVGKS 110
            ++ ++  V+  +A++T    K PP  + N             + K +AVASGKGGVGKS
Sbjct: 63  ALVSDLAGVEKVSALMTAHSTKAPPDLKPNKPAEPQGPQKIPGIAKIIAVASGKGGVGKS 122

Query: 111 TTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSM 170
           T   N+ACAL   GK V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS+
Sbjct: 123 TVSANLACALAQAGKRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPLRNHGVTMMSI 182

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGV 230
             + +++ A++WRGPM+  A+  M+  V WG LD L++D+PPGTGD  +T+AQK  + G 
Sbjct: 183 GLMTNDDQAVVWRGPMLMGALQQMMMQVQWGALDVLIVDLPPGTGDVQMTLAQKAQVDGA 242

Query: 231 VIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAE 290
           ++VSTPQD+ALID ++ I M+ K+N+PI+G+IENMS  + S+ G +  +FG+GG   EAE
Sbjct: 243 IVVSTPQDVALIDARKGIDMFHKLNVPILGLIENMSTHICSNCGHEEHIFGHGGVAAEAE 302

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           K+ +P L  VP  +DVR+ +D G PIV    +S  +  +Q+I+
Sbjct: 303 KLNVPLLAEVPLHLDVRLAADGGAPIVASKPDSTQARAFQDIA 345


>gi|114328155|ref|YP_745312.1| iron-sulfur cluster assembly/repair protein ApbC [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316329|gb|ABI62389.1| iron-sulfur cluster assembly/repair protein ApbC [Granulibacter
           bethesdensis CGDNIH1]
          Length = 379

 Score =  278 bits (712), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 140/349 (40%), Positives = 211/349 (60%), Gaps = 21/349 (6%)

Query: 8   QIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQ 67
           Q+ + L+ ++ P    +IV    +  I      V +++      A +++++R  A+ ++ 
Sbjct: 15  QLREVLRAVTDPATGKDIVSAGLIDSIQSRDGLVQVALRATRERAAEMETVRKAAETVLS 74

Query: 68  NIPTVKNAVVTLTENKN-PP-----------------QQRNNL--NVKKFVAVASGKGGV 107
             P ++NA V LT + + PP                 Q R  L   V   +AVASGKGGV
Sbjct: 75  RQPGIRNATVVLTAHHDVPPTTAQAAHGHGPGHGQGAQPRPRLLTEVGAVIAVASGKGGV 134

Query: 108 GKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKI 167
           GKST  VN+A AL   G    +LDAD++GPS+P LL  + K E  D + + P E +G+K 
Sbjct: 135 GKSTVAVNLAVALAQMGLKAGLLDADIHGPSLPLLLGETRKPEARDGRLI-PIETWGLKA 193

Query: 168 MSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPL 227
           MS+  LVD+N AMIWRGPMV  A+  M+  V WG LD L++DMPPGTGDA LT+AQ++ L
Sbjct: 194 MSIGFLVDQNEAMIWRGPMVMGALEQMMGQVAWGDLDVLIVDMPPGTGDAQLTMAQRVAL 253

Query: 228 SGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARF 287
           +G VIVSTPQDLAL D +R ++M+ K ++P++G++ENMSYF   + G + ++F +GG + 
Sbjct: 254 AGAVIVSTPQDLALADARRGVAMFGKTHVPVLGIVENMSYFCCPNCGHRSEVFSHGGVKE 313

Query: 288 EAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           EAE++G  FL  +P  +D+R  +D G P+V     S  ++ + E++ RI
Sbjct: 314 EAERLGTDFLGEIPLLLDIRAAADSGTPVVAAAPASQAAQAFSELARRI 362


>gi|311697016|gb|ADP99889.1| Mrp/NBP35 family protein [marine bacterium HP15]
          Length = 282

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 128/271 (47%), Positives = 188/271 (69%), Gaps = 10/271 (3%)

Query: 76  VVTLTE-NKNP---------PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGK 125
           +V  TE  KNP         PQ +N   V + +A+ASGKGGVGKST   N+A AL +KG 
Sbjct: 1   MVEYTEVGKNPNLIGTDAPRPQDKNPRGVDRIIAIASGKGGVGKSTVSSNLAVALASKGL 60

Query: 126 NVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGP 185
            V +LDADVYGPS P++L +SG+    D   + P  N+G+ +MS+  +  E+ A++WRGP
Sbjct: 61  KVGLLDADVYGPSQPRMLGVSGRPSSPDGSTILPLRNHGVTLMSLGLMAPEDEAIVWRGP 120

Query: 186 MVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVK 245
           M+  A+  M++ V WG+LD LL+D+PPGTGD  +T++QK  ++G VIVSTPQD+AL+D +
Sbjct: 121 MLMGALQQMMNQVEWGRLDVLLVDLPPGTGDVQMTLSQKFFVAGAVIVSTPQDIALMDAR 180

Query: 246 RAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMD 305
           + I M+++M++P+ G+IENM+ F+    GK++  FG+GGAR EAEK+G PFL  +P D+D
Sbjct: 181 KGIDMFKRMDVPLFGLIENMASFICDGCGKEHHPFGHGGARAEAEKLGSPFLGEIPLDLD 240

Query: 306 VRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +R+ SD G+PIVV   +S  ++ +Q I+D I
Sbjct: 241 IRLGSDGGVPIVVSKPDSPQAQAFQRIADEI 271


>gi|58039871|ref|YP_191835.1| GTP-binding protein [Gluconobacter oxydans 621H]
 gi|58002285|gb|AAW61179.1| GTP-binding protein [Gluconobacter oxydans 621H]
          Length = 399

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 137/352 (38%), Positives = 206/352 (58%), Gaps = 35/352 (9%)

Query: 21  EKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLT 80
           + +N++    L  + + +   ++S+      A +++ LR   +  I ++P +  A ++ T
Sbjct: 37  QGSNVLSFAALESVSVRNGHAHVSLATSRDNASRVEPLRPRVEAAIASLPGITGATLSFT 96

Query: 81  ENK-------------------NPPQQRNNL-----------NVKKFVAVASGKGGVGKS 110
            ++                   N   +R N             VK  +AVASGKGGVGKS
Sbjct: 97  SHRPATPAAANAPAQSGGHRPFNLGDKRRNAASRHAPETLLPGVKAVIAVASGKGGVGKS 156

Query: 111 TTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSM 170
           TT VN+A  L  +G    +LDAD+YGPS+P++L  + + E+ D   L P E +G+K MS+
Sbjct: 157 TTAVNLAVGLAQQGLKTGLLDADIYGPSLPRMLGRNARPEVVDGTIL-PIEAWGLKSMSI 215

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKI----P 226
             LVDEN AMIWRGPMV  A+   L  V WG+LD L+IDMPPGTGDA LT+AQK+     
Sbjct: 216 GYLVDENQAMIWRGPMVMGALTQFLGEVEWGELDVLVIDMPPGTGDAQLTLAQKLGPKLA 275

Query: 227 LSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGAR 286
             G VIVSTPQD+AL+D +R ++M+++M  PI+G++ENMSYF   +   + +LFG+GGA+
Sbjct: 276 AGGAVIVSTPQDIALLDARRGVAMFERMETPILGVVENMSYFCCPNCNHRTELFGHGGAK 335

Query: 287 FEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
            EAEK+G+PFL  +P   D+R   D G PI++    S  ++ Y  ++  + +
Sbjct: 336 AEAEKMGVPFLAEIPLLADIRASGDEGTPIILSAPQSEAAQAYTRLAQAVAR 387


>gi|159896859|ref|YP_001543106.1| hypothetical protein Haur_0326 [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159889898|gb|ABX02978.1| protein of unknown function DUF59 [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 359

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 204/332 (61%), Gaps = 4/332 (1%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           +  ++ +L  +  P    N+V  + + E+ I    V + I +        + L ++ +  
Sbjct: 13  QEAVLAALATVQEPELGGNLVARKMIKELNIDGGRVVVLIDLTTPACPFKEQLANDVRAA 72

Query: 66  IQNIPTVKNAVVTLTENKNP----PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           +  +P V    V  T         P +     V   +AVASGKGGVGKST  VN+A AL 
Sbjct: 73  LAQVPGVSEIEVDFTATVRSYNGIPDKARVPGVSHILAVASGKGGVGKSTVAVNLAVALA 132

Query: 122 NKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMI 181
            +G NV +LDAD+YGPS P +    GK  I+  + + P E +GIKI+S+   VD++  ++
Sbjct: 133 QEGANVGLLDADIYGPSAPLMTGARGKPGITQNQKIAPLEAHGIKIISVGYFVDDSQPLV 192

Query: 182 WRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLAL 241
           WRGPM+ S +   L  V WGQLD+L++D+PPGTGD  LT+AQ IPLSG V+V+TPQD+AL
Sbjct: 193 WRGPMISSMLRQFLFEVDWGQLDYLIVDLPPGTGDIQLTLAQSIPLSGSVVVTTPQDVAL 252

Query: 242 IDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVP 301
            D  + + M++K+N+PI+G++ENMSYF+A DTGK+YD+FG+GGAR  + K+G+PFL  +P
Sbjct: 253 ADAIKGVEMFRKLNVPILGIVENMSYFIAPDTGKRYDIFGHGGARTASSKLGVPFLGEIP 312

Query: 302 FDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
             M +R   D G P V  +   A ++ +++++
Sbjct: 313 LGMPIREGGDTGQPAVTQSAKDAYADSFRDVA 344


>gi|149375890|ref|ZP_01893657.1| Mrp/NBP35 family protein [Marinobacter algicola DG893]
 gi|149359770|gb|EDM48227.1| Mrp/NBP35 family protein [Marinobacter algicola DG893]
          Length = 281

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 120/251 (47%), Positives = 180/251 (71%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI 145
           PQ +N   V + +A+ASGKGGVGKST   N+A A+ +KG  V +LDADVYGPS P++L +
Sbjct: 20  PQDKNPKGVDRIIAIASGKGGVGKSTVASNLAVAMASKGLKVGLLDADVYGPSQPRMLGV 79

Query: 146 SGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDF 205
           SG+    D   + P  N+G+ +MS+  +  ++ A++WRGPM+  A+  M++ V WG+LD 
Sbjct: 80  SGRPSSPDGNTILPLRNHGVTLMSLGLMASDDEAIVWRGPMLMGALQQMMNQVDWGRLDV 139

Query: 206 LLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENM 265
           LL+D+PPGTGD  +T++QK  ++G V+VSTPQD+AL+D ++ I M+++M++P+ G+IENM
Sbjct: 140 LLVDLPPGTGDVQMTLSQKFFVAGAVVVSTPQDIALMDARKGIDMFKRMDVPLFGLIENM 199

Query: 266 SYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSAT 325
           + F+    GK++  FG+GGAR EAEK+G PFL  +P D+D+RV SD G+PIVV   +S  
Sbjct: 200 ASFICDGCGKEHHPFGHGGARAEAEKLGAPFLGEIPLDLDIRVGSDGGVPIVVSKPDSPQ 259

Query: 326 SEIYQEISDRI 336
           S  +Q I+D +
Sbjct: 260 SRAFQRIADEL 270


>gi|126739779|ref|ZP_01755470.1| Mrp/NBP35 family protein [Roseobacter sp. SK209-2-6]
 gi|126719011|gb|EBA15722.1| Mrp/NBP35 family protein [Roseobacter sp. SK209-2-6]
          Length = 354

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 136/343 (39%), Positives = 211/343 (61%), Gaps = 13/343 (3%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I +  ++++LK +S P    +IV    +  + + + +V   + +    A     +R  A+
Sbjct: 3   ISRETVLETLKSISDPVSGQDIVAAGIVRGLTVENGSVLFVLEIDPAKAEVYSPVRDAAE 62

Query: 64  QIIQNIPTVKNAVVTLTEN--KNPPQQRNNL-----------NVKKFVAVASGKGGVGKS 110
             IQN+  V+   V LT +  K PP  +               V + +AVASGKGGVGKS
Sbjct: 63  AAIQNLTGVEKTSVMLTGHSAKAPPDLKPKKPAEPQGAQKIPGVDRIIAVASGKGGVGKS 122

Query: 111 TTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSM 170
           T   N+ACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS+
Sbjct: 123 TVSANLACALAMQGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPLRNHGVTMMSI 182

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGV 230
             + +E+ A++WRGPM+  A+  M+  V WG LD L++D+PPGTGD  +T+AQK  + G 
Sbjct: 183 GLMTNEDQAVVWRGPMLMGALQQMMMQVQWGALDVLIVDLPPGTGDVQMTLAQKAQVDGA 242

Query: 231 VIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAE 290
           ++VSTPQD+ALID ++ I M+ K+N+PI+GMIENMS  + S+ G +  +FG+GG   EAE
Sbjct: 243 IVVSTPQDVALIDARKGIDMFNKLNVPILGMIENMSTHICSNCGHEEHVFGHGGVAAEAE 302

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           K+ +P L  +P  +DVR+ +D G PIV    +SA ++ + +I+
Sbjct: 303 KLNVPLLAEIPLHLDVRMAADGGAPIVTSKPDSAQAKAFLDIA 345


>gi|163736986|ref|ZP_02144404.1| Mrp/NBP35 family protein [Phaeobacter gallaeciensis BS107]
 gi|161389590|gb|EDQ13941.1| Mrp/NBP35 family protein [Phaeobacter gallaeciensis BS107]
          Length = 354

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 133/338 (39%), Positives = 208/338 (61%), Gaps = 13/338 (3%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           ++++LK +  P   ++IV    +  + I  +TV   + +    +     +R  A   +  
Sbjct: 8   VLEALKTIKDPVSGSDIVAAGIVRALNIEEDTVRFVLEIDPAKSDIYAPVRDEADAKVTA 67

Query: 69  IPTVK--NAVVTLTENKNPPQQRNNL-----------NVKKFVAVASGKGGVGKSTTVVN 115
           +P     +A++T    K PP  + +             V + +AVASGKGGVGKST   N
Sbjct: 68  LPGAGKVSAMLTAHSAKAPPDLKGSKPAQPQGPQKIPGVDRILAVASGKGGVGKSTVSAN 127

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVD 175
           IACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS+  + +
Sbjct: 128 IACALAAQGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPMRNHGVTMMSIGLMTN 187

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
           E+ A++WRGPM+  A+  M+  V WG LD L++D+PPGTGD  +T+AQK  + G ++VST
Sbjct: 188 EDQAVVWRGPMLMGALQQMMMQVQWGALDVLIVDLPPGTGDVQMTLAQKAHVDGAIVVST 247

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQD+ALID ++ I M+QK+N+PIIGM+ENMS  + S+ G +  +FG+GG   EAEK+ +P
Sbjct: 248 PQDVALIDARKGIDMFQKLNVPIIGMVENMSTHICSNCGHEEHVFGHGGVAAEAEKLNVP 307

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
            L  +P  +DVRV +D G PI V   +SA ++ + +++
Sbjct: 308 LLAEIPLHLDVRVAADGGAPIAVSKPDSAQAKAFHDLA 345


>gi|163740591|ref|ZP_02147985.1| Mrp/NBP35 family protein [Phaeobacter gallaeciensis 2.10]
 gi|161386449|gb|EDQ10824.1| Mrp/NBP35 family protein [Phaeobacter gallaeciensis 2.10]
          Length = 354

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 132/338 (39%), Positives = 208/338 (61%), Gaps = 13/338 (3%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           ++++LK +  P   ++IV    +  + I  +TV   + +    +     +R  A   +  
Sbjct: 8   VLEALKTIKDPVSGSDIVAAGIVRALNIEEDTVRFVLEIDPAKSDIYTPVRDEADAKVTA 67

Query: 69  IPTVK--NAVVTLTENKNPPQQRNNL-----------NVKKFVAVASGKGGVGKSTTVVN 115
           +P     +A++T    K PP  + +             V + +A+ASGKGGVGKST   N
Sbjct: 68  LPGAGKVSAMLTAHSAKAPPDLKGSKPAQPQGPQKIPGVDRIIAIASGKGGVGKSTVSAN 127

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVD 175
           IACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS+  + +
Sbjct: 128 IACALAAQGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPMRNHGVTMMSIGLMTN 187

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
           E+ A++WRGPM+  A+  M+  V WG LD L++D+PPGTGD  +T+AQK  + G ++VST
Sbjct: 188 EDQAVVWRGPMLMGALQQMMMQVQWGALDVLIVDLPPGTGDVQMTLAQKAHVDGAIVVST 247

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQD+ALID ++ I M+QK+N+PIIGM+ENMS  + S+ G +  +FG+GG   EAEK+ +P
Sbjct: 248 PQDVALIDARKGIDMFQKLNVPIIGMVENMSTHICSNCGHEEHVFGHGGVAAEAEKLNVP 307

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
            L  +P  +DVRV +D G PI V   +SA ++ + +++
Sbjct: 308 LLAEIPLHLDVRVAADGGAPIAVSKPDSAQAKAFHDLA 345


>gi|254511057|ref|ZP_05123124.1| Mrp/NBP35 family protein [Rhodobacteraceae bacterium KLH11]
 gi|221534768|gb|EEE37756.1| Mrp/NBP35 family protein [Rhodobacteraceae bacterium KLH11]
          Length = 353

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 129/342 (37%), Positives = 209/342 (61%), Gaps = 13/342 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +++ I+++LK ++ P    +IV    +  + +  +TV   + +    A Q++ +R+ A++
Sbjct: 3   IRDAILENLKQITDPVSGQDIVSAGLVRALNVEDDTVRFVLEIDPKHAEQMEPVRATAEK 62

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNL-------------NVKKFVAVASGKGGVGKST 111
             Q++  V      LT + +                      V + +AVASGKGGVGKST
Sbjct: 63  AAQSVEGVSKVSAMLTAHSDKAPPDLKPKPKPSQTGPQAVPGVDRIIAVASGKGGVGKST 122

Query: 112 TVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMA 171
              N+ACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MSM 
Sbjct: 123 VSANLACALAAEGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPLRNHGVTMMSMG 182

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
            + +E  A++WRGPM+  A+  M+  V WG LD L++D+PPGTGD  LT++QK  + G +
Sbjct: 183 LMTNEGQAVVWRGPMLMGALQQMMSQVQWGALDVLIVDLPPGTGDVQLTLSQKFQVDGAI 242

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEK 291
           +VSTPQD+ALID ++ I M+ ++  PI+GMIENMS  + S+ G +  +FG+GG   EAE 
Sbjct: 243 VVSTPQDVALIDARKGIDMFNQLKTPILGMIENMSTHICSNCGHEEHIFGHGGVASEAEA 302

Query: 292 IGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           +G+P L  +P  +D+R+ +D G PIVV   +S  +E +++++
Sbjct: 303 LGVPLLGEIPLHLDIRLAADGGAPIVVSKPDSPQAEAFRKVA 344


>gi|254476950|ref|ZP_05090336.1| Mrp/NBP35 family protein [Ruegeria sp. R11]
 gi|214031193|gb|EEB72028.1| Mrp/NBP35 family protein [Ruegeria sp. R11]
          Length = 354

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 132/341 (38%), Positives = 207/341 (60%), Gaps = 13/341 (3%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           +  ++++LK +  P   ++IV    +  + I   TV   + +    +     +R  A   
Sbjct: 5   RETVLETLKTIKDPLSGSDIVAAGIVRALNIEEGTVRFVLEIDPAKSDVYAPVRDEADAK 64

Query: 66  IQNIPTVK--NAVVTLTENKNPPQQRNNL-----------NVKKFVAVASGKGGVGKSTT 112
           +  +P     +A++T    K PP  +               V + +AVASGKGGVGKST 
Sbjct: 65  VAALPGAGKVSAMLTAHSEKAPPDLKPKQAAQPQGPQKIPGVDRIIAVASGKGGVGKSTV 124

Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMAS 172
             NIACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS+  
Sbjct: 125 SANIACALAAQGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPMRNHGVTMMSIGL 184

Query: 173 LVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVI 232
           + +E+ A++WRGPM+  A+  M+  V WG LD L++D+PPGTGD  +T+AQK  + G ++
Sbjct: 185 MTNEDQAVVWRGPMLMGALQQMMMQVQWGALDVLIVDLPPGTGDVQMTLAQKAHVDGAIV 244

Query: 233 VSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKI 292
           VSTPQD+ALID ++ I M+QK+N+PIIGM+ENMS  + S+ G +  +FG+GG   EA+K+
Sbjct: 245 VSTPQDVALIDARKGIDMFQKLNVPIIGMVENMSTHICSNCGHEEHVFGHGGVAAEADKL 304

Query: 293 GIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
            +P L  +P  +DVRV +D G PI V   +SA ++ + +++
Sbjct: 305 NVPLLAEIPLHLDVRVAADGGAPIAVSKPDSAQAKAFHDLA 345


>gi|223936080|ref|ZP_03627994.1| protein of unknown function DUF59 [bacterium Ellin514]
 gi|223895302|gb|EEF61749.1| protein of unknown function DUF59 [bacterium Ellin514]
          Length = 348

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 129/344 (37%), Positives = 224/344 (65%), Gaps = 11/344 (3%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I + QI ++LK +  PG   +IV    + ++ I + +V +S+ +        Q +++ ++
Sbjct: 2   ITEEQIKEALKAVKYPGYSRDIVSFGLVKQVNISNGSVNVSMQLASGTPEVAQQIKTESE 61

Query: 64  QIIQNIPTVKNAVVTL--------TENKNPPQQRNNL-NVKKFVAVASGKGGVGKSTTVV 114
           ++++++P +  A V L           +NP Q +N +  +K+ VAVASGKGGVGKSTT V
Sbjct: 62  RVLKSLPGITAAQVHLQAPTGAPAVAAQNPWQNQNKIPGIKRIVAVASGKGGVGKSTTSV 121

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+ACAL++ G  V +LD D+YGPSIP ++ I  K  ++ D+  + P   +G+K+MSM  L
Sbjct: 122 NLACALQHLGAKVGLLDCDIYGPSIPLMMGIHRKPTVTEDETMMIPPVAHGVKVMSMGLL 181

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           ++ +  +IWRGPM+   I   + +V WG+LD++++D+PPGTGDA L++ Q +PL G VIV
Sbjct: 182 IEGDSPVIWRGPMIMKTIQQFITSVAWGELDYMIVDLPPGTGDAQLSLCQTVPLDGGVIV 241

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQ+ +L  V++ I+M++K+N+PI+G++ENMSYF  +  G++ ++FG+GG + EAE+  
Sbjct: 242 TTPQEASLGVVRKGIAMFEKVNVPILGIVENMSYF-TTPNGERVEIFGHGGGKSEAERQK 300

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           + FL  +P   ++R+  D G+PIVV       ++ + +++D ++
Sbjct: 301 VTFLGEIPIFTEIRIAGDSGVPIVVSAPEKPAAKAFLQVADHLR 344


>gi|260434024|ref|ZP_05787995.1| Mrp/NBP35 family protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417852|gb|EEX11111.1| Mrp/NBP35 family protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 353

 Score =  273 bits (697), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 132/344 (38%), Positives = 212/344 (61%), Gaps = 17/344 (4%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +++ ++ +LK ++ P    +IV    +  + +  +TV   + +    A +++ +R+ A++
Sbjct: 3   IRDAVLANLKKITDPVSGQDIVSAGVVRALNVEGDTVRFVLEIDPKNADKMEPVRATAEK 62

Query: 65  IIQNIPTVKNAVVTLTENKNP---------------PQQRNNLNVKKFVAVASGKGGVGK 109
             Q +  V      LT + +                PQ      V + +AVASGKGGVGK
Sbjct: 63  AAQMVDGVAKVSALLTAHSDKAPPDLKPKPKPSQTGPQAVPG--VDRIIAVASGKGGVGK 120

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMS 169
           ST   N+ACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS
Sbjct: 121 STVSANLACALAAEGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPLRNHGVTMMS 180

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           M  + +E  A++WRGPM+  A+  M++ V WG LD L++D+PPGTGD  LT++QK  + G
Sbjct: 181 MGLMTNEGQAVVWRGPMLMGALQQMMNQVQWGALDVLIVDLPPGTGDVQLTLSQKFKVDG 240

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEA 289
            ++VSTPQD+ALID ++ I M++++N PI+GMIENMS  + S+ G +  +FG+GG   EA
Sbjct: 241 AIVVSTPQDVALIDARKGIDMFRQLNTPIVGMIENMSTHICSNCGHEEHVFGHGGVAAEA 300

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
            K+G+P L  +P  +D+RV +D G PIVV   +S  +E +++I+
Sbjct: 301 AKLGVPLLGEIPLHLDIRVAADGGAPIVVSKPDSPQAEAFRKIA 344


>gi|85704193|ref|ZP_01035296.1| Mrp/NBP35 family protein [Roseovarius sp. 217]
 gi|85671513|gb|EAQ26371.1| Mrp/NBP35 family protein [Roseovarius sp. 217]
          Length = 354

 Score =  272 bits (695), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 131/346 (37%), Positives = 212/346 (61%), Gaps = 13/346 (3%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + +  ++++LK ++ P   ++IV    +  + +   TV   + +    A     +R  A+
Sbjct: 3   LTRESVLEALKTITDPVSGSDIVSAGVMRALTVDGGTVRFVLEIDPAKAQAYTPVRDAAE 62

Query: 64  QIIQNIPTVKN--AVVTLTENKNPPQQRNNL-----------NVKKFVAVASGKGGVGKS 110
             ++ +    +  AV+T    K PP  + +             V   +A+ASGKGGVGKS
Sbjct: 63  AAVKALAGADSVSAVLTGHSTKAPPDLKPSRKAEPKGPEKVPGVNHLIAIASGKGGVGKS 122

Query: 111 TTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSM 170
           T   N+ACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS+
Sbjct: 123 TVSANLACALAAEGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPMRNHGVTMMSI 182

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGV 230
             + +E  A++WRGPM+  A+  ML  V WG LD LL+D+PPGTGD  +T+AQK  + G 
Sbjct: 183 GLMTNEGQAVVWRGPMLMGALQQMLMQVQWGALDVLLVDLPPGTGDVQMTLAQKAQVDGA 242

Query: 231 VIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAE 290
           +IVSTPQD+AL+D ++ I M+ ++++P++GMIENMS  + ++ G +  +FG+GG R EAE
Sbjct: 243 IIVSTPQDVALLDARKGIDMFNQLHVPVLGMIENMSTHICTNCGHEEHVFGHGGVRAEAE 302

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           K+G+P L  +P  +D+RV SD G PIVV   +S  ++ ++E++  +
Sbjct: 303 KLGVPLLAEIPLHLDIRVASDGGAPIVVSKPDSPQAQAFREVARHL 348


>gi|149201538|ref|ZP_01878512.1| Mrp/NBP35 family protein [Roseovarius sp. TM1035]
 gi|149144586|gb|EDM32615.1| Mrp/NBP35 family protein [Roseovarius sp. TM1035]
          Length = 354

 Score =  271 bits (694), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 132/346 (38%), Positives = 211/346 (60%), Gaps = 13/346 (3%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + +  ++++LK ++ P   ++IV    +  + I   TV   + +    A     +R  A+
Sbjct: 3   LTRESVLEALKKITDPVSGSDIVAAGVMRALTIDGGTVRFVLEIDPAKAQAYTPVRDAAE 62

Query: 64  QIIQNIPTVKNAVVTLT--ENKNPPQQRNNL-----------NVKKFVAVASGKGGVGKS 110
             +  +   ++  V LT    K PP  + +             V   +A+ASGKGGVGKS
Sbjct: 63  AAVTALAGAESVSVVLTGHSTKAPPDLKPSRKAEPKGPEKVPGVNHLIAIASGKGGVGKS 122

Query: 111 TTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSM 170
           T   N+ACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS+
Sbjct: 123 TVSANLACALAAEGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPMRNHGVTMMSI 182

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGV 230
             + +E  A++WRGPM+  A+  ML  V WG LD LL+D+PPGTGD  +T+AQK  + G 
Sbjct: 183 GLMTNEGQAVVWRGPMLMGALQQMLMQVQWGALDVLLVDLPPGTGDVQMTLAQKAQVDGA 242

Query: 231 VIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAE 290
           +IVSTPQD+AL+D ++ I M+ ++++P++GMIENMS  + ++ G +  +FG+GG R EAE
Sbjct: 243 IIVSTPQDVALLDARKGIDMFNQLHVPVLGMIENMSTHICTNCGHEEHVFGHGGVRAEAE 302

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           K+G+P L  +P  +D+RV SD G PIVV   +S  ++ ++E++  +
Sbjct: 303 KLGVPLLAEIPLHLDIRVASDGGAPIVVSKPDSPQAQAFREVARHL 348


>gi|126734230|ref|ZP_01749977.1| hypothetical protein RCCS2_08724 [Roseobacter sp. CCS2]
 gi|126717096|gb|EBA13960.1| hypothetical protein RCCS2_08724 [Roseobacter sp. CCS2]
          Length = 355

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 136/345 (39%), Positives = 210/345 (60%), Gaps = 16/345 (4%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHN-TVYLSITVPHTIAHQLQSLRSNA 62
           I +  ++D+LK +S P   ++IV    +  + I     V   + +P + A +  +++  A
Sbjct: 3   IERTAVLDALKSISDP-TGSDIVSAGVVRALNIGEGGAVRFVMEIPPSQAQEYTAIKDAA 61

Query: 63  QQIIQNIPTVKNAVVTLT---ENKNPPQ---QRNNL--------NVKKFVAVASGKGGVG 108
           +  +Q +  V    + +T   E   PP    QR            V + +A+ASGKGGVG
Sbjct: 62  EAALQALDGVGAVSIVMTGHSEKPAPPDLKPQRAAEPSGPQSIPGVDRILAIASGKGGVG 121

Query: 109 KSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIM 168
           KST   N+ACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +M
Sbjct: 122 KSTVSANLACALAQQGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKIILPMRNHGVTMM 181

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           S+  + +E+ A++WRGPM+  A+  M+  V WG LD LL+D+PPGTGD  +T+AQK  + 
Sbjct: 182 SIGLMTNEDQAVVWRGPMLMGALQQMMTQVQWGALDVLLVDLPPGTGDVQMTLAQKAKVD 241

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFE 288
           G +IVSTPQD+AL+D ++ I M+Q++++PIIGMIENMS  + S  G +  +FG+GG   E
Sbjct: 242 GAIIVSTPQDVALLDARKGIDMFQQLHVPIIGMIENMSTHICSQCGHEEHVFGHGGVAAE 301

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           A K+ +P L  VP D+ +R+ SD G PI V   + A ++ +Q I+
Sbjct: 302 AAKLDVPLLAEVPLDLQIRLSSDGGAPITVSQPDGAQAQAFQGIA 346


>gi|255019869|ref|ZP_05291944.1| protein of unknown function DUF59 [Acidithiobacillus caldus ATCC
           51756]
 gi|254970649|gb|EET28136.1| protein of unknown function DUF59 [Acidithiobacillus caldus ATCC
           51756]
          Length = 358

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 138/336 (41%), Positives = 207/336 (61%), Gaps = 7/336 (2%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+ + K  +  SLK ++ P    ++   + L  +        + I +P+  A     L  
Sbjct: 1   MSALQKETVEQSLKAITDPYLNRDLASAKVLKSV----TDARVEIELPYPSAGVAAELGE 56

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL---NVKKFVAVASGKGGVGKSTTVVNIA 117
             +  I+    V+ AV       +   QR       +K  +AVASGKGGVGKSTT VN+A
Sbjct: 57  RIRAQIERDTGVEAAVQVGHRIHSHQVQRGVKLLDGIKNIIAVASGKGGVGKSTTSVNLA 116

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDEN 177
            AL  +G  V +LDAD+YGPS P++L ISGK    D K ++P E +GIK MS+  L+DE 
Sbjct: 117 LALAQEGAAVGMLDADIYGPSQPRMLGISGKPTSKDGKKMEPLEGHGIKAMSIGFLIDEE 176

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
             M+WRGPMV  A+  +L +  WG+LD+L+ID+PPGTGD  LT+AQK+P+SG VIV+TPQ
Sbjct: 177 TPMVWRGPMVMQALEQLLSDTRWGELDYLVIDLPPGTGDTQLTLAQKVPVSGAVIVTTPQ 236

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D ++ + M++K+ +PI+G+IENMS+++    G + D+FG+GG    AE+ G+  L
Sbjct: 237 DIALLDARKGLKMFEKVGVPILGIIENMSFYICPKCGNEDDIFGHGGGALMAEQYGVELL 296

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
            +VP D  +R  +D G P VV   +S  ++IY+E++
Sbjct: 297 GAVPLDRRIRDEADNGAPTVVAAPDSPLAKIYRELA 332


>gi|163794808|ref|ZP_02188778.1| ATPase involved in chromosome partitioning [alpha proteobacterium
           BAL199]
 gi|159180081|gb|EDP64606.1| ATPase involved in chromosome partitioning [alpha proteobacterium
           BAL199]
          Length = 361

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 133/349 (38%), Positives = 216/349 (61%), Gaps = 16/349 (4%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M +I ++ ++ +L+ +  P    ++V    +  + I  + V  ++ V       L+ L  
Sbjct: 1   MAEITEDAVLTALRTVVDPSRGVDLVSAGMVESVTIRGSNVGFTLLVDAHRGAALEPLCR 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENK-------------NPPQQRNNLNVKKF---VAVASGK 104
            A+ ++Q +P V +A   LT +               PP   ++  + +F   +AVASGK
Sbjct: 61  RAEAVVQALPGVTSATGLLTAHSAAGAARRSSNPMMEPPVAVSSEPLAEFHYVIAVASGK 120

Query: 105 GGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYG 164
           GGVGKSTT  N+A +L  +G++V +LDADVYGPS P++L ++G+ +   +  + P ENY 
Sbjct: 121 GGVGKSTTAANLAVSLALEGRSVGLLDADVYGPSQPRMLGVTGRPKPLSQDTVAPLENYN 180

Query: 165 IKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQK 224
           +K++SM  L  E+  + WRGPMVQSA+  ML  V WG+LD+L+ID+PPGTGD  +T+ Q+
Sbjct: 181 VKLISMGLLAAEDTPIAWRGPMVQSALTQMLTKVAWGKLDYLVIDLPPGTGDVPITMIQQ 240

Query: 225 IPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGG 284
             + GVV+V TPQD+AL+D ++AI+M Q+  +PI+G+IENMS++   D G+   +FG+GG
Sbjct: 241 TSVDGVVVVCTPQDVALLDARKAIAMLQRAQVPILGVIENMSFYQCPDCGRVDHIFGHGG 300

Query: 285 ARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           A  EA++ G+P L ++P D+ VR   D G PIV+   NS  ++ +++ +
Sbjct: 301 AGKEAQRHGVPLLGAIPLDVAVRESGDSGTPIVIARPNSIHAQAFRDAA 349


>gi|163846753|ref|YP_001634797.1| hypothetical protein Caur_1178 [Chloroflexus aurantiacus J-10-fl]
 gi|222524566|ref|YP_002569037.1| hypothetical protein Chy400_1290 [Chloroflexus sp. Y-400-fl]
 gi|163668042|gb|ABY34408.1| protein of unknown function DUF59 [Chloroflexus aurantiacus
           J-10-fl]
 gi|222448445|gb|ACM52711.1| protein of unknown function DUF59 [Chloroflexus sp. Y-400-fl]
          Length = 364

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 138/339 (40%), Positives = 216/339 (63%), Gaps = 8/339 (2%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           ++QI+ +L+ +  P    ++V  Q +  I I    V  +I +          +RS A+  
Sbjct: 14  EDQILAALRQVQEPELGGDLVSRQMVKHIAICDGIVRCTIELTTPACPLKDQIRSEAEAA 73

Query: 66  IQNIPTVKNAVVTLTEN-KNP---PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           +  +P V+   +  T N + P   P+Q     V   +AVA+GKGGVGKST   N+A AL 
Sbjct: 74  VLAVPGVREVHIEFTANVRRPAGIPEQSAIPGVANVIAVAAGKGGVGKSTVAANLAVALA 133

Query: 122 NKGKNVAILDADVYGPSIPKLLKISGK-VEISD---KKFLKPKENYGIKIMSMASLVDEN 177
             G  V +LDADV+GPS+P +L + G+ + +SD   +  + P  N+GIK+MS+  L+DE+
Sbjct: 134 QMGAQVGLLDADVFGPSLPLMLGVRGQPMAVSDANGQPMMLPLSNHGIKVMSVGFLIDES 193

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
             +IWRGPMV   +   L+ V W  LD+L+IDMPPGTGD  LT+AQ +PL+G +IV+TPQ
Sbjct: 194 QPVIWRGPMVSQLLRQFLYQVAWAPLDYLIIDMPPGTGDVALTLAQSLPLTGALIVTTPQ 253

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
            +A IDV +A+ M++K+N+P++G++ENM+YF+A DTGK+YD+FG+GGA   A+++G+P L
Sbjct: 254 QVATIDVIKAMEMFRKVNVPLLGIVENMAYFIAPDTGKRYDIFGSGGAERLAQQLGVPVL 313

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P  M VR   D G P V+ +   A ++I++E++ ++
Sbjct: 314 GQIPLGMSVREGGDNGQPAVISDAPDAYADIFRELARQV 352


>gi|254460293|ref|ZP_05073709.1| Mrp/NBP35 family protein [Rhodobacterales bacterium HTCC2083]
 gi|206676882|gb|EDZ41369.1| Mrp/NBP35 family protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 352

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 118/241 (48%), Positives = 172/241 (71%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            + + +AVASGKGGVGKST   N+ACAL  +G+ V ILDADVYGPS P++L +SG+ +  
Sbjct: 103 GIDRIIAVASGKGGVGKSTVASNLACALAAEGRRVGILDADVYGPSQPRMLGVSGRPQSP 162

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K + P  NYG+ +MS+  + +E+ A++WRGPM+  A+  ML+ V WG LD L++D+PP
Sbjct: 163 DGKIILPLRNYGVTMMSIGLMTNEDQAVVWRGPMLMGALQQMLNQVQWGALDVLIVDLPP 222

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  +T+AQK  L G VIVSTPQD+AL+D ++ I M+ +M  P+IGMIENMS  + S+
Sbjct: 223 GTGDVQMTLAQKAHLDGAVIVSTPQDVALLDARKGIDMFNQMGTPVIGMIENMSTHICSN 282

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG+GG + EAEK+ +P L  +P  +D+RV +D G PIVV   NS  ++ ++++
Sbjct: 283 CGHEEHVFGHGGVKAEAEKLSVPLLAEIPLHLDIRVAADGGAPIVVSKPNSVQAKAFRDV 342

Query: 333 S 333
           +
Sbjct: 343 A 343


>gi|189219388|ref|YP_001940029.1| Mrp protein, an chromosome partitioning ATPase [Methylacidiphilum
           infernorum V4]
 gi|189186246|gb|ACD83431.1| Mrp protein, an ATPase involved in chromosome partitioning
           [Methylacidiphilum infernorum V4]
          Length = 344

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 140/344 (40%), Positives = 213/344 (61%), Gaps = 5/344 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVY--LSITVPHT-IAHQLQS 57
           M+ + K  I++ LK +  PG   +IV    + EI  +   V   L ++ P+  +  QL+ 
Sbjct: 1   MSILSKELILNQLKQVRYPGFSRDIVSFGLVKEIESLEGEVRIKLELSSPNPDVPGQLEK 60

Query: 58  LRSNAQQIIQNIPTVKNAVVTLTENKNPPQQR-NNLNVKKFVAVASGKGGVGKSTTVVNI 116
              +    ++ I  V+  V+   E+++ P+       +K  +A+ASGKGGVGKST   N+
Sbjct: 61  EIKSKLSTLEGIGNVQ-VVIKRPESRSLPKPSPTGSEIKHIIAIASGKGGVGKSTVAANL 119

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           ACAL  KG +V + D D+YGPSI  +       +I+  + L P E YG+K+MSM  L++ 
Sbjct: 120 ACALYKKGLDVGLCDCDIYGPSISMMFGTIESPQITPDERLIPVERYGLKLMSMGFLLEA 179

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           +   + RGP+V       L NV WG LDFL++D+PPGTGD  LTI Q + LSG VIV+TP
Sbjct: 180 DQPAVLRGPLVTRYTQEFLKNVDWGNLDFLVLDLPPGTGDIQLTIVQTVRLSGAVIVTTP 239

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q++AL+D ++A+SM++K+N+PI+G+IENMSYFL     +KYDLFG GG + EAEK  +PF
Sbjct: 240 QEVALVDARKAVSMFKKVNVPILGIIENMSYFLCPSDNQKYDLFGCGGGKREAEKQNVPF 299

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
           L  +P + ++R+ SD G+PIV+ + +  TS ++ E + +I  F 
Sbjct: 300 LGEIPIEPELRISSDQGLPIVLSDPDRKTSRVFLEAAKKIIDFL 343


>gi|149915669|ref|ZP_01904195.1| Mrp/NBP35 family protein [Roseobacter sp. AzwK-3b]
 gi|149810561|gb|EDM70404.1| Mrp/NBP35 family protein [Roseobacter sp. AzwK-3b]
          Length = 354

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 132/343 (38%), Positives = 212/343 (61%), Gaps = 13/343 (3%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + +  ++++LK ++ P   ++IV    +  + +  +TV   + +    A   + +R+ A+
Sbjct: 3   LTRETVLEALKAVNDPVSGSDIVSAGVMRGLNVEGDTVRFVLEIDPAKADIYEPVRAEAE 62

Query: 64  QIIQNIPTVKN--AVVTLTENKNPPQ---QRNNL--------NVKKFVAVASGKGGVGKS 110
             +  +    +  AV+T   +K PP    QR            V   +A+ASGKGGVGKS
Sbjct: 63  AAVNALAGAASVSAVLTGHSSKAPPDLKPQRKAEPQGPQHVPGVNHIIAIASGKGGVGKS 122

Query: 111 TTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSM 170
           T   N+ACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS+
Sbjct: 123 TVSANLACALAAEGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPMRNHGVTMMSI 182

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGV 230
             + +E+ A++WRGPM+  A+  ML  V WG LD LL+D+PPGTGD  +T+AQK  + G 
Sbjct: 183 GLMTNEDQAVVWRGPMLMGALQQMLMQVQWGALDVLLVDLPPGTGDVQMTLAQKAVVDGA 242

Query: 231 VIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAE 290
           ++VSTPQD+AL+D ++ I M+ ++++P++GMIENMS  + S  G +  +FG+GG + E E
Sbjct: 243 IVVSTPQDVALLDARKGIDMFNQLHVPVLGMIENMSTHICSQCGHEEHVFGHGGVKAECE 302

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           KIG+P L  VP  +D+R  SD G PIVV   ++  ++ ++EI+
Sbjct: 303 KIGVPLLAEVPLHIDIRTASDGGAPIVVSKPDAPQAQAFREIA 345


>gi|126664788|ref|ZP_01735772.1| Mrp/NBP35 family protein [Marinobacter sp. ELB17]
 gi|126631114|gb|EBA01728.1| Mrp/NBP35 family protein [Marinobacter sp. ELB17]
          Length = 281

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 117/251 (46%), Positives = 178/251 (70%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI 145
           P+ +N   + + +A++SGKGGVGKST   N+A AL +KG  V +LDADVYGPS P++L +
Sbjct: 20  PKDKNPEGIDRIIAISSGKGGVGKSTVASNLAVALASKGLKVGLLDADVYGPSQPRMLGV 79

Query: 146 SGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDF 205
           SG+    D   + P  N+G+ +MS+  +  ++ A+IWRGPM+  A+  M++ V WG+LD 
Sbjct: 80  SGRPSSPDGHTILPLRNHGVTLMSLGLMTPDDEAIIWRGPMLMGALEQMMNQVDWGRLDV 139

Query: 206 LLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENM 265
           LL+D+PPGTGD  +T++QK  ++G ++VSTPQD+AL+D ++ I M+ +M +P+ G+IENM
Sbjct: 140 LLVDLPPGTGDVQMTLSQKFFVAGAIVVSTPQDIALMDARKGIDMFNRMEVPLFGLIENM 199

Query: 266 SYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSAT 325
           + F+    GK++  FG+GGAR EA+KIG PFL  +P D+D+R+ SD G+PIVV    S  
Sbjct: 200 ASFVCDGCGKEHHPFGSGGARAEAKKIGAPFLGEIPLDLDIRIGSDGGVPIVVSKPESPQ 259

Query: 326 SEIYQEISDRI 336
           ++ +Q I+D I
Sbjct: 260 AQTFQRIADEI 270


>gi|198284374|ref|YP_002220695.1| chromosome partitioning ATPase protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218665483|ref|YP_002427038.1| Mrp protein [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198248895|gb|ACH84488.1| ATP-binding protein involved in chromosome partitioning
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218517696|gb|ACK78282.1| Mrp protein [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 358

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 175/244 (71%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            +K  +AVASGKGGVGKSTT VN+A AL  +G  V +LDAD+YGPS P++L ISGK    
Sbjct: 92  GIKNIIAVASGKGGVGKSTTAVNLALALAKEGAKVGMLDADIYGPSQPRMLGISGKPTSK 151

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P E +GIK MS+  L+D+   M+WRGPMV  A+  +L +  WG+LD+L++D+PP
Sbjct: 152 DGKKMEPMEGHGIKAMSIGFLIDDETPMVWRGPMVMQALEQLLSDTRWGELDYLVVDLPP 211

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQK+P+SG VIV+TPQD+AL+D ++ + M++K+ +PI+G+IENMS+++   
Sbjct: 212 GTGDTQLTLAQKVPVSGAVIVTTPQDIALLDARKGLKMFEKVGVPILGIIENMSFYICPK 271

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G + D+FG+GG    AE+ G+ FL ++P D  +R  +D G P VV   +S  ++IY E+
Sbjct: 272 CGNEDDIFGHGGGAAMAEQDGVEFLGAIPLDRSIRNEADNGAPTVVAEPDSRLAKIYLEL 331

Query: 333 SDRI 336
           +  +
Sbjct: 332 ARHV 335


>gi|309792553|ref|ZP_07687015.1| hypothetical protein OSCT_2966 [Oscillochloris trichoides DG6]
 gi|308225367|gb|EFO79133.1| hypothetical protein OSCT_2966 [Oscillochloris trichoides DG6]
          Length = 360

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 137/343 (39%), Positives = 216/343 (62%), Gaps = 8/343 (2%)

Query: 2   NQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSN 61
            QI + Q++ +L  +  P    ++V  + + ++ +  + V  ++ +          +R+ 
Sbjct: 3   QQISEQQVLAALSRVQEPELGGDLVSRRMIKDVQVEGSVVSFTVELTTPACPLKGQIRNE 62

Query: 62  AQQIIQNIPTVKNAVVTLTEN----KNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIA 117
            +  +  IP V    V  + N       P+Q     V   +AVA+GKGGVGKST   N+A
Sbjct: 63  TEAAVLAIPGVTEVKVEFSANVRQHAGIPEQAAIPGVANVIAVAAGKGGVGKSTVAANLA 122

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKVE-ISD---KKFLKPKENYGIKIMSMASL 173
            AL  +G +V +LDADV+GPS+P +L I+G+ E +SD   +  + P E YGIK +S+  L
Sbjct: 123 VALAQEGASVGLLDADVFGPSLPLMLGITGQPEAVSDAHGQAVMLPLEGYGIKTISVGFL 182

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           +DEN  +IWRGPMV   +   L+ V W  LD+L+IDMPPGTGD  LT+AQ +PL+G VIV
Sbjct: 183 IDENQPVIWRGPMVSQLLRQFLYQVAWAPLDYLIIDMPPGTGDIALTLAQSLPLTGAVIV 242

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQ +A IDV +A+ M++K+N+P++G++ENM+YFLA DTG++YD+FG+GGA+  A ++G
Sbjct: 243 TTPQTVATIDVIKAMEMFKKVNVPLVGVVENMAYFLAPDTGRRYDIFGSGGAQRVATQLG 302

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P L  +P  M VR   D G P V+ +   A +E+++E++ ++
Sbjct: 303 VPLLGQIPLGMAVRAGGDSGQPAVISDAPDAYAELFRELARQV 345


>gi|326404885|ref|YP_004284967.1| Mrp-like protein [Acidiphilium multivorum AIU301]
 gi|325051747|dbj|BAJ82085.1| protein Mrp homolog [Acidiphilium multivorum AIU301]
          Length = 360

 Score =  268 bits (686), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 191/295 (64%), Gaps = 10/295 (3%)

Query: 38  HNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNP-PQQRNNLN--- 93
              V +++ V    A + + +R   +  +  +P V+NA V  T  +   PQ +       
Sbjct: 36  EGLVQVALMVAKADAARQEPMRRALEADLAAMPGVRNATVMFTAPRAATPQPQAQAQEPG 95

Query: 94  -----VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGK 148
                V   VAVASGKGGVGKST  VN+A AL  +GK V +LDAD+YGPS+P++L   GK
Sbjct: 96  TLLGQVGSIVAVASGKGGVGKSTVAVNLAVALARQGKRVGLLDADIYGPSLPRMLGTKGK 155

Query: 149 VEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLI 208
            E++  K + P E +G+K +S+  +V+E  AM+WRGPMV +A+  ++  V W +LD +++
Sbjct: 156 PEMAGNKLV-PIEAWGLKAISIGHVVEEETAMVWRGPMVLNALTQLMTQVAWPELDVMVL 214

Query: 209 DMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYF 268
           D+PPGTGD  LT+AQ++ L+G VIVSTPQD++L+D +R ISM++++ +PI+G++ENMS+F
Sbjct: 215 DLPPGTGDVQLTLAQRLKLAGAVIVSTPQDISLLDARRGISMFRQVRVPILGVVENMSFF 274

Query: 269 LASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS 323
              + G + D+FG+GGA  EA+++G+PFL +VP    +R  SD G PI      S
Sbjct: 275 CCPNCGTRTDIFGHGGAEAEAQRLGVPFLGAVPLLAPIRETSDAGTPIAASAPES 329


>gi|220935784|ref|YP_002514683.1| hypothetical protein Tgr7_2621 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997094|gb|ACL73696.1| conserved hypothetical protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 363

 Score =  268 bits (685), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 138/339 (40%), Positives = 211/339 (62%), Gaps = 4/339 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+ + + Q+  +LK +  P  + ++V    +++I I    V + + + +  A     L  
Sbjct: 1   MSDVSRLQVETALKEIQDPYMEKDLVAASEIADIRIDGAKVAVDVRMGYPAAGYHAKLAD 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNI 116
             +  +  I  V +  V +         + NL     +K  +AVASGKGGVGKSTT VN+
Sbjct: 61  QIKAKVGGISGVSSVDVKVETRITAHAVQKNLKPMEGIKNIIAVASGKGGVGKSTTAVNL 120

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           A AL  +G  V ILDAD+YGPS P++L I GK E  D + ++P EN+GI+ MS+  L++E
Sbjct: 121 ALALAAEGATVGILDADIYGPSQPRMLGIHGKPESKDGRHMEPLENHGIQAMSIGFLIEE 180

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           +  MIWRGPMV  A+  +L +  W  LD+L+ID+PPGTGD  LT+AQKIP+SG VIV+TP
Sbjct: 181 DTPMIWRGPMVTQALEQLLRDTRWRGLDYLVIDLPPGTGDVQLTLAQKIPVSGAVIVTTP 240

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QD+AL+D ++ + M++K+ +P++G++ENMS  + S  G +  +FG GG    AE+ G+  
Sbjct: 241 QDIALLDARKGLKMFEKVEVPVLGIVENMSIHICSKCGHEEHIFGEGGGARMAEEYGVEL 300

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
           L ++P D+ +R  +D G P VV N +S  +EIY+EI+ R
Sbjct: 301 LGALPLDIHIREQADGGKPTVVANPDSRITEIYREIARR 339


>gi|241663774|ref|YP_002982134.1| hypothetical protein Rpic12D_2188 [Ralstonia pickettii 12D]
 gi|240865801|gb|ACS63462.1| protein of unknown function DUF59 [Ralstonia pickettii 12D]
          Length = 363

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 132/334 (39%), Positives = 211/334 (63%), Gaps = 4/334 (1%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
            QI ++L+ +  P    ++V  +    I +    V L + + +    Q + +R      +
Sbjct: 7   EQITEALRGVVDPNTGRDLVSSKSARNIRVDGGEVALDVELGYPAKSQFEPIRKLVIGAL 66

Query: 67  QNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +  V+N  V ++     +  Q+  +L  NVK  +AVASGKGGVGKSTT VN+A AL  
Sbjct: 67  RQVQGVENVSVQVSMKIVAHAVQRGVHLMPNVKNIIAVASGKGGVGKSTTAVNLALALSA 126

Query: 123 KGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIW 182
           +G NV ILDAD+YGPS P +L I G+ E +D K ++P E +G++  S+  L++++  M+W
Sbjct: 127 EGANVGILDADIYGPSQPMMLGIQGQPESADGKTMEPMEGHGLQANSIGFLIEQDNPMVW 186

Query: 183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI 242
           RGPMV SA+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+AL+
Sbjct: 187 RGPMVTSALEQLLKQTNWRDLDYLIVDMPPGTGDIQLTLSQKVPVTGAVIVTTPQDIALL 246

Query: 243 DVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPF 302
           D K+ + M++K+ IPIIG++ENM+ +   + G    +FG GG     E+ G+PFL S+P 
Sbjct: 247 DAKKGLKMFEKVGIPIIGVVENMAVYCCPNCGHTEHIFGAGGGEKMCEQYGVPFLGSLPL 306

Query: 303 DMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           ++ +R  +D G P VV + + A + +Y++I+ R+
Sbjct: 307 NLSIREQADSGRPTVVADPDGAIAGVYKQIARRV 340


>gi|219849366|ref|YP_002463799.1| hypothetical protein Cagg_2492 [Chloroflexus aggregans DSM 9485]
 gi|219543625|gb|ACL25363.1| protein of unknown function DUF59 [Chloroflexus aggregans DSM 9485]
          Length = 364

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 139/342 (40%), Positives = 214/342 (62%), Gaps = 8/342 (2%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           Q+ + QI+ +L+ +  P    ++V  Q +  I I    V  +I +          +R++ 
Sbjct: 11  QVTEEQILAALRQVQEPELGGDLVSRQMVKHIAICDGIVRCTIELTTPACPLKDQIRNDI 70

Query: 63  QQIIQNIPTVKNAVVTLTEN-KNP---PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
              +  +P VK   V  T N + P   P+Q     V   +AVA+GKGGVGKST   N+A 
Sbjct: 71  VAAVSAVPGVKEVNVDFTANVRRPAGIPEQAAIPGVANVLAVAAGKGGVGKSTVAANLAV 130

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGK-VEISD---KKFLKPKENYGIKIMSMASLV 174
           AL   G  V +LDADV+GPS+P +L I G+   +SD   +  + P  N+GIK+MS+  L+
Sbjct: 131 ALAQMGAQVGLLDADVFGPSLPLMLGIHGQPAAVSDANGQPMMLPLTNHGIKVMSVGFLI 190

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
           DE+  +IWRGPMV   +   L+ V W  LD+L+IDMPPGTGD  LT+AQ +PL+G +IV+
Sbjct: 191 DESQPVIWRGPMVSQLLRQFLYQVAWAPLDYLIIDMPPGTGDVALTLAQSLPLTGALIVT 250

Query: 235 TPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGI 294
           TPQ +A IDV +A+ M++K+N+P++G++ENM+YF+A DTGK+Y++FG+GGA   A ++G+
Sbjct: 251 TPQQVATIDVIKAMEMFRKVNVPLLGIVENMAYFVAPDTGKRYNIFGSGGAERLARRLGV 310

Query: 295 PFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           P L  +P  M VR   D G P V+ +   A +E+++E++ ++
Sbjct: 311 PLLGQIPLGMSVREGGDTGQPAVISDAPDAYAELFRELARQV 352


>gi|84501744|ref|ZP_00999916.1| Putative Mrp (Multidrug resistance-associated proteins) family
           protein [Oceanicola batsensis HTCC2597]
 gi|84390365|gb|EAQ02924.1| Putative Mrp (Multidrug resistance-associated proteins) family
           protein [Oceanicola batsensis HTCC2597]
          Length = 356

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 129/347 (37%), Positives = 204/347 (58%), Gaps = 21/347 (6%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHT-IAHQLQSLRSNAQQ 64
           +  ++ +L+ + +P +   +V+   +  + +   TV   I  P   +A +L  +R  AQ 
Sbjct: 5   RETVIAALQKIGLP-DGGTLVDRDLVRALSVEGGTVRFVIEAPSAEMARRLGPVRDAAQD 63

Query: 65  IIQNIPTVKNAVVTLT------ENKNP---------PQQR--NNLNVKKFVAVASGKGGV 107
            +  +P V++  V LT      E K P         PQ        V + +A+ASGKGGV
Sbjct: 64  AVAALPGVRDVSVVLTAHEAQKEQKAPQLKVGGHPTPQAGPMKPTGVDRIIAIASGKGGV 123

Query: 108 GKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKI 167
           GKST   N+A AL  +G+ V +LDAD+YGPS P+++  SG+    D K ++P   +G+ +
Sbjct: 124 GKSTVSANLAVALARQGRRVGLLDADIYGPSQPRMMGASGRPASPDGKTIEPLRAHGVTL 183

Query: 168 MSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPL 227
           MS+  +VDE  A++WRGPM+  A+  ML  V WGQLD L++D+PPGTGD  LT+ Q+  L
Sbjct: 184 MSIGFMVDEGKAVVWRGPMLMGALQQMLGQVAWGQLDVLIVDLPPGTGDVQLTLCQRSEL 243

Query: 228 SGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARF 287
           +G  +VSTPQD+AL+D ++AI M+  +  P++G+IENMS F+    G +  +FG+GG   
Sbjct: 244 TGAFVVSTPQDVALLDARKAIDMFATLKTPVLGLIENMSTFICPACGHESQIFGHGGVAA 303

Query: 288 EAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISD 334
           EA+++G+P L  +P D+D R+  D G PI     +   +E Y  +++
Sbjct: 304 EADRLGVPLLAQLPIDLDTRLSGDAGTPIAAG--DGPMAEAYGRLAE 348


>gi|282898281|ref|ZP_06306272.1| Mrp-like protein [Raphidiopsis brookii D9]
 gi|281196812|gb|EFA71717.1| Mrp-like protein [Raphidiopsis brookii D9]
          Length = 356

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/346 (37%), Positives = 222/346 (64%), Gaps = 10/346 (2%)

Query: 1   MNQILKNQ-IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLR 59
           M+ +L +Q +++ L+ +  P  + ++VE+  +  + I    V  ++ +        + + 
Sbjct: 1   MSNLLNSQSVLEVLRPVEDPELRKSLVELNMIRNVKIDGGKVSFTLVLTTPACPLREFIV 60

Query: 60  SNAQQIIQNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVN 115
            + ++ I+N+P V +  V +T    + K  P +     VK  +AV+SGKGGVGKST  VN
Sbjct: 61  EDCKKAIRNLPGVTDITVEVTAEIPQQKALPDRTGIQGVKNIIAVSSGKGGVGKSTIAVN 120

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGK---VEISDK-KFLKPKENYGIKIMSMA 171
           +A AL   G  V +LDAD+YGP+ P +L ++     V  S+K + L+P  NYG+K++SM 
Sbjct: 121 VAVALAQAGSKVGLLDADIYGPNDPTMLGLANAEIAVRSSEKGEILEPAFNYGVKLVSMG 180

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
            L+D +  ++WRGPM+   I   L+ V WG++D+L++DMPPGTGDA LT++Q +P+SG V
Sbjct: 181 FLIDRDQPVVWRGPMLNGVIRQFLYQVAWGEIDYLIVDMPPGTGDAQLTLSQAVPISGAV 240

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAE 290
           IV+TPQ++AL+D ++ + M+Q+MN+P++G++ENMSYF+  D   K+YD+FG+GG    A 
Sbjct: 241 IVTTPQNVALLDSRKGLRMFQQMNVPVLGIVENMSYFIPPDQQDKQYDIFGSGGGSKTAA 300

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           ++ +P L  VP +M +R+  D GIP+V+ + +S +++  + I+  I
Sbjct: 301 ELQVPLLGCVPLEMSIRIGGDNGIPVVISHPDSVSAQSLKAIAQGI 346


>gi|302765312|ref|XP_002966077.1| hypothetical protein SELMODRAFT_84330 [Selaginella moellendorffii]
 gi|300166891|gb|EFJ33497.1| hypothetical protein SELMODRAFT_84330 [Selaginella moellendorffii]
          Length = 278

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 124/245 (50%), Positives = 176/245 (71%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVEI 151
            V++ +AVASGKGGVGKSTT VN+A AL  K K  V +LDADVYGPSIP L+ +SG+ +I
Sbjct: 13  GVERIIAVASGKGGVGKSTTAVNLAVALALKCKLRVGLLDADVYGPSIPLLMNLSGQPKI 72

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
                + P ENYG+K MSM  L+D++  ++WRGPMV SA+  +   V WG+LD +++DMP
Sbjct: 73  DSANKMVPLENYGVKCMSMGFLMDKDAPVVWRGPMVMSALEKLTRGVSWGKLDIMVVDMP 132

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA ++++Q++ L+G VIVSTPQD+AL+D +R  +M+QK+++PI+G+IENMSYF+  
Sbjct: 133 PGTGDAQISVSQRLKLAGAVIVSTPQDIALLDARRGTNMFQKVHVPILGLIENMSYFICP 192

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+   +FG+GG    A+++ I FL  VP D+ +R  SD G PIV  + NS  + +Y  
Sbjct: 193 GCGQSSHIFGHGGCETTAKEMQIDFLGKVPLDVHIRETSDEGKPIVASSANSDVAAVYNS 252

Query: 332 ISDRI 336
           I+ RI
Sbjct: 253 IATRI 257


>gi|282901462|ref|ZP_06309387.1| protein of unknown function DUF59 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281193741|gb|EFA68713.1| protein of unknown function DUF59 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 356

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 130/347 (37%), Positives = 222/347 (63%), Gaps = 12/347 (3%)

Query: 1   MNQILKNQ-IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLR 59
           M+ +L +Q +++ L+ +  P  + ++VE+  +  + I    V  ++ +        + + 
Sbjct: 1   MSNLLNSQSVLEVLRPVEDPELRKSLVELNMIRNVKIDGGKVSFTLVLTTPACPLREFIV 60

Query: 60  SNAQQIIQNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVN 115
            + ++ I+N+P V +  V +T    + K+ P +     VK  +AV+SGKGGVGKST  VN
Sbjct: 61  EDCKKAIRNLPGVTDITVEVTAEIPQQKSLPDRTGIQGVKNIIAVSSGKGGVGKSTIAVN 120

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-----DKKFLKPKENYGIKIMSM 170
           +A AL   G  V +LDAD+YGP+ P +L ++   EI+     + + L+P  NYG+K++SM
Sbjct: 121 VAVALAQAGSKVGLLDADIYGPNDPTMLGLA-DAEIAVRSSENGEILEPAFNYGVKLVSM 179

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGV 230
             L+D +  ++WRGPM+   I   L+ V WG++D+L++DMPPGTGDA LT++Q +P+SG 
Sbjct: 180 GFLIDRDQPVVWRGPMLNGVIRQFLYQVAWGEIDYLIVDMPPGTGDAQLTLSQAVPISGA 239

Query: 231 VIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEA 289
           VIV+TPQ +AL+D ++ + M+Q+MN+P++G++ENMSYF+  D   K+YD+FG+GG    A
Sbjct: 240 VIVTTPQTVALLDSRKGLRMFQQMNVPVLGIVENMSYFIPPDQQDKQYDIFGSGGGSKTA 299

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            ++ +P L  VP +M +R+  D GIP+V+ + +S +++  + I+  I
Sbjct: 300 AELQVPLLGRVPLEMSIRIGGDNGIPVVISHPDSVSAQSLKAIAQGI 346


>gi|86140249|ref|ZP_01058810.1| Mrp/NBP35 family protein [Roseobacter sp. MED193]
 gi|85823052|gb|EAQ43266.1| Mrp/NBP35 family protein [Roseobacter sp. MED193]
          Length = 355

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 132/344 (38%), Positives = 208/344 (60%), Gaps = 14/344 (4%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I +  ++ +LK +S P    +IV       + +   +V   + +    A     +R  A+
Sbjct: 3   ITRESVLAALKNISDPVSGQDIVAAGLTRGLTVEGGSVLFVLEIDPAKADIYGPIRDQAE 62

Query: 64  QIIQNIPTVKNAVVTLTEN--KNPPQQ------------RNNLNVKKFVAVASGKGGVGK 109
            +++++  V+   V LT +  K PP              +    V + +AVASGKGGVGK
Sbjct: 63  SVVKDLAGVEKVSVMLTGHSAKAPPPDLKPSKPAAPQGPQKIPGVDRILAVASGKGGVGK 122

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMS 169
           ST   N+ACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS
Sbjct: 123 STVSANLACALAAQGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPLRNHGVTMMS 182

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           +  + +++ A++WRGPM+  A+  M+  V WG LD L++D+PPGTGD  +T+AQK  + G
Sbjct: 183 IGLMTNDDQAVVWRGPMLMGALQQMMMQVQWGALDVLIVDLPPGTGDVQMTLAQKAHVDG 242

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEA 289
            VIVSTPQD+ALID ++ I M+ K+N+PI+GMIENMS  + S+ G +  +FG+GG   EA
Sbjct: 243 AVIVSTPQDVALIDARKGIDMFNKLNVPIVGMIENMSTHICSNCGHEEHVFGHGGVAAEA 302

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
            K+ +P L  +P  +DVR+ +D G PIV    +SA ++ + +++
Sbjct: 303 AKLNVPLLAEIPLHLDVRLAADSGAPIVAAKPDSAQAKAFIDVA 346


>gi|289208947|ref|YP_003461013.1| ATPase-like, ParA/MinD [Thioalkalivibrio sp. K90mix]
 gi|288944578|gb|ADC72277.1| ATPase-like, ParA/MinD [Thioalkalivibrio sp. K90mix]
          Length = 363

 Score =  265 bits (678), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 132/339 (38%), Positives = 216/339 (63%), Gaps = 4/339 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M ++ + QI ++LK +     + ++V    + +I +      +++ + ++ +     LR+
Sbjct: 1   MAELSREQIENALKTVQDKYLEQDLVAAGAVKDIRVEGARAAITLEMGYSASGYHDELRA 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNI 116
             Q  +  +  ++++ VT+T        + +L     +K  +AVASGKGGVGKSTT VN+
Sbjct: 61  AIQGALAGVAGLESSEVTITTKVTAHAVQKSLKPMPGIKNIIAVASGKGGVGKSTTAVNL 120

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           A AL  +G  V ILDAD+YGPS P++L I  + E  D K ++P E +G++ MS+  L+DE
Sbjct: 121 ALALAAEGAQVGILDADIYGPSQPRMLGIKDRPESKDGKSMEPLERHGVQAMSIGFLIDE 180

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           +  MIWRGPMV  A+  +L+   W  LD+L+ID+PPGTGD  LT++QKIP+SG VIV+TP
Sbjct: 181 DTPMIWRGPMVTQALEQLLNETNWKDLDYLVIDLPPGTGDIQLTLSQKIPVSGAVIVTTP 240

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QD+AL+D ++ + M++K+ +P++G+IENMS  + S+ G +  +FG GGA   AE+ G+  
Sbjct: 241 QDIALLDARKGLRMFEKVEVPVLGIIENMSIHICSNCGHEEHIFGQGGAESMAEEYGVDM 300

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
           L ++P D+ +R  +D G P V+ + +   +EIY+EI+ R
Sbjct: 301 LGALPLDIRIREQADGGEPTVIADPDGRIAEIYREIARR 339


>gi|326429700|gb|EGD75270.1| ATPase [Salpingoeca sp. ATCC 50818]
          Length = 338

 Score =  265 bits (678), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 126/253 (49%), Positives = 179/253 (70%), Gaps = 2/253 (0%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK--NKGKNVAILDADVYGPSIPKLL 143
           P++     VK+ + V+S KGGVGKSTT VN+A AL+       V +LDADVYGPS+PKL+
Sbjct: 60  PRKWPIFGVKQIILVSSAKGGVGKSTTAVNLALALRAVKPSMAVGLLDADVYGPSLPKLM 119

Query: 144 KISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQL 203
            +SG+  I+D+  + P  NYGIK MSM  LVDE   ++WRG MV SAI  +L  V WG L
Sbjct: 120 NLSGQPNINDRNLMIPLVNYGIKCMSMGFLVDEADPIVWRGLMVMSAIQKLLRQVAWGDL 179

Query: 204 DFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIE 263
           D L+IDMPPGTGD  L+IAQ++P+ G VIVSTPQDLAL+D +R ++M++K++IP++G+++
Sbjct: 180 DVLVIDMPPGTGDTQLSIAQQVPVDGAVIVSTPQDLALLDARRGVNMFRKVDIPVLGIVQ 239

Query: 264 NMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS 323
           NMS+FL  + G    +FG+GGA+  A+++G+  +  +P DMD+R LSD G PIVV    S
Sbjct: 240 NMSHFLCPNCGHASSIFGSGGAQDLADEVGVDIIGDLPLDMDIRTLSDEGKPIVVAQPES 299

Query: 324 ATSEIYQEISDRI 336
             +E Y+ ++  +
Sbjct: 300 KQAESYRVLAQNV 312


>gi|302776496|ref|XP_002971408.1| hypothetical protein SELMODRAFT_96143 [Selaginella moellendorffii]
 gi|300160540|gb|EFJ27157.1| hypothetical protein SELMODRAFT_96143 [Selaginella moellendorffii]
          Length = 278

 Score =  265 bits (677), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 176/245 (71%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVEI 151
            V++ +AVASGKGGVGKSTT VN+A AL  K K  V +LDADVYGPSIP L+ +SG+ +I
Sbjct: 13  GVERIIAVASGKGGVGKSTTAVNLAVALALKCKLRVGLLDADVYGPSIPLLMNLSGQPKI 72

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
                + P ENYG+K MSM  L++++  ++WRGPMV SA+  +   V WG+LD +++DMP
Sbjct: 73  DSANKMIPLENYGVKCMSMGFLMEKDAPVVWRGPMVMSALEKLTRGVSWGKLDIMVVDMP 132

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA ++++Q++ L+G VIVSTPQD+AL+D +R  +M+QK+++PI+G+IENMSYF+  
Sbjct: 133 PGTGDAQISVSQRLKLAGAVIVSTPQDIALLDARRGTNMFQKVHVPILGLIENMSYFICP 192

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+   +FG+GG    A+++ I FL  VP D+ +R  SD G PIV  + NS  + +Y  
Sbjct: 193 GCGQSSHIFGHGGCETTAKEMQIDFLGKVPLDVHIRETSDEGKPIVASSANSDVAAVYNS 252

Query: 332 ISDRI 336
           I+ RI
Sbjct: 253 IATRI 257


>gi|307825406|ref|ZP_07655625.1| ATPase-like, ParA/MinD [Methylobacter tundripaludum SV96]
 gi|307733581|gb|EFO04439.1| ATPase-like, ParA/MinD [Methylobacter tundripaludum SV96]
          Length = 363

 Score =  265 bits (676), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 137/339 (40%), Positives = 217/339 (64%), Gaps = 4/339 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M  I K  + D L+    P    ++V  + +  I I  N V + + + +     +  L++
Sbjct: 1   MASIEKADVEDLLQTFIDPNNGTDLVSAKSVKAIVIDGNNVSVKLELGYPAKSYIAELKA 60

Query: 61  NAQQIIQNIPTVKNAVVTLTEN--KNPPQQ--RNNLNVKKFVAVASGKGGVGKSTTVVNI 116
             ++ ++ +  + +  V ++     +  QQ  +   NVK  +AVASGKGGVGKSTT VN+
Sbjct: 61  AVEEHLKTLAGIGDVSVEVSVKILSHAVQQALKPLPNVKNIIAVASGKGGVGKSTTAVNL 120

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           A AL  +G NV ILDAD+YGPSIP +L +SG  E  D+K + PK  YG++ +S+  LV+ 
Sbjct: 121 ALALAAEGANVGILDADIYGPSIPMMLGLSGLPESKDQKTMMPKIAYGVQTISIGYLVEA 180

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           + AMIWRGPMV +A+  +L +  W  LD+L+ID+PPGTGD  LT++Q+IP+SG +IV+TP
Sbjct: 181 DQAMIWRGPMVTTALQQLLKDTNWDNLDYLVIDLPPGTGDIQLTLSQQIPVSGAIIVTTP 240

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QD+ALID +R + M++K+N+P++G++ENMS  + S+ G +  +FG GG    AE+  I F
Sbjct: 241 QDIALIDAQRGLGMFEKVNVPVLGLVENMSMHICSNCGHEEAIFGEGGGLAMAERNRIEF 300

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
           L S+P D+++R  +D G P VV + +   ++IY++I+ +
Sbjct: 301 LGSLPLDINIRQFADSGRPTVVADPDGRPAQIYRQIARK 339


>gi|159045811|ref|YP_001534605.1| hypothetical protein Dshi_3271 [Dinoroseobacter shibae DFL 12]
 gi|157913571|gb|ABV95004.1| hypothetical protein Dshi_3271 [Dinoroseobacter shibae DFL 12]
          Length = 357

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 127/349 (36%), Positives = 207/349 (59%), Gaps = 16/349 (4%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + ++ ++++LK +  P    ++V    +  + +    V   + V    A +++  R+ A+
Sbjct: 3   VTRDAVLETLKQVKDPLGGGDLVSAGMIRALTVDDGVVRFVMEVDPKRAAEVEPARAEAE 62

Query: 64  QIIQNIPTVKNAVVTLT----------------ENKNPPQQRNNLNVKKFVAVASGKGGV 107
             ++ +  V +    +T                +   P   +    + + +A+ASGKGGV
Sbjct: 63  ARLKALAGVASVSAVMTAHAAPAAPPELKPQSAKAAGPAGPQKIPGIDRILAIASGKGGV 122

Query: 108 GKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKI 167
           GKST   N+A AL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +
Sbjct: 123 GKSTVASNLATALAAEGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPLRNHGVTL 182

Query: 168 MSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPL 227
           MS+  +  EN A++WRGPM+  A+  ML  V WG LD LL+D+PPGTGD  +T+AQK  +
Sbjct: 183 MSLGLMTGENEAVVWRGPMLMGALQQMLTQVQWGALDVLLVDLPPGTGDVQMTLAQKAEV 242

Query: 228 SGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARF 287
           +G +IVSTPQD+AL+D ++ I M+ K+  PI+GMIENMS  + S  G +  +FG+GG R 
Sbjct: 243 TGAIIVSTPQDIALLDARKGIDMFNKLGTPILGMIENMSTHICSQCGHEEHVFGHGGVRD 302

Query: 288 EAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           EA K+G+P +  +P DM +R+ +D G PIVV +  S  +E ++ I+ ++
Sbjct: 303 EAAKLGVPVMAEIPLDMSIRMAADGGTPIVVSHPQSPQAESFRMIARQL 351


>gi|163731472|ref|ZP_02138919.1| hypothetical protein RLO149_19249 [Roseobacter litoralis Och 149]
 gi|161394926|gb|EDQ19248.1| hypothetical protein RLO149_19249 [Roseobacter litoralis Och 149]
          Length = 355

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 127/348 (36%), Positives = 214/348 (61%), Gaps = 16/348 (4%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIV-HNTVYLSITVPHTIAHQLQSLRSNA 62
           + ++ ++ +LK +S P   ++IV    +  + +     V   + V  +     ++++  A
Sbjct: 3   LTRDAVLAALKTVSDPISDSDIVAAGLVKALTVDDKGAVRFVMEVSPSQVKTYEAVKDAA 62

Query: 63  QQIIQNIPTVKNAVVTLTENKNP-------PQQRNNLN-------VKKFVAVASGKGGVG 108
           ++ +Q++       V +T +  P       PQ+ +  +       + + +A+ASGKGGVG
Sbjct: 63  EKAVQDL-GASAVQVLMTAHSTPAAPPDLKPQRSSEPSGPQKIPGIDRILAIASGKGGVG 121

Query: 109 KSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIM 168
           KST   NIACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  NYG+ +M
Sbjct: 122 KSTLSANIACALAAEGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKIILPMRNYGVTMM 181

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           S+  + +E+ A++WRGPM+  A+  M++ V WG LD L++D+PPGTGD  +T+ QK  + 
Sbjct: 182 SIGLMQNEDQAVVWRGPMLMGALQQMMNQVQWGALDVLIVDLPPGTGDVQMTLTQKFQVD 241

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFE 288
           G ++VSTPQD+AL+D ++ I M+ ++  PI+GMIENMS  + S+ G +  +FG+GG   E
Sbjct: 242 GAIVVSTPQDVALLDARKGIDMFNQLGTPILGMIENMSTHICSNCGHEEHVFGHGGVARE 301

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           AEKIG+P L  +P  +D+R+ +D G PIVV   +S  +  +++++ R+
Sbjct: 302 AEKIGVPLLAEIPLHLDIRLAADGGAPIVVSKPDSPQATAFRDVAKRL 349


>gi|126727355|ref|ZP_01743190.1| Mrp/NBP35 family protein [Rhodobacterales bacterium HTCC2150]
 gi|126703350|gb|EBA02448.1| Mrp/NBP35 family protein [Rhodobacterales bacterium HTCC2150]
          Length = 351

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 172/255 (67%)

Query: 79  LTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPS 138
           L +   P        + + +AVASGKGGVGKST   N+ACAL  +G+ V ILDADVYGPS
Sbjct: 88  LAKKAAPSGPEKIPGIDRIIAVASGKGGVGKSTVASNLACALAAEGRRVGILDADVYGPS 147

Query: 139 IPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNV 198
            P++L +SG+ +  D K + P  N+G+ +MS+  + +++ A++WRGPM+  A+  ML  V
Sbjct: 148 QPRMLGVSGRPQSPDGKLILPLRNFGVTMMSIGLMTNDDQAVVWRGPMLMGALQQMLTQV 207

Query: 199 VWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPI 258
            WG LD L++D+PPGTGD  +T+AQK  L G VIVSTPQD+AL+D ++ I M+ ++  PI
Sbjct: 208 QWGALDVLIVDLPPGTGDVQMTLAQKAHLDGAVIVSTPQDVALLDARKGIDMFNQLGTPI 267

Query: 259 IGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVV 318
           IGMIENMS  + S  G +  +FG+GG   EAEK+G+P L  +P  +D+R+ +D G PIVV
Sbjct: 268 IGMIENMSTHICSQCGHEEHVFGHGGVVSEAEKLGVPLLAEIPLHLDIRLAADGGAPIVV 327

Query: 319 HNMNSATSEIYQEIS 333
               SA ++ ++ ++
Sbjct: 328 SKPESAQAQAFRTVA 342


>gi|254451936|ref|ZP_05065373.1| Mrp/NBP35 family protein [Octadecabacter antarcticus 238]
 gi|198266342|gb|EDY90612.1| Mrp/NBP35 family protein [Octadecabacter antarcticus 238]
          Length = 355

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 205/345 (59%), Gaps = 14/345 (4%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           +  I+  L  L  P    +IVE   +  + +    V   + V    A    +L+  A   
Sbjct: 5   REAILGILAGLEDPISGTSIVEAGVIKALTVEDGVVRFVMEVSGEHADAYTALKDKADVQ 64

Query: 66  IQNIPTVKNAVVTLT---ENKNPPQQRNNLN-----------VKKFVAVASGKGGVGKST 111
           I+ +  V +  + +T   ++K PP  + +             + + +AVASGKGGVGKST
Sbjct: 65  IKALDGVASVSIVMTAHNKSKAPPDLKPSRGAASAGPEKVPGIDRIIAVASGKGGVGKST 124

Query: 112 TVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMA 171
              N+ACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS+ 
Sbjct: 125 VASNLACALAAEGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPMRNFGVTMMSLG 184

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
            + +++ A++WRGPM+  A+  ML  V WG LD L++D+PPGTGD  +T+AQK  L G +
Sbjct: 185 LMTNDDQAVVWRGPMLMGALQQMLSQVQWGALDVLIVDLPPGTGDVQMTLAQKAKLDGAI 244

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEK 291
           IVSTPQD+AL+D ++ I M+ ++  P+IGMIENMS  + S  G +  +FG+GG   EA K
Sbjct: 245 IVSTPQDIALLDARKGIDMFNQLGTPLIGMIENMSTHICSACGHEEHMFGHGGVATEAAK 304

Query: 292 IGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +GIP L  +P  +D+R+ +D G PIVV   +S  +  +++++ ++
Sbjct: 305 LGIPLLAEIPLHIDIRLAADGGAPIVVSKPDSPHAAAFRDVAKQL 349


>gi|83593539|ref|YP_427291.1| hypothetical protein Rru_A2204 [Rhodospirillum rubrum ATCC 11170]
 gi|83576453|gb|ABC23004.1| Protein of unknown function DUF59 [Rhodospirillum rubrum ATCC
           11170]
          Length = 382

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 133/363 (36%), Positives = 216/363 (59%), Gaps = 31/363 (8%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFI-VHNTVYLSITVPHTIAHQLQSLR 59
           M  + ++ ++ +L  +  PG  +++V +  +  + I     V +S+ VP  +   L+ L 
Sbjct: 1   MASVTRDDVLGALTRIVPPGADHDVVSLGWIDGVAIQPGGLVSVSLAVPAALGPSLEPLS 60

Query: 60  SNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL--------------------------- 92
             A+  ++ +  V  A V LT  + PPQ  N                             
Sbjct: 61  RQAEDALRALAGVTRATVILTAQR-PPQAENAQQRPPQAEKKPQPGAGGHGHATSQARIE 119

Query: 93  --NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVE 150
              V+  +AVASGKGGVGKSTT VN+A  L   G  VA+ DAD+YGPSIP++L ++    
Sbjct: 120 LPGVRHIIAVASGKGGVGKSTTAVNLALGLTALGLKVALFDADIYGPSIPRMLGVASVKP 179

Query: 151 ISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDM 210
           +++ K + P  N+G+ +MS+  ++ E+  +IWRGPMV  A+  +L +V WG  D +++DM
Sbjct: 180 VANGKKVMPVTNHGLSMMSIGFMIAEDDPIIWRGPMVMGALEQLLRDVDWGTQDVMVVDM 239

Query: 211 PPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLA 270
           PPGTGD  LT+ Q++ LSG VIVSTPQD+AL+D KR ++M++++++P++G+IENMSY L 
Sbjct: 240 PPGTGDTQLTMCQRVALSGAVIVSTPQDIALLDAKRGLAMFRRVDVPVLGLIENMSYHLC 299

Query: 271 SDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQ 330
           ++ G + D+F +GGAR  A+++G+PFL  +P D+ +R  SD G+PI + +     +  Y+
Sbjct: 300 TNCGHREDVFSHGGARRTAQELGVPFLGELPLDIRIRSGSDEGMPITLSDPEGDHALAYK 359

Query: 331 EIS 333
            I+
Sbjct: 360 AIA 362


>gi|114320711|ref|YP_742394.1| hypothetical protein Mlg_1557 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227105|gb|ABI56904.1| protein of unknown function DUF59 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 362

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 132/336 (39%), Positives = 207/336 (61%), Gaps = 4/336 (1%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+ Q+  +L+ +  P  + ++V  + + EI +  + V + + + +      + L    + 
Sbjct: 4   LRAQVEAALQEVVDPALEMDLVSAECVKEIAVDGDRVRIDVQLGYPADTVRKELAEQLRT 63

Query: 65  IIQNIPTVKNAVVTLTENKNP----PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACAL 120
             + +P V  A VTL     P    P  +    VK  +AVASGKGGVGKSTT VN+A AL
Sbjct: 64  AAEGVPGVAAAEVTLQSVVEPHTVQPGVKLLDEVKNIIAVASGKGGVGKSTTAVNLALAL 123

Query: 121 KNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAM 180
             +G  V +LDAD+YGPS P++L IS + E  D K L P  NYGI+ MS   L+DE   M
Sbjct: 124 AAEGARVGMLDADIYGPSQPRMLGISARPESRDGKKLDPVVNYGIQAMSSGFLIDEETPM 183

Query: 181 IWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLA 240
           +WRGPMV  A+  ++ +  W  LD+L++DMPPGTGD  LT+AQ++P+SG VI++TPQD+A
Sbjct: 184 VWRGPMVTQALDQLIRDTRWEGLDYLIVDMPPGTGDVQLTLAQRVPVSGAVIITTPQDIA 243

Query: 241 LIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESV 300
           L+D ++ + M++K+N+P++G++ENMS  + S  G    +FG GG +  A++ G+  L S+
Sbjct: 244 LLDARKGLKMFEKVNVPVLGVVENMSIHICSQCGHAEHIFGEGGGQRMADQYGVDLLGSL 303

Query: 301 PFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           P D+ +R  +D G P V+   +   +E Y++I+ R+
Sbjct: 304 PLDISIREQADSGRPSVISEPDGKVAESYRQIARRV 339


>gi|253996892|ref|YP_003048956.1| hypothetical protein Mmol_1525 [Methylotenera mobilis JLW8]
 gi|253983571|gb|ACT48429.1| protein of unknown function DUF59 [Methylotenera mobilis JLW8]
          Length = 362

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 137/331 (41%), Positives = 208/331 (62%), Gaps = 4/331 (1%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPH---TIAHQLQSLRSNAQQI 65
           I  +LK+   P    + V  +    I +  N V + I + +   ++   +Q+L + A   
Sbjct: 8   IQSTLKLCIDPNTGKDFVSSKSARNIKVDGNDVSVDIVLGYPAKSVEADIQNLVAQALLA 67

Query: 66  IQNIPTVKNAVVTLTENKNPPQQRNNL-NVKKFVAVASGKGGVGKSTTVVNIACALKNKG 124
           I+ I  V   V +        Q    L NVK  +AVASGKGGVGKSTT VN+A AL  +G
Sbjct: 68  IEGIGRVAVHVSSKIVAHKAQQGVTLLPNVKNIIAVASGKGGVGKSTTSVNLALALAVEG 127

Query: 125 KNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRG 184
            +V +LDAD+YGPS P++L ISG+ E  D K ++P E +GI+ MS+  L+D +  M+WRG
Sbjct: 128 ASVGLLDADIYGPSQPQMLGISGRPESLDGKSMEPMEAHGIQAMSIGFLIDTDTPMVWRG 187

Query: 185 PMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDV 244
           PMV  A+  +L +  W  LD+L+ID+PPGTGD  LT+AQKIP++G +IV+TPQD+AL+D 
Sbjct: 188 PMVTGALEQLLRDTKWRDLDYLVIDLPPGTGDIQLTLAQKIPVTGAIIVTTPQDIALLDA 247

Query: 245 KRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDM 304
           ++ + M++K++IPI+G++ENMS  + S+ G +  +FG GG    A+   +  L S+P D+
Sbjct: 248 RKGLKMFEKVSIPILGIVENMSTHICSNCGHEEHIFGAGGGELMAKDYNVDLLGSLPLDI 307

Query: 305 DVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
           D+R+ +D G P V  N +S  + IY+EI+ +
Sbjct: 308 DIRLQADSGKPTVTANPDSKVANIYKEIARK 338


>gi|300866326|ref|ZP_07111029.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300335669|emb|CBN56189.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 356

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 131/339 (38%), Positives = 215/339 (63%), Gaps = 9/339 (2%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
           N +++ L+ +  P    ++VE+  +  I I    V  ++ +        + +  + Q+ +
Sbjct: 8   NSVLEILRPVQDPELGKSLVELNMIRNIKIDGGKVSFTLVLTTPACPLREFIVEDCQKAV 67

Query: 67  QNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +P V+   V +T    + K  P ++    VK  +A++SGKGGVGKST  VN+A AL  
Sbjct: 68  KQLPGVEGVEVEVTAETPKQKGVPDRQGIEGVKNILAISSGKGGVGKSTIAVNVAVALAQ 127

Query: 123 KGKNVAILDADVYGPSIPKLLKIS-GKVEIS---DKKFLKPKENYGIKIMSMASLVDENV 178
            G  V +LDAD+YGP+ P +L ++  KV ++       L+P  NYG+K++SMA L+D++ 
Sbjct: 128 LGAKVGLLDADIYGPNDPTMLGLAEAKVMVTKGPQGDILEPAFNYGVKLVSMAFLIDKDQ 187

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            +IWRGPM+   I   L+ V WG LD+L++DMPPGTGDA LT+AQ +P++G VIV+TPQ 
Sbjct: 188 PVIWRGPMLNGIIRQFLYQVQWGDLDYLIVDMPPGTGDAQLTMAQAVPMAGAVIVTTPQT 247

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPFL 297
           +AL+D ++ + M+Q++ +P++G++ENMSYF+  D   K+YD+FG+GG    A ++G+P L
Sbjct: 248 VALLDSRKGLKMFQQLGVPVLGIVENMSYFIPPDMPDKQYDIFGSGGGEKTAAELGVPLL 307

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             VP ++ +R   D G+PIVV   +SA+++  + I+ RI
Sbjct: 308 GRVPLEIPLREGGDGGVPIVVGQPDSASAKELKAIAQRI 346


>gi|258593122|emb|CBE69433.1| Protein mrp homolog [NC10 bacterium 'Dutch sediment']
          Length = 360

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 129/333 (38%), Positives = 200/333 (60%), Gaps = 3/333 (0%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + +  ++++L  +  P    +IV +  + ++ I    V  +I +        + +   A+
Sbjct: 2   VTERAVLEALAKIPDPDLHRDIVSLGFIRDVQIDGGKVRFAIELTTPACPVRKQMEEGAR 61

Query: 64  QIIQNIPTVKNAVVTLTE---NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACAL 120
           Q++  +P V+   VT+T        PQ      V   VAVASGKGGVGKST   N+A AL
Sbjct: 62  QVVAALPGVEQVEVTMTSRVTTSREPQPSYLSGVLNTVAVASGKGGVGKSTVAANLAVAL 121

Query: 121 KNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAM 180
              G  V ++DADVYGP IPKL+   G +E ++   + P   +G+KIMSM   + +N A+
Sbjct: 122 MRTGARVGLMDADVYGPCIPKLMGGGGALEQTEAGRMIPPLMHGVKIMSMGFFLPKNEAV 181

Query: 181 IWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLA 240
           +WRGPM+   +   L +V WG+LD+L+ID+PPGTGD  L++ Q IPL+G VIVSTPQD+A
Sbjct: 182 VWRGPMLHKMVQEFLGHVEWGELDYLVIDLPPGTGDIQLSLCQTIPLTGAVIVSTPQDVA 241

Query: 241 LIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESV 300
           L    +AI M+ K+  PI+G++ENMSY+  S  G + D+FG+GGA+  +EK  IPFL  +
Sbjct: 242 LEVASKAILMFNKLKTPILGIVENMSYYACSQCGHREDIFGHGGAKAASEKAEIPFLGEI 301

Query: 301 PFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           P D  +R  SD G P+ + + +++ +  + E++
Sbjct: 302 PLDSYIRRSSDEGRPVAMESADTSVARAFHEVA 334


>gi|83950411|ref|ZP_00959144.1| Mrp/NBP35 family protein [Roseovarius nubinhibens ISM]
 gi|83838310|gb|EAP77606.1| Mrp/NBP35 family protein [Roseovarius nubinhibens ISM]
          Length = 359

 Score =  262 bits (670), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 128/346 (36%), Positives = 205/346 (59%), Gaps = 15/346 (4%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFI-VHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +  ++ +LK +S P   ++I+    +  + I     V   + +    A   +++++ A+ 
Sbjct: 8   RESVIATLKTISDPISGDDIMASGVVRALNIEPTGAVRFVMEINPAHAKAYEAVKAAAET 67

Query: 65  IIQNIPTVKNAVVTLT--ENKNPPQQ------------RNNLNVKKFVAVASGKGGVGKS 110
            +  +  V +  + LT   +K PP              +    V   +A+ASGKGGVGKS
Sbjct: 68  ALAGLDGVASVSIVLTGHSDKAPPPDLKPSRAAQPSGPQKIPGVNHIIAIASGKGGVGKS 127

Query: 111 TTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSM 170
           T   N+ACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS+
Sbjct: 128 TVSANLACALAQQGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPMRNHGVTMMSI 187

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGV 230
             + +E+ A++WRGPM+  A+  M+  V WG LD LL+D+PPGTGD  +T+AQK  + G 
Sbjct: 188 GLMTNEDQAVVWRGPMLMGALQQMMMQVQWGALDVLLVDLPPGTGDVQMTLAQKAHVDGA 247

Query: 231 VIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAE 290
           +IVSTPQD+AL+D ++ I M+Q++ +PI+GM+ENMS  + S  G +  +FG+GG   EAE
Sbjct: 248 IIVSTPQDVALLDARKGIDMFQQLKVPILGMVENMSTHICSSCGHEEHVFGHGGVAAEAE 307

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           K+G+P L  VP D+ +R+ SD G PI V   +   +  +  I+  +
Sbjct: 308 KLGVPLLAEVPLDLQIRLASDGGAPITVSQPDGPQARAFHAIASHL 353


>gi|148261396|ref|YP_001235523.1| ATPase involved in chromosome partitioning-like protein
           [Acidiphilium cryptum JF-5]
 gi|146403077|gb|ABQ31604.1| ATPase involved in chromosome partitioning-like protein
           [Acidiphilium cryptum JF-5]
          Length = 360

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 124/295 (42%), Positives = 189/295 (64%), Gaps = 10/295 (3%)

Query: 38  HNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL----- 92
              V +++ V    A + + +R   +  +  +P V+NA V  T  +    Q         
Sbjct: 36  EGLVQVALMVAKADAARQEPMRRALEADLAAMPGVRNATVMFTAPRAAAPQPQAQAQEPG 95

Query: 93  ----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGK 148
                V   VAVASGKGGVGKST  VN+A AL  +GK V +LDAD+YGPS+P++L   GK
Sbjct: 96  TLLGQVGSIVAVASGKGGVGKSTVAVNLAVALARQGKRVGLLDADIYGPSLPRMLGTKGK 155

Query: 149 VEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLI 208
            E++  K + P E +G+K +S+  +V+E  AM+WRGPMV +A+  ++  V W +LD +++
Sbjct: 156 PEMAGNKLV-PIEAWGLKAISIGHVVEEETAMVWRGPMVLNALTQLMTQVAWPELDVMVL 214

Query: 209 DMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYF 268
           D+PPGTGD  LT+AQ++ L+G VIVSTPQD++L+D +R ISM++++ +PI+G++ENMS+F
Sbjct: 215 DLPPGTGDVQLTLAQRLKLAGAVIVSTPQDISLLDARRGISMFRQVRVPILGVVENMSFF 274

Query: 269 LASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS 323
              + G + ++FG+GGA  EA+++G+PFL +VP    +R  SD G PI      S
Sbjct: 275 CCPNCGTRTEIFGHGGAEAEAQRLGVPFLGAVPLLAPIRETSDAGTPIAASAPES 329


>gi|187929664|ref|YP_001900151.1| hypothetical protein Rpic_2592 [Ralstonia pickettii 12J]
 gi|309781568|ref|ZP_07676303.1| mrP protein [Ralstonia sp. 5_7_47FAA]
 gi|187726554|gb|ACD27719.1| protein of unknown function DUF59 [Ralstonia pickettii 12J]
 gi|308919673|gb|EFP65335.1| mrP protein [Ralstonia sp. 5_7_47FAA]
          Length = 363

 Score =  262 bits (669), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 132/334 (39%), Positives = 213/334 (63%), Gaps = 4/334 (1%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
            QI ++L+ +  P  ++++V  +    I +    V L + + +    Q + +R      +
Sbjct: 7   EQITEALRGVVDPNTEHDLVSSKSARNIRVDGGEVSLDVELGYPAKSQFEPIRKLVIGAL 66

Query: 67  QNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +  V+N  V ++     +  Q+  +L  NVK  +AVASGKGGVGKSTT VN+A AL  
Sbjct: 67  RQVQGVENVSVQVSMKIVAHAVQRGVHLMPNVKNIIAVASGKGGVGKSTTAVNLALALAA 126

Query: 123 KGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIW 182
           +G NV ILDAD+YGPS P +L I G+ E +D K ++P E +G++  S+  L++++  M+W
Sbjct: 127 EGANVGILDADIYGPSQPMMLGIQGQPESADGKTMEPMEGHGLQANSIGFLIEQDNPMVW 186

Query: 183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI 242
           RGPMV SA+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+AL+
Sbjct: 187 RGPMVTSALEQLLKQTNWRDLDYLIVDMPPGTGDIQLTLSQKVPVTGAVIVTTPQDIALL 246

Query: 243 DVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPF 302
           D K+ + M++K+ IPIIG++ENM+ +   + G    +FG GG     E+ G+PFL S+P 
Sbjct: 247 DAKKGLKMFEKVGIPIIGVVENMAVYCCPNCGHTEHIFGAGGGEKMCEQYGVPFLGSLPL 306

Query: 303 DMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           ++ +R  +D G P VV + + A + +Y++I+ R+
Sbjct: 307 NLSIREQADSGRPTVVADPDGAIAGVYKQIARRV 340


>gi|296537071|ref|ZP_06899047.1| cobyrinic Acid a,c-diamide synthase [Roseomonas cervicalis ATCC
           49957]
 gi|296262603|gb|EFH09252.1| cobyrinic Acid a,c-diamide synthase [Roseomonas cervicalis ATCC
           49957]
          Length = 338

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 175/246 (71%), Gaps = 1/246 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            V   VAVASGKGGVGKSTT VN+A AL   G  V +LDAD+YGPS+P++L    K   +
Sbjct: 79  EVGAIVAVASGKGGVGKSTTAVNLAVALAADGLRVGLLDADIYGPSLPQMLGTRDKPRAT 138

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
             + + P   +G+K MS+  LV+E   MIWRGPMV  A+  ML  V WG LD L++DMPP
Sbjct: 139 GGRII-PLSRWGLKAMSIGFLVEEETPMIWRGPMVMGALEQMLGQVEWGALDVLVVDMPP 197

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGDA LT++Q++PL+G VIVSTPQD+ALID +R I M++K+N+P++G+IENMS++   +
Sbjct: 198 GTGDAQLTMSQRVPLAGAVIVSTPQDVALIDARRGIRMFEKVNVPVLGLIENMSFYCCPN 257

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G   ++FG+GGAR EAE++G+ FL  +P  +++R L+D G PIV+   +S  +  Y+ I
Sbjct: 258 CGHTANIFGHGGARAEAERMGVEFLGELPLKLEIRELADAGTPIVMARPDSHEAGAYRAI 317

Query: 333 SDRIQQ 338
           + R++Q
Sbjct: 318 AARLRQ 323


>gi|145348579|ref|XP_001418724.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144578954|gb|ABO97017.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 289

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 120/246 (48%), Positives = 165/246 (67%), Gaps = 1/246 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           +  +  AVASGKGGVGKSTT VNIA AL   G  VA+LDADVYGPS+P L+++SG+  + 
Sbjct: 36  SCARVFAVASGKGGVGKSTTCVNIAVALARLGHRVALLDADVYGPSVPTLMRLSGQPVVD 95

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
               + P EN+G++  SM  L+    A  WRGPMV  A+  M+ +  WG +D L++DMPP
Sbjct: 96  ADGRMLPMENHGVRCQSMGFLMKPGAAATWRGPMVSGALTKMIQDTRWGDVDVLMVDMPP 155

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGDA ++I+QK+PL+G V+VSTPQ+LAL D +R I MY K+N  ++G++ENM+Y+   D
Sbjct: 156 GTGDAQISISQKLPLTGAVVVSTPQELALADARRGIDMYGKVNTEVVGVVENMAYYCEKD 215

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
             + Y +FG GGAR  A + G+ FL  VP D  +R  SD G PIVV + +   + IY  I
Sbjct: 216 GTRSY-VFGRGGARATAAERGVEFLAEVPLDATIRESSDEGAPIVVRDPDGEVAAIYTNI 274

Query: 333 SDRIQQ 338
           + RI +
Sbjct: 275 ARRIME 280


>gi|114763312|ref|ZP_01442736.1| Mrp/NBP35 family protein [Pelagibaca bermudensis HTCC2601]
 gi|114544110|gb|EAU47120.1| Mrp/NBP35 family protein [Roseovarius sp. HTCC2601]
          Length = 354

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 191/307 (62%), Gaps = 12/307 (3%)

Query: 39  NTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTEN--KNPPQQRNNL---- 92
             V   + +P + +     ++  A+  ++    V    + +T +  K PP+ R       
Sbjct: 39  GAVRFVMEIPPSASTAYTKIKDEAEAALKATEGVTGVSIVMTGHTEKAPPELRTRKAEPQ 98

Query: 93  ------NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKIS 146
                  V   +A+ASGKGGVGKST   N+ACAL  +G+ V +LDADVYGPS P++L +S
Sbjct: 99  GPQKIPGVNHIIAIASGKGGVGKSTVSSNLACALAQQGRRVGLLDADVYGPSQPRMLGVS 158

Query: 147 GKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFL 206
           G+    D K + P  N+G+ +MS+  + +++ A++WRGPM+  A+  M+  V WG LD L
Sbjct: 159 GRPASPDGKTILPLRNHGVTMMSIGLMTNDDQAVVWRGPMLMGALQQMMTQVQWGALDVL 218

Query: 207 LIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMS 266
           L+D+PPGTGD  +T++QK  + G ++VSTPQD+AL+D ++ I M++++N+P++GMIENMS
Sbjct: 219 LVDLPPGTGDVQMTLSQKAQVDGAIVVSTPQDVALLDARKGIDMFKQLNVPLLGMIENMS 278

Query: 267 YFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATS 326
             + S  G +  +FG+GG   EA K+G+P L  +P D+ +R+ SD G PIVV   +S  +
Sbjct: 279 THICSACGHEEHVFGHGGVASEAAKLGVPLLAEIPLDLQIRLASDGGAPIVVSQPDSGQA 338

Query: 327 EIYQEIS 333
           + + +++
Sbjct: 339 KAFHDVA 345


>gi|260430289|ref|ZP_05784263.1| Mrp/NBP35 family protein [Citreicella sp. SE45]
 gi|260418761|gb|EEX12017.1| Mrp/NBP35 family protein [Citreicella sp. SE45]
          Length = 359

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/345 (35%), Positives = 208/345 (60%), Gaps = 15/345 (4%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFI-VHNTVYLSITVPHTIAHQLQSLRSNA 62
           + ++ ++ +LK +  P    +IV    +  + +     V   + +    A     +++ A
Sbjct: 6   LTRDAVLVALKTVDDPVAGGDIVASGVMRALNVSAEGAVRFVLEIAPRHAETYTDVKTRA 65

Query: 63  QQIIQNIPTVKNAVVTLT---ENKNPPQ---QRNN--------LNVKKFVAVASGKGGVG 108
           +++++ +P V    + LT   E   PP    QR            + + +A+ASGKGGVG
Sbjct: 66  EEVLRALPGVTAVSIVLTGHTEKAPPPDLKPQRAAEPKGPQKVPGIDRILAIASGKGGVG 125

Query: 109 KSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIM 168
           KST   N+A AL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +M
Sbjct: 126 KSTVSANLAVALAQQGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKTILPMRNHGVTMM 185

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           S+  + +++ A++WRGPM+  A+  ML  V WG LD L++D+PPGTGD  +T++QK  + 
Sbjct: 186 SIGLMTNDDQAVVWRGPMLMGALQQMLTQVQWGALDVLIVDLPPGTGDVQMTLSQKAQVD 245

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFE 288
           G +IVSTPQD+AL+D ++ I M+Q++ +P++GMIENMS  + S  G +  +FG+GG   E
Sbjct: 246 GAIIVSTPQDVALLDARKGIDMFQQLKVPLVGMIENMSTHICSACGHEEHVFGHGGVAAE 305

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           A K+G+P L  +P D+ +R+ +D G PI +   +SA ++ + +I+
Sbjct: 306 AAKLGVPLLAEIPLDLQIRLAADGGAPIAISQPDSAQAQAFHDIA 350


>gi|186476940|ref|YP_001858410.1| cobyrinic acid a,c-diamide synthase [Burkholderia phymatum STM815]
 gi|184193399|gb|ACC71364.1| Cobyrinic acid ac-diamide synthase [Burkholderia phymatum STM815]
          Length = 362

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 123/329 (37%), Positives = 208/329 (63%), Gaps = 4/329 (1%)

Query: 12  SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPT 71
           +L  ++ P  +      +    + +   TV + + + +    Q  ++R+  +  ++ +P 
Sbjct: 11  ALAAITDPNTQRPFAAAKNFRNVNVDGATVSVDVVLGYPAKRQFDAIRALVESALRAVPG 70

Query: 72  VKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNV 127
           V +  V ++++   +  Q+   L  NVK  VAVASGKGGVGKSTT VN+A AL ++G +V
Sbjct: 71  VADTRVQVSQDIAAHTVQRGVKLLPNVKNIVAVASGKGGVGKSTTAVNLALALASEGASV 130

Query: 128 AILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMV 187
            ILDAD+YGPS+P +L I G+ E  D + + P   +G++  S+  L++++  M+WRGPM 
Sbjct: 131 GILDADIYGPSLPMMLGIEGRPESPDGQSMNPMTGHGVQANSIGFLIEQDNPMVWRGPMA 190

Query: 188 QSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRA 247
            SA+  +L    W  LD+L++DMPPGTGD  LT++Q++P++G VIV+TPQD+AL+D K+ 
Sbjct: 191 TSALEQLLRQTAWKDLDYLIVDMPPGTGDIQLTLSQRVPVTGAVIVTTPQDIALLDAKKG 250

Query: 248 ISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVR 307
           + M++K+ IPI+G++ENM   + S+ G +  +FG GGA   +++ G+  L S+P D+ +R
Sbjct: 251 LKMFEKVGIPILGIVENMGLHICSNCGHEEHIFGTGGAERMSKEYGVDVLGSLPLDISIR 310

Query: 308 VLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +D G P VV + +   +EIY+ I+ ++
Sbjct: 311 EQADSGQPTVVADPDGRVAEIYRSIARKV 339


>gi|149927351|ref|ZP_01915606.1| ATPase involved in chromosome partitioning [Limnobacter sp. MED105]
 gi|149823843|gb|EDM83068.1| ATPase involved in chromosome partitioning [Limnobacter sp. MED105]
          Length = 363

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/335 (37%), Positives = 208/335 (62%), Gaps = 5/335 (1%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
           + + ++L+ +  P    + +  + +  I +    V   + + +    QL  LR  A   +
Sbjct: 6   DTVREALRSVIDPNLNKDFISAKLIKNIQVDGGDVSFELELSYPGKSQLDGLRKAAIAAV 65

Query: 67  Q-NIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIACALK 121
           +  +P V+N  V  T        +  L    NVK  +AVASGKGGVGKSTT VN+A AL 
Sbjct: 66  RAQVPGVENVSVNATIKIQTHAVQRGLKPMPNVKNIIAVASGKGGVGKSTTAVNLALALV 125

Query: 122 NKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMI 181
            +G  V +LDAD+YGPS P +L I+G+ +  D + + P E +G++ MS+  L+DE+  M+
Sbjct: 126 AEGARVGMLDADIYGPSQPTMLGITGRPQSDDGQIIDPMEGHGVQAMSIGFLIDEDTPMV 185

Query: 182 WRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLAL 241
           WRGPMV SA+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+AL
Sbjct: 186 WRGPMVTSALEQLLKQTNWKDLDYLIVDMPPGTGDIQLTLSQKVPVTGAVIVTTPQDIAL 245

Query: 242 IDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVP 301
           +D ++ + M++K+ +PI+G++ENM+  + ++ G K  +FG+GG +  A+   I +L  +P
Sbjct: 246 LDARKGLKMFEKVGVPILGLVENMAIHVCTNCGHKEHIFGDGGGQKMAKDYNIHYLGGLP 305

Query: 302 FDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            DM +R+ +D G P VV + +   ++ Y+EI+ ++
Sbjct: 306 LDMRIRMQADSGKPTVVADPDGDLAKTYKEIARKV 340


>gi|300703369|ref|YP_003744971.1| Na+/H+ antiporter [Ralstonia solanacearum CFBP2957]
 gi|299071032|emb|CBJ42341.1| Na+/H+ antiporter [Ralstonia solanacearum CFBP2957]
          Length = 362

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 132/334 (39%), Positives = 210/334 (62%), Gaps = 4/334 (1%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
            QI ++L+ +  P    ++V  + +  + +    V L + + +    Q + +R      +
Sbjct: 6   EQITEALRGVVDPNTGRDLVSSKSVRNVRVDGGDVSLDVELGYPAKSQFEPIRKLVIGAL 65

Query: 67  QNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +  V N  V ++     +  Q+  +L  NVK  +AVASGKGGVGKSTT VN+A AL  
Sbjct: 66  RQVEGVANVSVQVSMKIVAHAVQRGIHLLPNVKNIIAVASGKGGVGKSTTAVNLALALAA 125

Query: 123 KGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIW 182
           +G NV ILDAD+YGPS P +L I G+ E +D K ++P E +G++  S+  L++++  M+W
Sbjct: 126 EGANVGILDADIYGPSQPMMLGIQGQPESTDGKTMEPMEGHGLQANSIGFLIEQDNPMVW 185

Query: 183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI 242
           RGPMV SA+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+ALI
Sbjct: 186 RGPMVTSALEQLLKQTNWRDLDYLIVDMPPGTGDIQLTLSQKVPVTGAVIVTTPQDIALI 245

Query: 243 DVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPF 302
           D K+ + M++K+ IPIIG++ENM+ +   + G    +FG GG      + G+PFL S+P 
Sbjct: 246 DAKKGLKMFEKVGIPIIGVVENMAIYCCPNCGHTEHIFGAGGGEKMCAQYGVPFLGSLPL 305

Query: 303 DMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           ++ +R  +D G P VV + + A + +Y+EI+ R+
Sbjct: 306 NLSIREQADSGRPTVVADPDGAIAGVYREIARRV 339


>gi|220908002|ref|YP_002483313.1| hypothetical protein Cyan7425_2597 [Cyanothece sp. PCC 7425]
 gi|219864613|gb|ACL44952.1| protein of unknown function DUF59 [Cyanothece sp. PCC 7425]
          Length = 356

 Score =  260 bits (664), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 216/340 (63%), Gaps = 9/340 (2%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           +  I+D L+ +  P  + ++VE+  + ++ I +  V  ++ +        + +  + ++ 
Sbjct: 7   RESILDVLRPVQDPELRKSLVELNMIRDVAIANGNVSFTLVLTTPACPLREFIVEDCKKA 66

Query: 66  IQNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I  +P V+N  V +T    + K+ P +     VK  +AV+SGKGGVGKST  VNIA AL 
Sbjct: 67  IATLPGVQNIDVKVTAETPQQKSLPDRTGIKGVKNIIAVSSGKGGVGKSTVAVNIAVALA 126

Query: 122 NKGKNVAILDADVYGPSIPKLLKISGK-VEISDK---KFLKPKENYGIKIMSMASLVDEN 177
             G +V ++DAD+YGP+ P +L +    VE+  +     L+P  N+G+K++SM  L+D++
Sbjct: 127 QAGASVGMIDADIYGPNAPTMLGLEQAIVEVRKEPQGDVLEPAFNHGVKLVSMGFLIDKD 186

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
             +IWRGPM+   I   L+   WG LD+L++D+PPGTGDA LT+AQ +P++GVVIV+TPQ
Sbjct: 187 QPVIWRGPMLNGIIRQFLYQADWGDLDYLIVDLPPGTGDAQLTLAQAVPMAGVVIVTTPQ 246

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPF 296
            +AL+D ++ + M+Q++ +P++G++ENMSYF+  D   + YD+FG+ G    A ++G+P 
Sbjct: 247 TVALLDARKGLRMFQQLGVPVLGLVENMSYFIPPDLPDRHYDIFGSKGGEKMATELGVPL 306

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L SVP ++ +R   D G+PIV+   +SA+++  + I+ ++
Sbjct: 307 LGSVPLEIQLREGGDQGLPIVLSAPDSASAQALRAIAQQV 346


>gi|242032897|ref|XP_002463843.1| hypothetical protein SORBIDRAFT_01g007300 [Sorghum bicolor]
 gi|241917697|gb|EER90841.1| hypothetical protein SORBIDRAFT_01g007300 [Sorghum bicolor]
          Length = 298

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 121/247 (48%), Positives = 177/247 (71%), Gaps = 1/247 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVEI 151
            V   +AVASGKGGVGKSTT VNIA AL  + K  V +LDAD+YGPS+P ++ +  K E+
Sbjct: 35  GVSDIIAVASGKGGVGKSTTAVNIAVALAKEFKLQVGLLDADIYGPSVPTMMNLHAKPEV 94

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           S+   + P EN+G++ MS+  LVD++  ++WRGPMV SA+  M   V WG LD L++DMP
Sbjct: 95  SEDMKMIPVENHGVRCMSIGFLVDKDAPIVWRGPMVMSALEKMTRGVAWGDLDILVVDMP 154

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA L+++Q++ LSG +IVSTPQD+ALID +R  +M++K+ +PI+G++ENMS F   
Sbjct: 155 PGTGDAQLSMSQRLRLSGALIVSTPQDIALIDARRGANMFRKVQVPILGLVENMSCFKCP 214

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  AE++ +  L +VP ++ +R  SD G PIVV + NSA+++ Y  
Sbjct: 215 KCGEKSYIFGEGGAQRTAEEMDMKLLGAVPLEIGIRTGSDEGQPIVVSSPNSASAQAYVN 274

Query: 332 ISDRIQQ 338
           I++++ Q
Sbjct: 275 IAEKVTQ 281


>gi|257061850|ref|YP_003139738.1| hypothetical protein Cyan8802_4109 [Cyanothece sp. PCC 8802]
 gi|256592016|gb|ACV02903.1| protein of unknown function DUF59 [Cyanothece sp. PCC 8802]
          Length = 353

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 128/340 (37%), Positives = 213/340 (62%), Gaps = 9/340 (2%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           +  ++D L+ +  P  + ++V++  +  + I  NTV  ++ +        + +  + Q+ 
Sbjct: 4   RQSVLDVLRPVQDPELQKSLVDLNMIRHVEIEGNTVSFTLVLTTPACPLREFIVEDCQKA 63

Query: 66  IQNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           ++ +P V+   VT+T    + K  P Q+     K  +AV+SGKGGVGKST  VNIA AL 
Sbjct: 64  VKQLPGVETVNVTVTAETPQQKALPNQQAIPGTKNIIAVSSGKGGVGKSTVAVNIAVALA 123

Query: 122 NKGKNVAILDADVYGPSIPKLLKIS-GKVEI---SDKKFLKPKENYGIKIMSMASLVDEN 177
             G  V +LDAD+YGP+ P +L ++  +V +   S  + L+P  NYG+K++SM  L+D +
Sbjct: 124 QSGAKVGLLDADIYGPNAPTMLGLANAQVNVKQDSQGEILEPAFNYGVKMVSMGFLIDPD 183

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
             +IWRGPM+   I   L+ V WG LD+L++DMPPGTGDA LT+AQ +P++G VIV+TPQ
Sbjct: 184 QPVIWRGPMLNGIIRQFLYQVNWGNLDYLVVDMPPGTGDAQLTLAQGVPIAGAVIVTTPQ 243

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPF 296
            ++L+D +R + M++++ + ++G++ENMSYF+  D   + YDLFG+GG    A+++ +P 
Sbjct: 244 TVSLLDARRGLKMFEQLGVKVLGIVENMSYFIPPDLPDRSYDLFGSGGGEKAAKELNVPL 303

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L  VP ++ +R   D GIPIV+    SA+++    I+ ++
Sbjct: 304 LGCVPLEIALREGGDQGIPIVMSAPESASAKALTAIAKQV 343


>gi|218248791|ref|YP_002374162.1| hypothetical protein PCC8801_4070 [Cyanothece sp. PCC 8801]
 gi|218169269|gb|ACK68006.1| protein of unknown function DUF59 [Cyanothece sp. PCC 8801]
          Length = 353

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 128/340 (37%), Positives = 213/340 (62%), Gaps = 9/340 (2%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           +  ++D L+ +  P  + ++V++  +  + I  NTV  ++ +        + +  + Q+ 
Sbjct: 4   RQSVLDVLRPVQDPELQKSLVDLNMIRHVEIEGNTVSFTLVLTTPACPLREFIVEDCQKA 63

Query: 66  IQNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           ++ +P V+   VT+T    + K  P Q+     K  +AV+SGKGGVGKST  VNIA AL 
Sbjct: 64  VKQLPGVETVNVTVTAEIPQQKALPNQQAIPGTKNIIAVSSGKGGVGKSTVAVNIAVALA 123

Query: 122 NKGKNVAILDADVYGPSIPKLLKIS-GKVEI---SDKKFLKPKENYGIKIMSMASLVDEN 177
             G  V +LDAD+YGP+ P +L ++  +V +   S  + L+P  NYG+K++SM  L+D +
Sbjct: 124 QSGAKVGLLDADIYGPNAPTMLGLANAQVNVKQDSQGEILEPAFNYGVKMVSMGFLIDPD 183

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
             +IWRGPM+   I   L+ V WG LD+L++DMPPGTGDA LT+AQ +P++G VIV+TPQ
Sbjct: 184 QPVIWRGPMLNGIIRQFLYQVNWGNLDYLVVDMPPGTGDAQLTLAQGVPIAGAVIVTTPQ 243

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPF 296
            ++L+D +R + M++++ + ++G++ENMSYF+  D   + YDLFG+GG    A+++ +P 
Sbjct: 244 TVSLLDARRGLKMFEQLGVKVLGIVENMSYFIPPDLPDRSYDLFGSGGGEKAAKELNVPL 303

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L  VP ++ +R   D GIPIV+    SA+++    I+ ++
Sbjct: 304 LGCVPLEIALREGGDQGIPIVMSAPESASAKALTAIAKQV 343


>gi|163747830|ref|ZP_02155168.1| hypothetical protein OIHEL45_18586 [Oceanibulbus indolifex HEL-45]
 gi|161378902|gb|EDQ03333.1| hypothetical protein OIHEL45_18586 [Oceanibulbus indolifex HEL-45]
          Length = 356

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 114/244 (46%), Positives = 168/244 (68%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            V + +A+ASGKGGVGKST   N+ACAL  +G+ V +LDADVYGPS P++L +SG+    
Sbjct: 107 GVDRIIAIASGKGGVGKSTVSANLACALAAQGRRVGLLDADVYGPSQPRMLGVSGRPASP 166

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K + P  N+G+ +MS+  + +E+ A++WRGPM+  A+  M+  V WG LD L++D+PP
Sbjct: 167 DGKTILPMRNHGVTMMSIGLMTNEDQAVVWRGPMLMGALQQMMTQVQWGALDVLIVDLPP 226

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  +T+AQK  + G VIVSTPQD+ALID ++ I M+ ++ +PI+GMIENMS  + ++
Sbjct: 227 GTGDVQMTLAQKAHVDGAVIVSTPQDVALIDARKGIDMFNQLKVPILGMIENMSTHICTN 286

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG+GG   EAEK G+P L  VP D+ +R+ SD G PI V   +S  +  +  I
Sbjct: 287 CGHEEHVFGHGGVASEAEKWGVPLLAEVPLDLQIRLASDGGAPITVSQPDSKQAAAFHAI 346

Query: 333 SDRI 336
           + ++
Sbjct: 347 AKQL 350


>gi|153872440|ref|ZP_02001332.1| iron sulfur binding protein [Beggiatoa sp. PS]
 gi|152071092|gb|EDN68666.1| iron sulfur binding protein [Beggiatoa sp. PS]
          Length = 361

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 172/243 (70%)

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISD 153
           VK  +AVASGKGGVGKSTT VN+A AL  +G  V ILDAD+YGPS P +L I+ + E  D
Sbjct: 96  VKNIIAVASGKGGVGKSTTAVNLALALSAEGAKVGILDADIYGPSQPSMLGINQQPESKD 155

Query: 154 KKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPG 213
            K L+P  +Y ++ MS+  LV+EN  MIWRGPMV  A+  +L +  W +LD+L++D+PPG
Sbjct: 156 GKSLEPVMSYDLQSMSIGYLVEENTPMIWRGPMVTQALEQLLKDTCWHELDYLIVDLPPG 215

Query: 214 TGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDT 273
           TGD  LT+AQKIP+SG VI++TPQD+ALID ++ + M++K+N+ ++G+IENMS  + S  
Sbjct: 216 TGDTQLTLAQKIPVSGCVIITTPQDIALIDARKGLKMFEKVNVAVLGVIENMSIHICSQC 275

Query: 274 GKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           G +  +FG GG    A++  + FL S+P D+ +R  +D G P VV   +S  S+IY+EI+
Sbjct: 276 GHEEHIFGKGGGLQMAQESEVDFLGSLPLDIRIREETDGGKPTVVAEPDSRISQIYREIA 335

Query: 334 DRI 336
            RI
Sbjct: 336 RRI 338


>gi|207721380|ref|YP_002251821.1| mrp atpase involved in chromosome partitioning protein [Ralstonia
           solanacearum MolK2]
 gi|206586539|emb|CAQ17126.1| mrp atpase involved in chromosome partitioning protein [Ralstonia
           solanacearum MolK2]
          Length = 362

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 132/334 (39%), Positives = 210/334 (62%), Gaps = 4/334 (1%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
            QI ++L+ +  P    ++V  + +  + +    V L + + +    Q + +R      +
Sbjct: 6   EQITEALRGVVDPNTGRDLVSSKSVRNVRVDGGDVSLDVELGYPAKSQFEPIRKLVIGAL 65

Query: 67  QNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +  V N  V ++     +  Q+  +L  NVK  +AVASGKGGVGKSTT VN+A AL  
Sbjct: 66  RQLEGVANVSVQVSMKIVAHAVQRGIHLLPNVKNIIAVASGKGGVGKSTTAVNLALALAA 125

Query: 123 KGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIW 182
           +G NV ILDAD+YGPS P +L I G+ E +D K ++P E +G++  S+  L++++  M+W
Sbjct: 126 EGANVGILDADIYGPSQPMMLGIQGQPESTDGKTMEPMEGHGLQANSIGFLIEQDNPMVW 185

Query: 183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI 242
           RGPMV SA+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+ALI
Sbjct: 186 RGPMVTSALEQLLKQTNWRDLDYLIVDMPPGTGDIQLTLSQKVPVTGAVIVTTPQDIALI 245

Query: 243 DVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPF 302
           D K+ + M++K+ IPIIG++ENM+ +   + G    +FG GG      + G+PFL S+P 
Sbjct: 246 DAKKGLKMFEKVGIPIIGVVENMAIYCCPNCGHTEHIFGAGGGEKMCAQYGVPFLGSLPL 305

Query: 303 DMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           ++ +R  +D G P VV + + A + +Y+EI+ R+
Sbjct: 306 NLSIREQADSGRPTVVADPDGAIAGVYREIARRV 339


>gi|258592435|emb|CBE68744.1| putative ATPase of the MinD/MRP superfamily
           (mrp-like)(ATP/GTP-binding protein) [NC10 bacterium
           'Dutch sediment']
          Length = 358

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 119/339 (35%), Positives = 208/339 (61%), Gaps = 5/339 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           Q+ ++ ++ +L+ +  PG   ++V    +    +   TV+L + VP   A  +  + ++ 
Sbjct: 5   QLTEDMVISALRQVKYPGMSRDLVSFGMIKNARVEGATVHLDLQVPTEDAEVVAKVEASV 64

Query: 63  QQIIQNIPTVKNAVVTLTENKNP----PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
           ++ +  +P +    +       P    P       V++ VAVASGKGGVGKST  VN+A 
Sbjct: 65  REALSRVPGIGEIRIQNAPRPAPQESAPGPAPLPGVRRIVAVASGKGGVGKSTVSVNLAL 124

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENV 178
           AL   G  V +LDAD+YGP++P++L   G+ +  + K + P   +G++++S+  L+ E  
Sbjct: 125 ALAQSGAAVGLLDADIYGPNVPRMLGELGRPKAHEGKIV-PLVRHGLRVISVGYLLGEQS 183

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            +IWRGP+V  A+  +LH V WG+LD+L++D+PPGTGD  LT+ Q +PL+G VIV+TP  
Sbjct: 184 PIIWRGPLVAQALKQLLHEVHWGELDYLIVDLPPGTGDTQLTLVQAVPLTGGVIVTTPSA 243

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +AL+D +R + M+++  +PI+G++ENMSYF+      + D+F  GG R  ++ +G+PFL 
Sbjct: 244 VALMDAERGLRMFREARVPILGIVENMSYFICPHCQGETDIFSRGGGRQVSDSLGVPFLG 303

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
            +P +  +R   D G P+VV    SA ++I+++++D+++
Sbjct: 304 EIPLNPTIREGGDTGAPVVVAMPESAEAQIFRDVADKVR 342


>gi|209522322|ref|ZP_03270945.1| Cobyrinic acid ac-diamide synthase [Burkholderia sp. H160]
 gi|209497241|gb|EDZ97473.1| Cobyrinic acid ac-diamide synthase [Burkholderia sp. H160]
          Length = 362

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 126/329 (38%), Positives = 204/329 (62%), Gaps = 4/329 (1%)

Query: 12  SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPT 71
           ++ V++ P         + +  + +  + V L +T+ +    Q  ++R      ++ +P 
Sbjct: 11  AIAVVADPNTGAPYAAAKSIRNVVVEGDAVSLQVTLGYPAKRQFDAIRQQFADALRAVPG 70

Query: 72  VKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNV 127
           V N  V +++    +  Q+   L   VK  VAVASGKGGVGKSTT VN+A AL ++G +V
Sbjct: 71  VANVRVEISQQIAAHTVQRGVKLLPGVKNIVAVASGKGGVGKSTTAVNLALALASEGASV 130

Query: 128 AILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMV 187
            ILDAD+YGPS+P +L I G+ E  D K + P   +G++  S+  L++ +  M+WRGPM 
Sbjct: 131 GILDADIYGPSLPTMLGIEGRPESPDDKSMNPMIGHGVQANSIGFLIEADNPMVWRGPMA 190

Query: 188 QSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRA 247
            SA+  +L    W +LD+L++DMPPGTGD  LT+AQ++P++G VIV+TPQD+AL+D K+ 
Sbjct: 191 TSALEQLLRQTNWHELDYLIVDMPPGTGDIQLTLAQRVPVTGAVIVTTPQDIALLDAKKG 250

Query: 248 ISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVR 307
           + M++K+ IPI+G++ENM   + S+ G +  +FG GG     ++ G+  L S+P D+ +R
Sbjct: 251 LKMFEKVGIPILGIVENMGLHICSNCGHEEHIFGAGGGERMGKEYGVDVLGSLPLDITIR 310

Query: 308 VLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +D G P VV + N   +EIY+ I+ ++
Sbjct: 311 EQADSGHPTVVADPNGRIAEIYRTIARKV 339


>gi|83746717|ref|ZP_00943766.1| Iron-sulfur cluster assembly/repair protein ApbC [Ralstonia
           solanacearum UW551]
 gi|83726670|gb|EAP73799.1| Iron-sulfur cluster assembly/repair protein ApbC [Ralstonia
           solanacearum UW551]
          Length = 422

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 132/334 (39%), Positives = 210/334 (62%), Gaps = 4/334 (1%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
            QI ++L+ +  P    ++V  + +  + +    V L + + +    Q + +R      +
Sbjct: 66  EQITEALRGVVDPNTGRDLVSSKSVRNVRVDGGDVSLDVELGYPAKSQFEPIRKLVIGAL 125

Query: 67  QNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +  V N  V ++     +  Q+  +L  NVK  +AVASGKGGVGKSTT VN+A AL  
Sbjct: 126 RQLEGVANVSVQVSMKIVAHAVQRGIHLLPNVKNIIAVASGKGGVGKSTTAVNLALALAA 185

Query: 123 KGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIW 182
           +G NV ILDAD+YGPS P +L I G+ E +D K ++P E +G++  S+  L++++  M+W
Sbjct: 186 EGANVGILDADIYGPSQPMMLGIQGQPESADGKTMEPMEGHGLQANSIGFLIEQDNPMVW 245

Query: 183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI 242
           RGPMV SA+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+ALI
Sbjct: 246 RGPMVTSALEQLLKQTNWRDLDYLIVDMPPGTGDIQLTLSQKVPVTGAVIVTTPQDIALI 305

Query: 243 DVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPF 302
           D K+ + M++K+ IPIIG++ENM+ +   + G    +FG GG      + G+PFL S+P 
Sbjct: 306 DAKKGLKMFEKVGIPIIGVVENMAIYCCPNCGHTEHIFGAGGGEKMCAQYGVPFLGSLPL 365

Query: 303 DMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           ++ +R  +D G P VV + + A + +Y+EI+ R+
Sbjct: 366 NLSIREQADSGRPTVVADPDGAIAGVYREIARRV 399


>gi|296162309|ref|ZP_06845103.1| ATPase-like, ParA/MinD [Burkholderia sp. Ch1-1]
 gi|295887463|gb|EFG67287.1| ATPase-like, ParA/MinD [Burkholderia sp. Ch1-1]
          Length = 362

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 124/312 (39%), Positives = 201/312 (64%), Gaps = 4/312 (1%)

Query: 29  QRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTEN--KNPP 86
           + +  + +  +TV + + + +    Q  ++R+     ++ +P V NA V +++    +  
Sbjct: 28  KNIKNVAVQDDTVSVEVVLGYPAMRQFDAIRAQFSDALRAVPGVANARVQVSQQIAAHTV 87

Query: 87  QQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK 144
           Q+   L  NVK  VAVASGKGGVGKSTT VN+A AL ++G +V ILDAD+YGPS+P +L 
Sbjct: 88  QRGVKLLPNVKNIVAVASGKGGVGKSTTAVNLALALASEGASVGILDADIYGPSLPMMLG 147

Query: 145 ISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLD 204
           I G+ E  D+K + P   +G++  S+  L++++  M+WRGPM  SA+  +L    W  LD
Sbjct: 148 IVGRPESPDEKSMNPMTGHGLQANSIGFLIEQDNPMVWRGPMATSALEQLLRQTNWHDLD 207

Query: 205 FLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIEN 264
           +L++DMPPGTGD  LT++Q++P++G VIV+TPQD+AL+D K+ + M++K+ IPI+G++EN
Sbjct: 208 YLIVDMPPGTGDIQLTLSQRVPVTGAVIVTTPQDIALLDAKKGLKMFEKVGIPILGIVEN 267

Query: 265 MSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSA 324
           M   + S+ G +  +FG GG     ++ G+  L S+P D+ +R  +D G P VV +    
Sbjct: 268 MGTHICSNCGHEEHIFGAGGGERMGKEYGVDVLGSLPLDIAIREQADSGKPTVVADPEGR 327

Query: 325 TSEIYQEISDRI 336
            +EIY+ I+ R+
Sbjct: 328 IAEIYRSIARRV 339


>gi|294506814|ref|YP_003570872.1| protein mrp homolog [Salinibacter ruber M8]
 gi|294343142|emb|CBH23920.1| Protein mrp homolog [Salinibacter ruber M8]
          Length = 374

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 130/351 (37%), Positives = 211/351 (60%), Gaps = 19/351 (5%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           +  I+D L+ +  P E+ +I+ +  + ++ I    V  ++ V          +    Q++
Sbjct: 5   REDILDVLRQIKHPKEEKDIIRLDMVKDLTIEDGHVSFTVVVKDPDGPFASQVEEACQRL 64

Query: 66  IQN----------------IPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGK 109
           +                  IP + + V+   +     Q      V+  +AVASGKGGVGK
Sbjct: 65  LHEEVSRQLSVDVEVDSEMIP-LGDDVMVGDQGGEKQQTSGEDGVQNTIAVASGKGGVGK 123

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIM 168
           ST  VN+A +L  +G  VA++D D+YGPSIPK++ + G K  ++D++ + P E +G+K +
Sbjct: 124 STVAVNLAMSLSEQGYEVALVDTDIYGPSIPKMMGMEGEKPRVNDERKMVPLEKHGVKTL 183

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           SM  +VD + A++WRGPMV  A+   L +V WG ++++++D+PPGTGD  LTI Q IPL+
Sbjct: 184 SMGFMVDPDQAVVWRGPMVTKAVRQFLGDVDWGDIEYMILDLPPGTGDVQLTIVQTIPLT 243

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDT-GKKYDLFGNGGARF 287
           G VIVSTPQDLAL D ++  +M+  +N+P++GM+ENM+YF   D   +KY LFG  GA+ 
Sbjct: 244 GAVIVSTPQDLALADARKGKAMFDNVNVPVVGMVENMAYFSPPDQPDRKYYLFGRAGAQE 303

Query: 288 EAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
            A+++ +PFL  VP   ++R  SD G PIV    +SA+++ + EI+D++ +
Sbjct: 304 LAQELDVPFLGEVPIQQEIRKSSDQGTPIVRSAPDSASTQAFAEIADQLTE 354


>gi|83815172|ref|YP_444956.1| mrp protein [Salinibacter ruber DSM 13855]
 gi|83756566|gb|ABC44679.1| mrp protein [Salinibacter ruber DSM 13855]
          Length = 374

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 130/351 (37%), Positives = 211/351 (60%), Gaps = 19/351 (5%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           +  I+D L+ +  P E+ +I+ +  + ++ I    V  ++ V          +    Q++
Sbjct: 5   REDILDVLRQIKHPKEEKDIIRLDMVKDLTIEDGHVSFTVVVKDPDGPFASQVEEACQRL 64

Query: 66  IQN----------------IPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGK 109
           +                  IP + + V+   +     Q      V+  +AVASGKGGVGK
Sbjct: 65  LHEEVSRELTVDVEVDSEMIP-LGDDVMVGDQGGEKQQTSGEDGVQNTIAVASGKGGVGK 123

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIM 168
           ST  VN+A +L  +G  VA++D D+YGPSIPK++ + G K  ++D++ + P E +G+K +
Sbjct: 124 STVAVNLAMSLSEQGYEVALVDTDIYGPSIPKMMGMEGEKPRVNDERKMVPLEKHGVKTL 183

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           SM  +VD + A++WRGPMV  A+   L +V WG ++++++D+PPGTGD  LTI Q IPL+
Sbjct: 184 SMGFMVDPDQAVVWRGPMVTKAVRQFLGDVDWGDIEYMILDLPPGTGDVQLTIVQTIPLT 243

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDT-GKKYDLFGNGGARF 287
           G VIVSTPQDLAL D ++  +M+  +N+P++GM+ENM+YF   D   +KY LFG  GA+ 
Sbjct: 244 GAVIVSTPQDLALADARKGKAMFDNVNVPVVGMVENMAYFSPPDQPDRKYYLFGRAGAQE 303

Query: 288 EAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
            A+++ +PFL  VP   ++R  SD G PIV    +SA+++ + EI+D++ +
Sbjct: 304 LAQELDVPFLGEVPIQQEIRKSSDQGTPIVRSAPDSASTQAFAEIADQLTE 354


>gi|300690750|ref|YP_003751745.1| Na+/H+ antiporter [Ralstonia solanacearum PSI07]
 gi|299077810|emb|CBJ50448.1| Na+/H+ antiporter [Ralstonia solanacearum PSI07]
          Length = 362

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 132/334 (39%), Positives = 210/334 (62%), Gaps = 4/334 (1%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
            QI ++L+ +  P    ++V  + +  + +    V L + + +    Q + +R      +
Sbjct: 6   EQITEALRGVVDPNTGRDLVSSKSVRNVRVDGGDVSLDVELGYPARSQFEPIRKLVIGTL 65

Query: 67  QNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +  V N  V ++     +  Q+  +L  NVK  +AVASGKGGVGKSTT VN+A AL  
Sbjct: 66  RQVEGVANVSVQVSMKIVAHAVQRGVHLLPNVKNIIAVASGKGGVGKSTTAVNLALALAA 125

Query: 123 KGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIW 182
           +G +V ILDAD+YGPS P +L I G+ E +D K ++P E +GI+  S+  L++++  M+W
Sbjct: 126 EGASVGILDADIYGPSQPMMLGIQGQPESTDGKTMEPMEGHGIQANSIGFLIEQDNPMVW 185

Query: 183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI 242
           RGPMV SA+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+ALI
Sbjct: 186 RGPMVTSALEQLLKQTNWRDLDYLIVDMPPGTGDIQLTLSQKVPVTGAVIVTTPQDIALI 245

Query: 243 DVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPF 302
           D K+ + M++K+ IPIIG++ENM+ +   + G    +FG GG      + G+PFL S+P 
Sbjct: 246 DAKKGLKMFEKVGIPIIGVVENMAIYCCPNCGHTEHIFGAGGGEKMCAQYGVPFLGSLPL 305

Query: 303 DMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           ++ +R  +D G P VV + + A + +Y+EI+ R+
Sbjct: 306 NLSIREQADSGRPTVVADPDGAITGVYKEIARRV 339


>gi|302037794|ref|YP_003798116.1| protein Mrp, putative ATPase (fragment) [Candidatus Nitrospira
           defluvii]
 gi|300605858|emb|CBK42191.1| Protein Mrp, putative ATPase (fragment) [Candidatus Nitrospira
           defluvii]
          Length = 295

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 173/244 (70%), Gaps = 1/244 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            VK  VA++SGKGGVGKST  VN+A AL   G  V +LDAD+YGP+IP ++ +    E  
Sbjct: 23  GVKHVVAISSGKGGVGKSTVSVNLAVALALTGAKVGLLDADIYGPNIPMMMGVEKTPEQK 82

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K + P E++G+K++SM   V E+ A++WRGPMV +AI  +  +V+WG LD+LLID+PP
Sbjct: 83  DGK-IAPAESHGVKLISMGFFVPEDTAVVWRGPMVHTAIQQLFRDVLWGDLDYLLIDLPP 141

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGDA LT+ Q + LSG V V+TPQ++AL DV++ + M+QK+N+P++G++ENMS+FL   
Sbjct: 142 GTGDAQLTLTQLVSLSGAVTVTTPQEVALHDVRKGMMMFQKVNVPLLGIVENMSFFLCGH 201

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G++ ++F +GG    AEK+GIPFL  VP D  +R   D G PIVV   +S  ++ ++EI
Sbjct: 202 CGERTEIFSHGGGERAAEKLGIPFLGRVPIDPAIRAGGDTGNPIVVAKPDSPQAQAFREI 261

Query: 333 SDRI 336
           + ++
Sbjct: 262 AAKL 265


>gi|145589584|ref|YP_001156181.1| hypothetical protein Pnuc_1403 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047990|gb|ABP34617.1| protein of unknown function DUF59 [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 362

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 133/329 (40%), Positives = 206/329 (62%), Gaps = 4/329 (1%)

Query: 12  SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPT 71
           +LK L  P  K + V  + +  + +    + L I + +    Q   +R      ++ +P 
Sbjct: 11  ALKSLIDPNTKIDFVTAKNVKNLKVEDGDISLDIVLGYPAKSQFDGIRKVIINSLRELPG 70

Query: 72  VKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNV 127
           VKN  VT+T     +  Q+   L   VK  +AVASGKGGVGKSTT VN+A AL  +G  V
Sbjct: 71  VKNVSVTMTSQIVAHAVQRGVKLLPGVKNIIAVASGKGGVGKSTTAVNLALALAAEGAQV 130

Query: 128 AILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMV 187
            ILDAD+YGPS P +L I+G+ E  ++  ++P E +G++  S+  L+DE+  M+WRGPMV
Sbjct: 131 GILDADIYGPSQPMMLGITGRPESVEENTIEPMEGHGLQASSIGFLIDEDAPMVWRGPMV 190

Query: 188 QSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRA 247
            SA+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G +IV+TPQD+AL+D ++ 
Sbjct: 191 TSALEQLLRQTRWRDLDYLIVDMPPGTGDIQLTLSQKVPVTGSIIVTTPQDIALLDARKG 250

Query: 248 ISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVR 307
           + M++K+ +PIIG+IENMS ++    G +  +FG GG     ++ G+ FL ++P ++ +R
Sbjct: 251 LKMFEKVGVPIIGIIENMSTYVCPGCGHEEHIFGAGGGEKMCKEYGVEFLGALPLNLSIR 310

Query: 308 VLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             SD G P VV + + A S IY+ I+ +I
Sbjct: 311 EQSDAGRPTVVADPDGAISAIYKNIARQI 339


>gi|299066022|emb|CBJ37203.1| Na+/H+ antiporter [Ralstonia solanacearum CMR15]
          Length = 377

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 132/333 (39%), Positives = 211/333 (63%), Gaps = 4/333 (1%)

Query: 8   QIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQ 67
           QI ++L+ +  P   +++V  + +  + +    V L + + +    Q + +R      ++
Sbjct: 22  QITEALRGVVDPNTGHDLVSSKSVRNVRVDGGDVSLDVELGYPAKSQFEPIRKLVIGALR 81

Query: 68  NIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNK 123
            +  V N  V ++     +  Q+  +L  NVK  +AVASGKGGVGKSTT VN+A AL  +
Sbjct: 82  QVGGVANVSVQVSMKIVAHAVQRGVHLLPNVKNIIAVASGKGGVGKSTTAVNLALALAAE 141

Query: 124 GKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWR 183
           G +V +LDAD+YGPS P +L I G+ E +D K ++P E +GI+  S+  L++++  M+WR
Sbjct: 142 GASVGMLDADIYGPSQPMMLGIQGQPESNDGKTMEPMEGHGIQANSIGFLIEQDNPMVWR 201

Query: 184 GPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALID 243
           GPMV SA+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+ALID
Sbjct: 202 GPMVTSALEQLLKQTNWRDLDYLIVDMPPGTGDIQLTLSQKVPVTGAVIVTTPQDIALID 261

Query: 244 VKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFD 303
            K+ + M++K+ IPIIG++ENM+ +   + G    +FG GG      + G+PFL S+P +
Sbjct: 262 AKKGLKMFEKVGIPIIGVVENMAVYCCPNCGHTEHIFGAGGGEKMCAQYGVPFLGSLPLN 321

Query: 304 MDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           + +R  +D G P VV + + A +EIY+ I+ R+
Sbjct: 322 LSIREQADAGRPTVVADPDGAIAEIYRAIARRV 354


>gi|295675818|ref|YP_003604342.1| ATPase-like, ParA/MinD [Burkholderia sp. CCGE1002]
 gi|295435661|gb|ADG14831.1| ATPase-like, ParA/MinD [Burkholderia sp. CCGE1002]
          Length = 362

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 124/312 (39%), Positives = 199/312 (63%), Gaps = 4/312 (1%)

Query: 29  QRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTEN--KNPP 86
           + +  + +  + V L +T+ +    Q  ++R      ++ +P V N  V +++    +  
Sbjct: 28  KSIRNVVVEGDAVSLQVTLGYPAKSQFDAIRQQFGDALRAVPGVANVRVEVSQQIAAHTV 87

Query: 87  QQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK 144
           Q+   L   VK  VAVASGKGGVGKSTT VN+A AL ++G +V ILDAD+YGPS+P +L 
Sbjct: 88  QRGVKLLPGVKNIVAVASGKGGVGKSTTAVNLALALASEGASVGILDADIYGPSLPTMLG 147

Query: 145 ISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLD 204
           I G+ E  D K + P   +G++  S+  L++ +  M+WRGPM  SA+  +L    W +LD
Sbjct: 148 IEGRPESPDDKSMNPMTGHGVQANSIGFLIEADNPMVWRGPMATSALEQLLRQTNWHELD 207

Query: 205 FLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIEN 264
           +L++DMPPGTGD  LT+AQ++P++G VIV+TPQD+AL+D K+ + M++K+ IPI+G++EN
Sbjct: 208 YLIVDMPPGTGDIQLTLAQRVPVTGAVIVTTPQDIALLDAKKGLKMFEKVGIPILGIVEN 267

Query: 265 MSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSA 324
           M   + S+ G +  +FG GGA   +++ G+  L S+P D+ +R  +D G P V  + N  
Sbjct: 268 MGLHICSNCGHEEHIFGAGGAERMSKEYGVDVLGSLPLDITIREQADSGHPTVAADPNGR 327

Query: 325 TSEIYQEISDRI 336
            +EIY+ I+ ++
Sbjct: 328 IAEIYRSIARKV 339


>gi|77919189|ref|YP_357004.1| chromosome partitioning ATPase [Pelobacter carbinolicus DSM 2380]
 gi|77545272|gb|ABA88834.1| chromosome partitioning ATPase [Pelobacter carbinolicus DSM 2380]
          Length = 347

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 126/339 (37%), Positives = 213/339 (62%), Gaps = 9/339 (2%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           K  I++++KV+  P    +++++  + +IF+    V LS+ +  +   + +++ +  +Q+
Sbjct: 4   KQSILEAIKVVQDPELNKSLIDLGMIRDIFVEKGLVRLSLALTTSKCPKKEAIVAEIRQV 63

Query: 66  IQNIPTVKNAVVTLTENKN-------PPQQRNNLN-VKKFVAVASGKGGVGKSTTVVNIA 117
           +QN+P V    V LT           P      LN V+  +AVASGKGGVGK+T  VN+A
Sbjct: 64  LQNLPDVSKVEVKLTTLTKEELRKLFPEHPLVGLNRVRHVLAVASGKGGVGKTTAAVNVA 123

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDEN 177
             L  KG  V +LDADVYGPS+P +L ++   +  +   + P E +G++IMS+  + D+ 
Sbjct: 124 LGLAAKGNRVGLLDADVYGPSVPVMLGLNDSPDWENGMMI-PVEKFGLRIMSLGMITDKG 182

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
             ++WRGP+V  AI  +L  V+WG LD+L++D+PPGTGD  +T+AQ IP + V++V+TPQ
Sbjct: 183 KPVVWRGPLVSKAIRQLLGQVLWGDLDYLVVDLPPGTGDPSITVAQAIPGATVLMVTTPQ 242

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           ++AL DV+R+I ++ K NI I+G++ENMSYF    + K  ++FG GG    +++ G+P L
Sbjct: 243 EVALADVRRSIDLFNKFNIGILGLLENMSYFFCGHSEKPIEIFGQGGGEKLSKEFGLPLL 302

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P D+++    D G+P+++   +S T  I+Q I+++I
Sbjct: 303 GKIPIDLEIGKGGDSGVPLMILAPDSETGRIFQNIAEKI 341


>gi|91775273|ref|YP_545029.1| hypothetical protein Mfla_0920 [Methylobacillus flagellatus KT]
 gi|91775417|ref|YP_545173.1| hypothetical protein Mfla_1064 [Methylobacillus flagellatus KT]
 gi|91709260|gb|ABE49188.1| protein of unknown function DUF59 [Methylobacillus flagellatus KT]
 gi|91709404|gb|ABE49332.1| protein of unknown function DUF59 [Methylobacillus flagellatus KT]
          Length = 362

 Score =  259 bits (661), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 135/329 (41%), Positives = 204/329 (62%), Gaps = 4/329 (1%)

Query: 11  DSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIP 70
           D+L+ +  P    + +  +   +I I  + V + I + +     L  +R    Q +  +P
Sbjct: 10  DALRSVIDPNTGKDFISSKSARQITIAGSHVSVEILLDYPANSILGEIRDLVTQALAALP 69

Query: 71  TVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKN 126
            V+N  V +T     +  Q+   L  NVK  +AVASGKGGVGKSTT VN+A AL  +G  
Sbjct: 70  GVENVTVGVTSRIVSHEVQRGVQLIPNVKNIIAVASGKGGVGKSTTAVNLALALAAEGAR 129

Query: 127 VAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPM 186
           V ILDAD+YGPS P++L ISGK E +D K ++P E YG++ MS+  LVD +  M+WRGPM
Sbjct: 130 VGILDADIYGPSQPQMLGISGKPESADGKSMEPLERYGVQAMSIGFLVDIDTPMVWRGPM 189

Query: 187 VQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKR 246
           V  A+  +L +  W  LD+L++D+PPGTGD  LT+AQK+P++G +IV+TPQD+AL+D ++
Sbjct: 190 VVGALEQLLRDTRWKDLDYLVVDLPPGTGDIQLTLAQKVPVTGAIIVTTPQDIALLDARK 249

Query: 247 AISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDV 306
            + M++K+ IPI+G++ENMS  + S  G +  +FG+GGA        +  L S+P D+ +
Sbjct: 250 GLKMFEKVGIPILGIVENMSTHICSQCGHEEHIFGSGGAARMCADYDVELLGSLPLDIRI 309

Query: 307 RVLSDLGIPIVVHNMNSATSEIYQEISDR 335
           R  +D G P VV +     + IY+ I+ R
Sbjct: 310 REETDSGKPTVVADPAGQVAGIYKSIARR 338


>gi|256822908|ref|YP_003146871.1| hypothetical protein Kkor_1691 [Kangiella koreensis DSM 16069]
 gi|256796447|gb|ACV27103.1| conserved hypothetical protein [Kangiella koreensis DSM 16069]
          Length = 362

 Score =  258 bits (660), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 133/338 (39%), Positives = 213/338 (63%), Gaps = 5/338 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + + QI D+L  L +     +++    L +  I  + V L+I +   + +  Q L     
Sbjct: 2   LTEQQIHDALSQLKLSQLNTDLISANALKKTDIDGDKVTLTIKLGFPMGNYQQELEREVT 61

Query: 64  QIIQ-NIPTVKNAVVT---LTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACA 119
           + ++   P +K  V     +  + +P + +   ++K  +AVASGKGGVGKSTT VN+A A
Sbjct: 62  EYLKAQFPEIKPQVKVSWRVEAHAHPAKVQAMPDIKNIIAVASGKGGVGKSTTSVNLALA 121

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGK-VEISDKKFLKPKENYGIKIMSMASLVDENV 178
           L + G NV ILDAD+YGPSIP +L + GK  E +DKK + P EN+G++ MS+  LV    
Sbjct: 122 LSHLGANVGILDADIYGPSIPIMLGLQGKHPESTDKKTILPVENHGLQSMSIGYLVKPEQ 181

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
           AM+WRGPM   A+  ++++  W  LD+L+ID+PPGTGD  LT+AQKIP++  V+V+TPQD
Sbjct: 182 AMVWRGPMASGALQQLINDTQWRDLDYLIIDLPPGTGDIQLTMAQKIPVTAAVVVTTPQD 241

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +AL D ++A++M+ K+++P++G++ENM+    S+ G +  +FG GG    A++IG+  L 
Sbjct: 242 IALADARKAVTMFNKVSVPVLGVVENMAMHTCSNCGHQEHIFGAGGGDKLAQEIGVELLG 301

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           S+P  + +R  +D G P VV + ++A S +Y +I+ RI
Sbjct: 302 SLPLALTIREQADSGKPTVVADPSTAESHLYLDIAQRI 339


>gi|308806145|ref|XP_003080384.1| mrp-related protein (ISS) [Ostreococcus tauri]
 gi|116058844|emb|CAL54551.1| mrp-related protein (ISS) [Ostreococcus tauri]
          Length = 728

 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 129/299 (43%), Positives = 181/299 (60%), Gaps = 13/299 (4%)

Query: 39  NTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLN-VKKF 97
           +TVY        I H     R  A+ + QN P  K           PP+   +L+   + 
Sbjct: 432 STVYRGAMSAREIQHPSPCTRPRARSMTQNPPEFK-----------PPKLPTSLSSCARV 480

Query: 98  VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFL 157
            AV SGKGGVGKSTT VN+A AL   G  V +LDADV+GPS+P L+ +SG+     +K +
Sbjct: 481 FAVTSGKGGVGKSTTCVNLAVALARIGLRVGLLDADVHGPSVPTLMGLSGRPVTDGEKKM 540

Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217
            P EN+G++  SM  L+    A  WRGPMV  A+  M+++  WG ++ L++DMPPGTGDA
Sbjct: 541 LPMENHGVRCQSMGFLLPPGRASTWRGPMVSGALTTMINDTRWGDVEVLMVDMPPGTGDA 600

Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277
            ++I+QK+PL+G V+VSTPQ LA     R I MY+++  P++G+IENM+Y+   D  + Y
Sbjct: 601 QISISQKLPLTGAVVVSTPQALASEVASRGIDMYERIRTPVLGVIENMAYYEEKDGTRAY 660

Query: 278 DLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +FG GGAR  AE  G+ FL  VP D D+R  SD G PIVV + +   + IY+ I+ R+
Sbjct: 661 -VFGKGGARATAEARGVEFLGEVPLDGDIRARSDEGAPIVVADADGDVARIYRSIAQRL 718


>gi|290986827|ref|XP_002676125.1| predicted protein [Naegleria gruberi]
 gi|284089725|gb|EFC43381.1| predicted protein [Naegleria gruberi]
          Length = 285

 Score =  258 bits (660), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 120/245 (48%), Positives = 176/245 (71%), Gaps = 2/245 (0%)

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKN-KGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           VK  + V+SGKGGVGKST   N+A AL +   K+V ++DAD+YGPSI +++ +SGK +++
Sbjct: 20  VKDVIVVSSGKGGVGKSTVATNLALALSSFCQKSVGLMDADIYGPSIHRMMNLSGKPQVN 79

Query: 153 D-KKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           +  + L PK NYG+K MSM  LV E+   IWRGPMV +A+  +LH V WG+LD L++D+P
Sbjct: 80  EATRKLIPKSNYGVKTMSMGFLVQEDAPTIWRGPMVMTAVDQLLHQVDWGELDILVVDLP 139

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA L+I Q++ LSG VIVSTPQD+ALIDVKR ++M++K+N+PI+G++ENMSYF  S
Sbjct: 140 PGTGDAQLSICQRVHLSGAVIVSTPQDIALIDVKRGVNMFRKLNVPILGVVENMSYFKCS 199

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
           + G K  +FG+ GA+  AE +G+ F+  +P    +R  SD G P+V+ +  S  +  + +
Sbjct: 200 NCGHKDHIFGHDGAKLTAENMGLNFIGEIPLHTQIRETSDSGRPVVISDPKSDRAASFLQ 259

Query: 332 ISDRI 336
           I+  +
Sbjct: 260 IARNV 264


>gi|224085613|ref|XP_002307635.1| predicted protein [Populus trichocarpa]
 gi|222857084|gb|EEE94631.1| predicted protein [Populus trichocarpa]
          Length = 293

 Score =  258 bits (660), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 172/245 (70%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVEI 151
            VK  +AVASGKGGVGKSTT VN+A AL  K +  V +LDADVYGPS+P ++KI  K +I
Sbjct: 30  GVKDVIAVASGKGGVGKSTTAVNLAVALAIKCQLKVGLLDADVYGPSVPMMMKIDRKPDI 89

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           ++ K + P ENYG+K MSM  LV+++  ++WRGPMV SA++ M   V WG LD L++DMP
Sbjct: 90  TEDKKMIPIENYGVKCMSMGFLVEKDAPIVWRGPMVMSALVKMTRGVDWGNLDILVVDMP 149

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA LT+ Q + LSG +IVSTPQD+AL+D +R  +M+ K+ +PI+G +ENMS+F   
Sbjct: 150 PGTGDAQLTMTQNLQLSGALIVSTPQDIALLDARRGANMFSKVGVPILGFVENMSFFKCP 209

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+   +FG GGAR  A  +G  FL  +P ++DVR  SD GIP+V+   +SA S+ Y +
Sbjct: 210 HCGEPSFIFGKGGARNAAASMGHNFLGEIPLEVDVRKGSDEGIPVVISAPDSAISKAYGD 269

Query: 332 ISDRI 336
            +  +
Sbjct: 270 TAQNV 274


>gi|168006075|ref|XP_001755735.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162693054|gb|EDQ79408.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 282

 Score =  258 bits (660), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 179/252 (71%), Gaps = 10/252 (3%)

Query: 92  LNVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVE 150
             V+  +A++SGKGGVGKSTT VN+A AL  + +  V +LDADVYGPSIP L+K+ G+ +
Sbjct: 7   FGVENIIAISSGKGGVGKSTTAVNLAVALAMECRLRVGLLDADVYGPSIPTLMKLDGRPQ 66

Query: 151 ISDK--------KFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQ 202
           +           + + P ENYG++ MSM  L+D++   +WRGPMV SA+  ++    WG+
Sbjct: 67  LDSGTYNFLPNFRLMIPMENYGVRCMSMGLLMDKDSPAVWRGPMVMSALEKLVRGTAWGK 126

Query: 203 LDFLLIDMPPGTGDAHLTIAQKIPLS-GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGM 261
           LD L+IDMPPGTGDA ++I+Q++PL+ G VIVSTPQD+ALID +R  +M++K+++PI+G+
Sbjct: 127 LDILVIDMPPGTGDAQISISQRLPLAAGAVIVSTPQDIALIDARRGANMFRKVDVPILGL 186

Query: 262 IENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNM 321
           IENMSYF   + G++  +FG+GGAR  AE++ + FL  VP ++++R  SD G PIV    
Sbjct: 187 IENMSYFKCPNCGERSHIFGHGGARATAEEMDMNFLGEVPLNVEIRQTSDAGSPIVASAP 246

Query: 322 NSATSEIYQEIS 333
           NS  S++Y+ I+
Sbjct: 247 NSEASKVYRGIA 258


>gi|224418490|ref|ZP_03656496.1| putative ATP/GTP-binding protein [Helicobacter canadensis MIT
           98-5491]
 gi|253827803|ref|ZP_04870688.1| putative ATP/GTP-binding protein [Helicobacter canadensis MIT
           98-5491]
 gi|313142020|ref|ZP_07804213.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|253511209|gb|EES89868.1| putative ATP/GTP-binding protein [Helicobacter canadensis MIT
           98-5491]
 gi|313131051|gb|EFR48668.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
          Length = 371

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 149/350 (42%), Positives = 209/350 (59%), Gaps = 15/350 (4%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           MNQ    Q+V  LK +  P  + +IV    + E+ I  N V L I +P       ++LR+
Sbjct: 1   MNQ---EQLVSLLKEIIYPNFEKDIVTFGFVKEMLIHENAVSLRIEIPSASPEVAETLRT 57

Query: 61  ------NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL--NVKKFVAVASGKGGVGKSTT 112
                 NAQ I +    +K         K  PQ   NL   +K FV V+SGKGGVGKSTT
Sbjct: 58  QITQKLNAQGITKINLDIKQPKPQAQNQK--PQGTKNLAPQIKNFVMVSSGKGGVGKSTT 115

Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKI-SGKVEISDK-KFLKPKENYGIKIMSM 170
            VN+A AL  +GK VA+LDAD+YGP+IP++L + + K E+  K K L P + YGI+++SM
Sbjct: 116 SVNLAIALAQQGKKVALLDADIYGPNIPRMLGLQNDKPEVDQKLKKLIPLQAYGIEMISM 175

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGV 230
             L DE  ++IWRGPM+  AI  ML +V+W  LD ++IDMPPGTGDA LT+AQ +P++  
Sbjct: 176 GVLYDEGQSLIWRGPMIIRAIEQMLSDVLWDNLDVMVIDMPPGTGDAQLTLAQSVPVTAG 235

Query: 231 VIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAE 290
           + VSTPQ +AL D  RA+ M+ K+ IP+ G+IENMS F+  D GK+YD+FG G     A+
Sbjct: 236 IAVSTPQKVALDDGARALDMFAKLKIPVAGIIENMSGFICPDCGKEYDIFGKGTTEEVAK 295

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
             G   L  +P +  VR   D G PIV  + +S +++ Y + +  +  F 
Sbjct: 296 AYGTKTLAQIPIEPSVREAGDNGKPIVYFHPDSKSAKEYLKAAKELWDFM 345


>gi|226493009|ref|NP_001149134.1| nucleotide-binding protein-like [Zea mays]
 gi|195606396|gb|ACG25028.1| nucleotide-binding protein-like [Zea mays]
          Length = 297

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 121/247 (48%), Positives = 176/247 (71%), Gaps = 1/247 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVEI 151
            V   +AVASGKGGVGKSTT VNIA AL  + K  V +LDAD+YGPSIP ++ +  K E+
Sbjct: 34  GVCDIIAVASGKGGVGKSTTAVNIAVALAKEFKLQVGLLDADIYGPSIPTMMNLHAKPEL 93

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           S+   + P EN+G++ MS+  LVD++  ++WRGPMV SA+  M   V WG LD L++DMP
Sbjct: 94  SEDMKMIPIENHGVRCMSIGFLVDKDAPIVWRGPMVMSALEKMTRGVAWGDLDILVVDMP 153

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA L+++Q++ LSG +IVSTPQD+ALID +R  +M++K+ +PI+G++ENMS F  S
Sbjct: 154 PGTGDAQLSMSQRLRLSGALIVSTPQDIALIDARRGANMFRKVQVPILGLVENMSCFKCS 213

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG  GA+  AE++ +  L  VP ++ +R  SD G PIVV + NSA+++ Y  
Sbjct: 214 KCGEKSYIFGEAGAQRTAEEMDMKLLGDVPLEISIRTGSDEGNPIVVSSPNSASAQAYVN 273

Query: 332 ISDRIQQ 338
           +++++ Q
Sbjct: 274 VAEKVTQ 280


>gi|323525138|ref|YP_004227291.1| ParA/MinD-like ATPase [Burkholderia sp. CCGE1001]
 gi|323382140|gb|ADX54231.1| ATPase-like, ParA/MinD [Burkholderia sp. CCGE1001]
          Length = 362

 Score =  258 bits (659), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 121/312 (38%), Positives = 204/312 (65%), Gaps = 4/312 (1%)

Query: 29  QRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTEN--KNPP 86
           + L  + +  +TV +++ + +    Q +++R      ++ +P V++  V +++    +  
Sbjct: 28  RNLKNVAVEGDTVSVAVVLGYPATRQFEAIRKQFDDALRAVPGVQHTRVEVSQEIAAHTV 87

Query: 87  QQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK 144
           Q+   L  NVK  VAVASGKGGVGKSTT VN+A AL ++G +V ILDAD+YGPS+P +L 
Sbjct: 88  QRGVKLLPNVKNIVAVASGKGGVGKSTTAVNLALALASEGASVGILDADIYGPSLPVMLG 147

Query: 145 ISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLD 204
           I G+ E  D+K + P   +G++  S+  L++++  M+WRGPM  SA+  +L    W  LD
Sbjct: 148 IEGRPESPDEKTMNPMTGHGLQANSIGFLIEQDNPMVWRGPMATSALEQLLRQTNWRDLD 207

Query: 205 FLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIEN 264
           +L++DMPPGTGD  LT++Q++P++G VIV+TPQD+AL+D ++ + M++K+ IPI+G++EN
Sbjct: 208 YLIVDMPPGTGDIQLTLSQRVPVTGAVIVTTPQDIALLDARKGLKMFEKVGIPILGIVEN 267

Query: 265 MSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSA 324
           M+  + S+ G +  +FG GG     ++ G+  L S+P D+ +R  +D G P VV + +  
Sbjct: 268 MAMHICSNCGHEEHIFGAGGGERMGKEYGVDVLGSLPLDIAIREQADSGRPTVVADPHGR 327

Query: 325 TSEIYQEISDRI 336
            +EIY+ I+ ++
Sbjct: 328 IAEIYRTIARKV 339


>gi|110680109|ref|YP_683116.1| hypothetical protein RD1_2906 [Roseobacter denitrificans OCh 114]
 gi|109456225|gb|ABG32430.1| conserved domain protein [Roseobacter denitrificans OCh 114]
          Length = 355

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 118/284 (41%), Positives = 184/284 (64%), Gaps = 2/284 (0%)

Query: 55  LQSLRSNAQQIIQNIPTVKNAVVTLTENKN--PPQQRNNLNVKKFVAVASGKGGVGKSTT 112
           +Q L + A Q++    +   A   L   ++  P   +    + + +AVASGKGGVGKST 
Sbjct: 66  VQDLGATAVQVLMTAHSAPAAPPDLKPQRSAGPAGPQKVPGIDRIIAVASGKGGVGKSTL 125

Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMAS 172
             NIACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  NYG+ +MS+  
Sbjct: 126 SANIACALAAEGRRVGLLDADVYGPSQPRMLGVSGRPASPDGKIILPMRNYGVTMMSIGL 185

Query: 173 LVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVI 232
           + +E+ A++WRGPM+  A+  M++ V WG LD L++D+PPGTGD  +T+ QK  + G ++
Sbjct: 186 MQNEDQAVVWRGPMLMGALQQMMNQVQWGALDVLIVDLPPGTGDVQMTLTQKFQVDGAIV 245

Query: 233 VSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKI 292
           VSTPQD+AL+D ++ I M+ ++  PI+GMIENMS  + S+ G +  +FG+GG   EAEKI
Sbjct: 246 VSTPQDVALLDARKGIDMFNQLGTPILGMIENMSTHICSNCGHEEHVFGHGGVAKEAEKI 305

Query: 293 GIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +P L  +P  +D+R+ +D G PIVV   +S  +  ++ ++ ++
Sbjct: 306 EVPLLAEIPLHLDIRLAADGGAPIVVSKPDSPQAAAFRGVARQL 349


>gi|242310484|ref|ZP_04809639.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
 gi|239522882|gb|EEQ62748.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
          Length = 371

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 146/350 (41%), Positives = 207/350 (59%), Gaps = 17/350 (4%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           MNQ    Q+V+ LK +  P  + +IV    + E+ I  N V + + +P       + LR+
Sbjct: 1   MNQ---EQLVNLLKEIIYPNFEKDIVTFGFVKEMLIHENAVSIRVEIPSASPEVAEKLRT 57

Query: 61  NAQQIIQNIPTVKNAVVTL-------TENKNPPQQRNNL--NVKKFVAVASGKGGVGKST 111
              QI Q + T     + L        E    PQ   NL   +K FV V+SGKGGVGKST
Sbjct: 58  ---QITQKLNTQGITKINLDIKQPKPQEQTQKPQSTKNLAPQIKNFVMVSSGKGGVGKST 114

Query: 112 TVVNIACALKNKGKNVAILDADVYGPSIPKLLKIS-GKVEISDK-KFLKPKENYGIKIMS 169
           T VN+A AL  +GK V +LDAD+YGP+IP++L +   K E+  K K L P + YGI+++S
Sbjct: 115 TSVNLAIALAQQGKKVGLLDADIYGPNIPRMLGLQKDKPEVDQKLKKLIPLQAYGIEMIS 174

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           M  L DE  ++IWRGPM+  AI  ML +V+W  LD ++IDMPPGTGDA LT+AQ +P++ 
Sbjct: 175 MGVLYDEGQSLIWRGPMIIRAIEQMLSDVLWDNLDVMVIDMPPGTGDAQLTLAQSVPVTA 234

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEA 289
            + VSTPQ +AL D  RA+ M+ K+ IP+ G+IENMS F+  D GK+YD+FG G  +  A
Sbjct: 235 GIAVSTPQKVALDDGARALDMFSKLKIPVAGIIENMSGFICPDCGKEYDIFGKGTTQEVA 294

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
           +  G   L  +P +  VR   D G PIV  +  S +++ Y + +  +  F
Sbjct: 295 KAYGTKTLAQIPIEPSVREAGDSGKPIVYFHPESKSAKEYLKAAKELWDF 344


>gi|17547098|ref|NP_520500.1| MRP family ATP-binding protein [Ralstonia solanacearum GMI1000]
 gi|17429399|emb|CAD16086.1| probable mrp atpase involved in chromosome partitioning protein
           [Ralstonia solanacearum GMI1000]
          Length = 362

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 131/334 (39%), Positives = 210/334 (62%), Gaps = 4/334 (1%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
            QI ++L+ +  P    ++V  + +  + +    V L + + +    Q + +R      +
Sbjct: 6   EQITEALRGVVDPNTGRDLVSSKSVRNVRVDGGDVSLDVELGYPARSQFEPIRKLVIGAL 65

Query: 67  QNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +  V N  V ++     +  Q+  +L  NVK  +AVASGKGGVGKSTT VN+A AL  
Sbjct: 66  RQVGGVANVSVQVSMKIVAHAVQRGVHLLPNVKNIIAVASGKGGVGKSTTAVNLALALAA 125

Query: 123 KGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIW 182
           +G +V +LDAD+YGPS P +L I G+ E +D K ++P E +GI+  S+  L++++  M+W
Sbjct: 126 EGASVGMLDADIYGPSQPMMLGIQGQPESTDGKTMEPMEGHGIQANSIGFLIEQDNPMVW 185

Query: 183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI 242
           RGPMV SA+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+ALI
Sbjct: 186 RGPMVTSALEQLLKQTNWRDLDYLIVDMPPGTGDIQLTLSQKVPVTGAVIVTTPQDIALI 245

Query: 243 DVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPF 302
           D K+ + M++K+ IPIIG++ENM+ +   + G    +FG GG      + G+PFL S+P 
Sbjct: 246 DAKKGLKMFEKVGIPIIGVVENMAVYCCPNCGHTEHIFGAGGGEKMCAQYGVPFLGSLPL 305

Query: 303 DMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           ++ +R  +D G P VV + + A ++IY+ I+ R+
Sbjct: 306 NLSIREQADAGRPTVVADPDGAIADIYRAIARRV 339


>gi|313144489|ref|ZP_07806682.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313129520|gb|EFR47137.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 368

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 138/347 (39%), Positives = 213/347 (61%), Gaps = 7/347 (2%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           MN + + QI  +LK +  P    +IV    L E+ +    VY+ I +P +    + +L+ 
Sbjct: 1   MNMLTQEQITQNLKNVIYPNFSKDIVSFGFLKEVKVSDEGVYIRIDIPSSAQEVIDTLKI 60

Query: 61  NAQQIIQNIPTVKN---AVVTLTENKNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVN 115
             Q+ + ++   +N    +        P  +  NL  ++K FV V+SGKGGVGKST+ VN
Sbjct: 61  EVQKQLDSLLQGQNLNLEINPPKPAPKPQPKTKNLAPHIKHFVMVSSGKGGVGKSTSSVN 120

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISG-KVEISD-KKFLKPKENYGIKIMSMASL 173
           +A AL  +GK V +LDAD+YGP+IP++L ++  K E+++ +K L P + +G+++MSM  L
Sbjct: 121 LAIALAQQGKRVGLLDADIYGPNIPRMLGLNATKAEVNEAQKKLIPLKAFGVEMMSMGVL 180

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
            DE  ++IWRGPM+  AI  ML +V+W +LD L+IDMPPGTGDA LT+AQ +P+S  VIV
Sbjct: 181 YDEGQSLIWRGPMIMRAIEQMLTDVLWSELDVLVIDMPPGTGDAQLTLAQSVPVSAGVIV 240

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQ ++L D  R++ M+ K+ +PI G+IENMS F+  D GK+YD+FG G +   A + G
Sbjct: 241 TTPQKVSLDDSARSLDMFDKLKVPIAGLIENMSGFICPDCGKEYDIFGKGTSEDLASQYG 300

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
              L  VP +  VR   D G PI     +S +++ Y + + ++  F 
Sbjct: 301 TSTLAQVPLEPKVREGGDSGKPIAFFEPDSKSAKAYMQAAVKLLSFL 347


>gi|71906216|ref|YP_283803.1| hypothetical protein Daro_0576 [Dechloromonas aromatica RCB]
 gi|71845837|gb|AAZ45333.1| Protein of unknown function DUF59 [Dechloromonas aromatica RCB]
          Length = 363

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 133/336 (39%), Positives = 205/336 (61%), Gaps = 5/336 (1%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           + QI  +L     P    + V  + +  I I  + V   I + +    Q+  +R      
Sbjct: 5   EQQIKAALSAAVDPNTGKDFVAGKAVKNIKIDGDDVAFDIELGYPAKTQIDPIRKQVIAA 64

Query: 66  IQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALK 121
           ++++P V N    +      +  Q    L   VK  +AVASGKGGVGKSTT VN+A AL 
Sbjct: 65  VRSVPGVGNISANVYTKIVAHSVQMGVKLMPGVKNIIAVASGKGGVGKSTTAVNLALALA 124

Query: 122 NKGKNVAILDADVYGPSIPKLLKISGKV-EISDKKFLKPKENYGIKIMSMASLVDENVAM 180
            +G +V ILDAD+YGPS P++L ++G+  E  D + ++P E YG++ MS+  +VD    M
Sbjct: 125 QEGASVGILDADIYGPSQPQMLGLAGQQPESKDGQSMEPLEAYGLQAMSIGFMVDVETPM 184

Query: 181 IWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLA 240
           +WRGPMV  A+  +L    W  +D+L++DMPPGTGD  L++AQK+P++G VIV+TPQD+A
Sbjct: 185 VWRGPMVSQALDQLLGQTNWHDIDYLIVDMPPGTGDIQLSLAQKVPVTGAVIVTTPQDIA 244

Query: 241 LIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESV 300
           LID ++ + M++K+NIPI+G++ENMS  + S  G +  +FG GG     +   + FL S+
Sbjct: 245 LIDARKGLKMFEKVNIPILGIVENMSIHICSKCGHEEHIFGEGGGEKMCKDYDVEFLGSL 304

Query: 301 PFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           P +M +R ++D G P VV + +S T+EIY+ I+ R+
Sbjct: 305 PLEMAIRQMADGGKPTVVGDPDSRTAEIYRGIARRV 340


>gi|325981753|ref|YP_004294155.1| ATPase-like, ParA/MinD [Nitrosomonas sp. AL212]
 gi|325531272|gb|ADZ25993.1| ATPase-like, ParA/MinD [Nitrosomonas sp. AL212]
          Length = 362

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 128/322 (39%), Positives = 197/322 (61%), Gaps = 4/322 (1%)

Query: 19  PGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVT 78
           P    + +  + +  I +  N   + I V +       ++++   + +++IP ++N  VT
Sbjct: 18  PTTDKDYITAKTVRSIRVEQNNAAIDIEVGYPAESVKNTIQNQITETLRSIPGIENIQVT 77

Query: 79  LTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV 134
           +T    P   +  +     VK  +AVASGKGGVGKS T VN+A AL  +G +V ILDAD+
Sbjct: 78  VTSKIIPHGVQRGVKLIPGVKNIIAVASGKGGVGKSATAVNLALALATEGASVGILDADI 137

Query: 135 YGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHM 194
           YGPS P++L ISG  E  D K ++P + +GI+ MS+  LVD    M+WRGPMV  A+  +
Sbjct: 138 YGPSQPQMLGISGHPESFDGKTMEPMQAHGIQAMSIGLLVDVETPMVWRGPMVTQALQQL 197

Query: 195 LHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKM 254
           L++  W  LD+L++D+PPGTGD  LT+AQKIP++G VIV+TPQD+AL+D ++ + M++K+
Sbjct: 198 LNDTNWKDLDYLIVDLPPGTGDIQLTLAQKIPVTGAVIVTTPQDIALLDARKGLKMFEKV 257

Query: 255 NIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGI 314
            IPI+G++ENMS    S  G    +FG GG     +   + FL ++P D+ +R  +D G 
Sbjct: 258 GIPILGIVENMSTHTCSQCGHTEPIFGTGGGEKMCQDYKVEFLGALPLDIKIREHTDTGK 317

Query: 315 PIVVHNMNSATSEIYQEISDRI 336
           P VV   +   + IY+ I+ RI
Sbjct: 318 PSVVAEPDGKIAGIYRLIARRI 339


>gi|34558233|ref|NP_908048.1| putative ATP/GTP-binding protein [Wolinella succinogenes DSM 1740]
 gi|34483952|emb|CAE10948.1| PUTATIVE ATP/GTP-BINDING PROTEIN (MRP HOMOLOG) [Wolinella
           succinogenes]
          Length = 370

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 141/345 (40%), Positives = 216/345 (62%), Gaps = 12/345 (3%)

Query: 5   LKNQ-IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           +KN+ I+D LK ++ PG + +IV    + +  + ++T++++I +P  +    Q LR+   
Sbjct: 1   MKNEAILDLLKEVTYPGFEKDIVTFGFVQKALLENDTLHVAIKIPSGVPEVEQKLRAEIT 60

Query: 64  QII-----QNIPTVKNAVVTLTENKNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNI 116
           Q +     +NI  V        E K  PQ   N+  ++K FV V+SGKGGVGKST+ VN+
Sbjct: 61  QKLAPLGAKNIDLVIEQPQAQEEPK--PQGPKNIAPHIKNFVMVSSGKGGVGKSTSSVNL 118

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEI--SDKKFLKPKENYGIKIMSMASLV 174
           A AL  +GK V +LDAD+YGP+IP++L ++ +     +++K L P   YG+++MSM  L 
Sbjct: 119 AIALAQQGKRVGLLDADIYGPNIPRMLGLTKERPDVNAEQKKLIPLSAYGVEMMSMGVLY 178

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
           +E  ++IWRGPM+  AI  ML +V+W  LD L+IDMPPGTGDA LT+AQ +P++  V V+
Sbjct: 179 EEGQSLIWRGPMIIRAIEQMLKDVLWSDLDVLVIDMPPGTGDAQLTLAQSVPVTAGVTVT 238

Query: 235 TPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGI 294
           TPQ +AL D +R++ M++K+ IPI G+IENMS F+  D+GK+YD+FG G ++  AE    
Sbjct: 239 TPQRVALDDSERSLDMFKKLKIPIAGIIENMSGFICPDSGKEYDIFGKGTSQAVAEDFKT 298

Query: 295 PFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
             L  VP +  VR   D G PIV     S +++ Y + +  +  F
Sbjct: 299 QVLAQVPIEPAVREGGDAGKPIVFFRPESQSAKEYMKAASILWSF 343


>gi|150864076|ref|XP_001382770.2| conserved nucleotide binding protein [Scheffersomyces stipitis CBS
           6054]
 gi|149385332|gb|ABN64741.2| conserved nucleotide binding protein [Scheffersomyces stipitis CBS
           6054]
          Length = 306

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 123/255 (48%), Positives = 177/255 (69%)

Query: 82  NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPK 141
           +K  P ++   NVK+ V V+SGKGGVGKST  VN+A AL++ GK V +LDAD++GPSIPK
Sbjct: 47  SKGLPMKQKIPNVKRIVLVSSGKGGVGKSTVSVNVALALRSMGKQVGLLDADIFGPSIPK 106

Query: 142 LLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWG 201
           L+ +SG+  +S++  L P  NYGI+ MSM  L+    A+ WRG MV  A+  +L  V W 
Sbjct: 107 LMNLSGEPRLSEQGKLLPLSNYGIETMSMGYLIPAESALAWRGLMVMKALQQLLFEVQWS 166

Query: 202 QLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGM 261
            LD+L++DMPPGTGD  LTI+Q++ + G VIVSTPQD+ALID  + I+M+ K+NIPI+G+
Sbjct: 167 NLDYLVVDMPPGTGDTQLTISQQLKVDGAVIVSTPQDIALIDAIKGITMFNKVNIPILGL 226

Query: 262 IENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNM 321
           ++NMSYF+ S+   +  +FG  GA+ EAEK  +  L S+P   D+   SDLG P+V+ + 
Sbjct: 227 VQNMSYFVCSNCNHESHIFGTDGAKREAEKQKLELLGSIPLSEDICSQSDLGKPVVISHP 286

Query: 322 NSATSEIYQEISDRI 336
            S+  + Y +I+ +I
Sbjct: 287 ESSIVQPYLDIARKI 301


>gi|83644724|ref|YP_433159.1| chromosome partitioning ATPase [Hahella chejuensis KCTC 2396]
 gi|83632767|gb|ABC28734.1| ATPase involved in chromosome partitioning [Hahella chejuensis KCTC
           2396]
          Length = 365

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 131/342 (38%), Positives = 210/342 (61%), Gaps = 6/342 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+ I ++ +  ++K    P  K ++  ++ +  + I  + V L + + +  A    +L+ 
Sbjct: 1   MSSIDRSAVEAAIKGYKDPYLKEDLFAIEAIKSLDIQGDVVKLEVELGYPAAGVAGALKQ 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNI 116
                I+++  V+ A V ++    P Q + NL    +VK  +AVASGKGGVGKSTT VN+
Sbjct: 61  IVGLAIEDVDGVERAEVNVSWKILPHQAQRNLQSIKSVKNIIAVASGKGGVGKSTTAVNL 120

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKIS--GKVEISDKKFLKPKENYGIKIMSMASLV 174
           A AL+ +G  V +LDAD+YGPS   +L ++   + E+ D +F  P   +G+++MSMA LV
Sbjct: 121 ALALQKEGAKVGVLDADIYGPSQGMMLGVADGARPEVQDGQFFIPIRAHGMQVMSMAFLV 180

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
            E   M+WRGPMV  A++ +L   +W  LD+L++DMPPGTGD  LT+AQK+P++G VIV+
Sbjct: 181 TEKTPMVWRGPMVSGALLQLLTQSLWEDLDYLVVDMPPGTGDIQLTLAQKVPVTGAVIVT 240

Query: 235 TPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGI 294
           TPQD+AL+D K+ I M++K++IP++G++ENMS  + S+ G    LFG GG    +E+   
Sbjct: 241 TPQDIALLDCKKGIEMFRKVDIPVLGVVENMSMHICSNCGHHEPLFGAGGGERVSEEYDT 300

Query: 295 PFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             L  +P  M +R  +D G P V    +S    IY++I+ ++
Sbjct: 301 ELLGQLPLHMTIREQTDSGSPTVAAEPDSEVGLIYRDIARKL 342


>gi|118602578|ref|YP_903793.1| hypothetical protein Rmag_0571 [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|118567517|gb|ABL02322.1| protein of unknown function DUF59 [Candidatus Ruthia magnifica str.
           Cm (Calyptogena magnifica)]
          Length = 360

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 121/244 (49%), Positives = 173/244 (70%), Gaps = 1/244 (0%)

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG-KVEIS 152
           VK  +A+ASGKGGVGKSTT VN+A AL+ +G  +AILDAD+YGPS P++L +S  K E +
Sbjct: 97  VKNIIAIASGKGGVGKSTTAVNLALALQMEGAKIAILDADIYGPSQPRMLGVSKVKPEST 156

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
            +  L P   +GI+ MS+  LVDE+  MIWRGPMV  A+  ML + +W  +D+++ID+PP
Sbjct: 157 AEGKLLPILGHGIQSMSIGYLVDEDNPMIWRGPMVTQALEQMLRDTLWRGIDYMIIDLPP 216

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++QKIP+SG VIV+TPQD+ALID K+ + M++K+NIPI+G++ENMS  + S+
Sbjct: 217 GTGDTQLTLSQKIPVSGSVIVTTPQDIALIDAKKGLKMFEKVNIPILGIVENMSLHICSE 276

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG GG    A    + FL ++P +MD+R   D G P V+ +     SEIY+EI
Sbjct: 277 CGHQEAIFGTGGGETMAADANVEFLGALPLEMDIRTDVDEGTPTVIKDPEGRISEIYKEI 336

Query: 333 SDRI 336
           + ++
Sbjct: 337 AKKV 340


>gi|89272112|emb|CAJ81382.1| novel protein similar to nucleotide binding protein 1 (MinD
           homolog, E. coli) nubp1 [Xenopus (Silurana) tropicalis]
          Length = 311

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 123/257 (47%), Positives = 174/257 (67%), Gaps = 2/257 (0%)

Query: 82  NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC--ALKNKGKNVAILDADVYGPSI 139
           ++  P+Q+    VK  V VASGKGGVGKSTT VN+A   A  ++ K V +LDADVYGPSI
Sbjct: 46  SRGLPKQKPIPGVKHVVVVASGKGGVGKSTTAVNLALGIAASDQVKAVGLLDADVYGPSI 105

Query: 140 PKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVV 199
           P+++ + G  E+S+K  + P  NYGI+ MSM  LV+E   ++WRG MV SAI  +L  V 
Sbjct: 106 PRMMNLKGNPEVSNKNLMIPLFNYGIRCMSMGFLVEETAPIVWRGLMVMSAIEKLLRQVE 165

Query: 200 WGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPII 259
           WG+LD+L+IDMPPGTGD  L+I+Q IP+SG VIVSTPQD+AL+D +R   M+QK+N+P++
Sbjct: 166 WGELDYLVIDMPPGTGDVQLSISQNIPISGAVIVSTPQDIALVDARRGAEMFQKVNVPVL 225

Query: 260 GMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVH 319
           G ++NMS F       +  +FG  GAR  AE +G   L  +P  +++R  SD G P+VV 
Sbjct: 226 GFVQNMSIFQCPKCNHETHIFGEEGARRLAESLGFDILGDIPLHINIRETSDQGRPVVVS 285

Query: 320 NMNSATSEIYQEISDRI 336
           +  S+ ++ Y +I+  +
Sbjct: 286 DPQSSEAKAYLKIASEV 302


>gi|329900711|ref|ZP_08272559.1| Mrp protein [Oxalobacteraceae bacterium IMCC9480]
 gi|327549404|gb|EGF33970.1| Mrp protein [Oxalobacteraceae bacterium IMCC9480]
          Length = 362

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 128/337 (37%), Positives = 209/337 (62%), Gaps = 4/337 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I    + ++L  +  P    ++V  + +  I +  N V   + + +    Q+  +R  A 
Sbjct: 3   ITAENVKEALSKVIDPNTNKDLVASRCVKNIKLDGNDVAFDVELGYPAKSQIDGIRRAAI 62

Query: 64  QIIQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACA 119
             ++ +P + N  V +      +  Q+   L  NVK  +AVASGKGGVGKSTT VN+A A
Sbjct: 63  SAVRQLPGIGNVSVNVYSKIIAHTAQRGVKLMANVKNIIAVASGKGGVGKSTTAVNLALA 122

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
           L  +G  V ILDAD+YGPS P ++ ISG+ E  D K ++P EN+G+++ S+  ++D +  
Sbjct: 123 LAAEGAQVGILDADIYGPSQPMMMGISGRPETIDGKTMEPMENHGLQVSSIGFMIDPDEP 182

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGP+V  A+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+
Sbjct: 183 MVWRGPIVTQALQQLLDQTNWRDLDYLIVDMPPGTGDIQLTLSQKVPVTGAVIVTTPQDI 242

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D ++ + M++K++IPI+G++ENMS  + S+ G    +FG GG      + G+ FL +
Sbjct: 243 ALLDARKGLKMFEKVDIPILGIVENMSTHICSNCGHAEAIFGQGGGEKMCHEYGVDFLGA 302

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P  M +R  +D G+P V+ + +   +EIY++I+ +I
Sbjct: 303 LPLTMSIREHADSGMPTVIADPDGPVAEIYRQIARKI 339


>gi|221632551|ref|YP_002521772.1| Mrp [Thermomicrobium roseum DSM 5159]
 gi|221156167|gb|ACM05294.1| Mrp [Thermomicrobium roseum DSM 5159]
          Length = 363

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 125/332 (37%), Positives = 201/332 (60%), Gaps = 6/332 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+++ + +++++L+ +  P    ++V++  + E+ I   +V + + +        + +R 
Sbjct: 1   MSELTRERVLEALRPVQDPELHRSLVDLGMIKEVTIEGASVRVQVELTTPACPLRERIRE 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNP-----PQQRNNLNVKKFVAVASGKGGVGKSTTVVN 115
           + ++ ++ +P V+   V  +          P ++    VK  +AVASGKGGVGKST  VN
Sbjct: 61  DVERAVRALPGVQTVEVGFSSRVRAAGTGLPDRQPIPGVKNTIAVASGKGGVGKSTVAVN 120

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVD 175
           +A AL  +G  V +LDADVYGPSIP +L    +  + D K + P   YGI +MS+  ++D
Sbjct: 121 LAVALAQEGATVGLLDADVYGPSIPLMLGAEEQPGLVDNKII-PGRAYGIAVMSVGYILD 179

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
              A+IWRGP+V   I   L +V WG LD+L+ID+PPGTGD  LT+ Q IPLSG +IV+T
Sbjct: 180 PEKALIWRGPLVSQLIRQFLSDVQWGDLDYLVIDLPPGTGDVQLTLVQTIPLSGAIIVTT 239

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQD+AL D  + + M++++  P++G++ENMSYF+    G   ++FG+GG    A K G+P
Sbjct: 240 PQDVALADAIKGLQMFREVKTPVLGIVENMSYFVCPHCGHVAEIFGSGGGERVANKYGVP 299

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSE 327
            L  +P D  VR   D G+P+VV    S+T++
Sbjct: 300 LLGQIPIDPAVREGGDRGVPVVVGQPGSSTAQ 331


>gi|62857965|ref|NP_001016573.1| nucleotide binding protein-like [Xenopus (Silurana) tropicalis]
 gi|112419375|gb|AAI22010.1| hypothetical protein LOC549327 [Xenopus (Silurana) tropicalis]
          Length = 319

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 123/257 (47%), Positives = 174/257 (67%), Gaps = 2/257 (0%)

Query: 82  NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC--ALKNKGKNVAILDADVYGPSI 139
           ++  P+Q+    VK  V VASGKGGVGKSTT VN+A   A  ++ K V +LDADVYGPSI
Sbjct: 54  SRGLPKQKPIPGVKHVVVVASGKGGVGKSTTAVNLALGIAASDQVKAVGLLDADVYGPSI 113

Query: 140 PKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVV 199
           P+++ + G  E+S+K  + P  NYGI+ MSM  LV+E   ++WRG MV SAI  +L  V 
Sbjct: 114 PRMMNLKGNPEVSNKNLMIPLFNYGIRCMSMGFLVEETAPIVWRGLMVMSAIEKLLRQVE 173

Query: 200 WGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPII 259
           WG+LD+L+IDMPPGTGD  L+I+Q IP+SG VIVSTPQD+AL+D +R   M+QK+N+P++
Sbjct: 174 WGELDYLVIDMPPGTGDVQLSISQNIPISGAVIVSTPQDIALVDARRGAEMFQKVNVPVL 233

Query: 260 GMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVH 319
           G ++NMS F       +  +FG  GAR  AE +G   L  +P  +++R  SD G P+VV 
Sbjct: 234 GFVQNMSIFQCPKCNHETHIFGEEGARRLAESLGFDILGDIPLHINIRETSDQGRPVVVS 293

Query: 320 NMNSATSEIYQEISDRI 336
           +  S+ ++ Y +I+  +
Sbjct: 294 DPQSSEAKAYLKIASEV 310


>gi|254486018|ref|ZP_05099223.1| Mrp/NBP35 family protein [Roseobacter sp. GAI101]
 gi|214042887|gb|EEB83525.1| Mrp/NBP35 family protein [Roseobacter sp. GAI101]
          Length = 353

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 131/342 (38%), Positives = 205/342 (59%), Gaps = 14/342 (4%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           ++ ++  LK L+ P    +IVE+  +  + +    V   + V  + A    +LR  A   
Sbjct: 3   RDAVLACLKTLNDPVSGKDIVELGLVKALTVDEGAVRFVLEVNPSHADAYAALRDQADAA 62

Query: 66  IQNIPTVKNAVVTLTENKN---PPQQRNNL-----------NVKKFVAVASGKGGVGKST 111
           ++ +  VK     LT +     PP  +               V + +A+ASGKGGVGKST
Sbjct: 63  VKALDGVKTVSAVLTAHSKQAAPPDLKMGRKSEPTGPEKIPGVDRILAIASGKGGVGKST 122

Query: 112 TVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMA 171
              N+ACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS+ 
Sbjct: 123 VAANLACALAAEGRRVGMLDADVYGPSQPRMLGVSGRPASPDGKTILPMRNFGVTMMSIG 182

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
            + +++ A++WRGPM+  A+  M+  V WG LD L++D+PPGTGD  +T+AQK  + G +
Sbjct: 183 LMTNDDQAVVWRGPMLMGALQQMMMQVQWGALDVLIVDLPPGTGDVQMTLAQKAQVDGAI 242

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEK 291
           IVSTPQD+AL+D ++ I M+ ++  PIIGMIENMS  + S+ G +  +FG+GG   EA K
Sbjct: 243 IVSTPQDVALLDARKGIDMFNQLKTPIIGMIENMSTHICSNCGHEEHVFGHGGVAAEAAK 302

Query: 292 IGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           +G+P L  +P  +D+RV +D G PIVV   +S  +E ++ ++
Sbjct: 303 LGVPLLAEIPLHLDIRVAADGGAPIVVSKPDSPQAEAFRTVA 344


>gi|171463318|ref|YP_001797431.1| protein of unknown function DUF59 [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171192856|gb|ACB43817.1| protein of unknown function DUF59 [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 362

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 128/329 (38%), Positives = 204/329 (62%), Gaps = 4/329 (1%)

Query: 12  SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPT 71
           +LK L  P  + + V  + +  + +    + L + + +    Q  S+R +    ++ +  
Sbjct: 11  ALKNLVAPNTRVDFVTAKNIKNLRVEEGDISLDLILGYPAKSQFDSIRKSVINALRELSG 70

Query: 72  VKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNV 127
           VKN  V ++     +  Q+   L   VK  +AVASGKGGVGKSTT VN+A AL  +G  V
Sbjct: 71  VKNVSVNVSSQIVAHAVQRGVKLLPGVKNIIAVASGKGGVGKSTTAVNLALALSAEGAQV 130

Query: 128 AILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMV 187
            ILDAD+YGPS P +L I+G+    ++  ++P E YG++  S+  L+D++  M+WRGPMV
Sbjct: 131 GILDADIYGPSQPMMLGITGRPNSLEENTIEPMEAYGLQASSIGFLIDDDAPMVWRGPMV 190

Query: 188 QSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRA 247
            SA+  +L    W  LD+L++DMPPGTGD  LT+AQK+P++G VIV+TPQD+AL+D ++ 
Sbjct: 191 TSALEQLLRQTRWRDLDYLIVDMPPGTGDIQLTLAQKVPVTGSVIVTTPQDIALLDARKG 250

Query: 248 ISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVR 307
           + M++K+ +PIIG+IENMS ++ +  G +  +FG GG      +  + FL S+P ++ +R
Sbjct: 251 LKMFEKVGVPIIGIIENMSTYVCTKCGHEEYVFGIGGGEKMCAEYKVDFLGSLPLNLSIR 310

Query: 308 VLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +D G P VV + + A S IY+ I+ ++
Sbjct: 311 EQADAGRPAVVADPDGAISAIYKGIARQV 339


>gi|83855219|ref|ZP_00948749.1| Mrp/NBP35 family protein [Sulfitobacter sp. NAS-14.1]
 gi|83843062|gb|EAP82229.1| Mrp/NBP35 family protein [Sulfitobacter sp. NAS-14.1]
          Length = 355

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 132/344 (38%), Positives = 210/344 (61%), Gaps = 14/344 (4%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + ++ ++  LK L+ P    +IVE+  +  + +    V   + V  + A     LR  A 
Sbjct: 3   VTRDAVLACLKTLNDPVSGKDIVELGLVKALTVDDGAVRFVLEVNPSHADAYAKLRDEAD 62

Query: 64  QIIQNIPTVKN--AVVTLTENKNPPQQ----RNNL--------NVKKFVAVASGKGGVGK 109
             ++ +  V +  AV+T    + PP      R +          V + +A+ASGKGGVGK
Sbjct: 63  AAVKALEGVASVSAVLTAHSKQAPPPDLKLGRKSEPAGPEKIPGVDRIIAIASGKGGVGK 122

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMS 169
           ST   N+ACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS
Sbjct: 123 STVAANLACALAAEGRRVGMLDADVYGPSQPRMLGVSGRPASPDGKTILPMRNFGVTMMS 182

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           +  + +++ A++WRGPM+  A+  M+  V WG LD L++D+PPGTGD  +T+AQK  + G
Sbjct: 183 IGLMTNDDQAVVWRGPMLMGALQQMMMQVQWGALDVLIVDLPPGTGDVQMTLAQKAHVDG 242

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEA 289
            +IVSTPQD+AL+D ++ I M+ ++  PI+GMIENMS  + S+ G +  +FG+GG   EA
Sbjct: 243 AIIVSTPQDVALLDARKGIDMFNQLKTPILGMIENMSTHICSNCGHEEHVFGHGGVAAEA 302

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           EK+G+P L  +P  +D+RV +D G PIVV   +S  +E +++++
Sbjct: 303 EKLGVPLLAEIPLHLDIRVAADGGAPIVVSKPDSTQAEGFRKVA 346


>gi|224030717|gb|ACN34434.1| unknown [Zea mays]
          Length = 298

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 175/247 (70%), Gaps = 1/247 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVEI 151
            V   +AVASGKGGVGKSTT VNIA AL  + K  V +LDAD+YGPSIP ++ +  K E+
Sbjct: 35  GVGDIIAVASGKGGVGKSTTAVNIAVALAKEFKLQVGLLDADIYGPSIPTMMNLHAKPEV 94

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           ++   + P EN+G++ MS+  LVD +  ++WRGPMV SA+  M   V WG LD L++DMP
Sbjct: 95  NEDMKMIPVENHGVRCMSIGFLVDNDAPIVWRGPMVMSALEKMTRGVAWGDLDILVVDMP 154

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA L+++Q++ LSG +IVSTPQD+ALID +R  +M++K+ +PI+G++ENMS F   
Sbjct: 155 PGTGDAQLSMSQRLRLSGALIVSTPQDIALIDARRGANMFRKVQVPILGLVENMSCFKCP 214

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  AE++ +  L  VP ++ +R  SD G PIV+ + NSA+++ Y  
Sbjct: 215 KCGEKSYIFGEGGAQRTAEEMDMKLLGDVPLEISIRTGSDEGSPIVISSPNSASAQAYVN 274

Query: 332 ISDRIQQ 338
           +++++ Q
Sbjct: 275 VAEKVTQ 281


>gi|226510536|ref|NP_001150831.1| nucleotide-binding protein-like [Zea mays]
 gi|195642234|gb|ACG40585.1| nucleotide-binding protein-like [Zea mays]
          Length = 298

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 175/247 (70%), Gaps = 1/247 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVEI 151
            V   +AVASGKGGVGKSTT VNIA AL  + K  V +LDAD+YGPSIP ++ +  K E+
Sbjct: 35  GVGDIIAVASGKGGVGKSTTAVNIAVALAKEFKLQVGLLDADIYGPSIPTMMNLHAKPEV 94

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           ++   + P EN+G++ MS+  LVD +  ++WRGPMV SA+  M   V WG LD L++DMP
Sbjct: 95  NEDMKMIPVENHGVRCMSIGFLVDNDAPIVWRGPMVMSALEKMTRGVAWGDLDILVVDMP 154

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA L+++Q++ LSG +IVSTPQD+ALID +R  +M++K+ +PI+G++ENMS F   
Sbjct: 155 PGTGDAQLSMSQRLRLSGALIVSTPQDIALIDARRGANMFRKVQVPILGLVENMSCFKCP 214

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  AE++ +  L  VP ++ +R  SD G PIV+ + NSA+++ Y  
Sbjct: 215 KCGEKSYIFGEGGAQRTAEEMDMKLLGDVPLEISIRTGSDEGNPIVISSPNSASAQAYVN 274

Query: 332 ISDRIQQ 338
           +++++ Q
Sbjct: 275 VAEKVTQ 281


>gi|91782350|ref|YP_557556.1| putative ATP-binding protein [Burkholderia xenovorans LB400]
 gi|91686304|gb|ABE29504.1| Putative ATP-binding protein [Burkholderia xenovorans LB400]
          Length = 362

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 122/312 (39%), Positives = 201/312 (64%), Gaps = 4/312 (1%)

Query: 29  QRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTEN--KNPP 86
           + +  + +  +TV + + + +    Q  ++R+     ++ +P V +A V +++    +  
Sbjct: 28  KNIKNVAVQDDTVSVEVVLGYPAMRQFDAIRAQFSDALRAVPGVADARVQVSQQIAAHTV 87

Query: 87  QQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK 144
           Q+   L  NVK  VAVASGKGGVGKSTT VN+A AL ++G +V ILDAD+YGPS+P +L 
Sbjct: 88  QRGVKLLPNVKNIVAVASGKGGVGKSTTAVNLALALASEGASVGILDADIYGPSLPMMLG 147

Query: 145 ISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLD 204
           I G+ E  D+K + P   +G++  S+  L++++  M+WRGPM  SA+  +L    W  LD
Sbjct: 148 IVGRPESPDEKSMNPMTGHGLQANSIGFLIEQDNPMVWRGPMATSALEQLLRQTNWHDLD 207

Query: 205 FLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIEN 264
           +L++DMPPGTGD  LT++Q++P++G VIV+TPQD+AL+D K+ + M++K+ IPI+G++EN
Sbjct: 208 YLIVDMPPGTGDIQLTLSQRVPVTGAVIVTTPQDIALLDAKKGLKMFEKVGIPILGIVEN 267

Query: 265 MSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSA 324
           M   + S+ G +  +FG GG     ++ G+  L S+P D+ +R  +D G P VV +    
Sbjct: 268 MGTHICSNCGHEEHIFGAGGGERMGKEYGVDVLGSLPLDIAIREQADSGKPTVVADPEGR 327

Query: 325 TSEIYQEISDRI 336
            +EIY+ I+ ++
Sbjct: 328 IAEIYRSIARKV 339


>gi|193215038|ref|YP_001996237.1| hypothetical protein Ctha_1327 [Chloroherpeton thalassium ATCC
           35110]
 gi|193088515|gb|ACF13790.1| protein of unknown function DUF59 [Chloroherpeton thalassium ATCC
           35110]
          Length = 364

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 134/350 (38%), Positives = 217/350 (62%), Gaps = 16/350 (4%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFI-VHNTVYLSI--TVPHT-IAHQLQ 56
           M+QI + Q++D+L+ +  P  + +++ +  + ++ I   N V  ++  T P   +   ++
Sbjct: 1   MSQITEKQVIDALRNVIEPDLQRDLISLNMVKDVAIDADNNVSFTVVLTTPACPLKEMIK 60

Query: 57  SLRSNA-QQIIQNIPTVKNAVVTLTEN-----KNPPQQRNN--LNVKKFVAVASGKGGVG 108
           +   NA +  +Q    VK   V +T N     K   +   N  + V+  +AVASGKGGVG
Sbjct: 61  TACINAVRHFVQGAKEVK---VNMTANVTGGGKTKTKDAANPLVKVRNTIAVASGKGGVG 117

Query: 109 KSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIM 168
           KST   N+A AL   G  V ++DAD++GPSIP +  +  +      K L P E YG+K+M
Sbjct: 118 KSTVATNLAVALAKTGARVGLIDADIHGPSIPTMFGLKNEKPDVLGKTLIPLEKYGVKLM 177

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           S+  LVD+  A++WRGPMV SA+   +++V W +LD+LL D+PPGTGD  LT+ Q +PL+
Sbjct: 178 SIGFLVDQKTAVVWRGPMVSSALRQFMNDVAWNELDYLLFDLPPGTGDIQLTLVQTVPLT 237

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFE 288
           G V+V+TPQD+A+ DV++AISM++ + +P++G+IENMSY+   D  ++Y +FG GG +  
Sbjct: 238 GSVVVTTPQDVAVADVEKAISMFKSVKVPVLGIIENMSYYSLPDGHREY-IFGQGGGKKL 296

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           AE   +PFL  VP   DVR+  D G+P+V+ N  S  ++++   ++++ Q
Sbjct: 297 AESHSMPFLGEVPLGADVRMGGDEGVPVVIRNPESEQAKLFTTAAEKLAQ 346


>gi|83941741|ref|ZP_00954203.1| Mrp/NBP35 family protein [Sulfitobacter sp. EE-36]
 gi|83847561|gb|EAP85436.1| Mrp/NBP35 family protein [Sulfitobacter sp. EE-36]
          Length = 355

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 132/344 (38%), Positives = 210/344 (61%), Gaps = 14/344 (4%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + ++ ++  LK L+ P    +IVE+  +  + +    V   + V  + A     LR  A 
Sbjct: 3   VTRDAVLACLKTLNDPVSGKDIVELGLVKALTVDDGAVRFVLEVNPSHADAYAKLRDEAD 62

Query: 64  QIIQNIPTVKN--AVVTLTENKNPPQQ----RNNL--------NVKKFVAVASGKGGVGK 109
             ++ +  V +  AV+T    + PP      R +          V + +A+ASGKGGVGK
Sbjct: 63  AAVKALEGVASVSAVLTAHSKRVPPPDLKLGRKSEPAGPEKIPGVDRIIAIASGKGGVGK 122

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMS 169
           ST   N+ACAL  +G+ V +LDADVYGPS P++L +SG+    D K + P  N+G+ +MS
Sbjct: 123 STVAANLACALAAEGRRVGMLDADVYGPSQPRMLGVSGRPASPDGKTILPMRNFGVTMMS 182

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           +  + +++ A++WRGPM+  A+  M+  V WG LD L++D+PPGTGD  +T+AQK  + G
Sbjct: 183 IGLMTNDDQAVVWRGPMLMGALQQMMMQVQWGALDVLIVDLPPGTGDVQMTLAQKAHVDG 242

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEA 289
            +IVSTPQD+AL+D ++ I M+ ++  PI+GMIENMS  + S+ G +  +FG+GG   EA
Sbjct: 243 AIIVSTPQDVALLDARKGIDMFNQLKTPILGMIENMSTHICSNCGHEEHVFGHGGVAAEA 302

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           EK+G+P L  +P  +D+RV +D G PIVV   +S  +E +++++
Sbjct: 303 EKLGVPLLAEIPLHLDIRVAADGGAPIVVSKPDSTQAEGFRKVA 346


>gi|16924108|gb|AAL31687.1|AC092390_8 putative nucleotide-binding protein [Oryza sativa Japonica Group]
 gi|222625404|gb|EEE59536.1| hypothetical protein OsJ_11803 [Oryza sativa Japonica Group]
          Length = 292

 Score =  255 bits (652), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 176/245 (71%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVEI 151
            V   +AVASGKGGVGKSTT VNIA AL  K +  V +LDAD+YGPSIP ++ +  K E+
Sbjct: 29  GVSDIIAVASGKGGVGKSTTAVNIAVALAKKFQLKVGLLDADIYGPSIPTMMNLHAKPEV 88

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           S+   + P +NYG++ MS+  LVD++  ++WRGPMV SA+  +   V WG LD L++DMP
Sbjct: 89  SEDMRMIPVDNYGVQCMSIGFLVDKDAPIVWRGPMVMSALEKITRGVAWGNLDILVVDMP 148

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA L+++Q++ LSG +IVSTPQD+ALID +R  +M++K+ +PI+G++ENMS F   
Sbjct: 149 PGTGDAQLSMSQRLRLSGALIVSTPQDIALIDARRGANMFRKVQVPILGLVENMSCFKCP 208

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GG +  AE++ +  +  +P ++D+R  SD G PIV+ + +SA+++ Y +
Sbjct: 209 KCGEKSYIFGEGGGQRTAEEMDMKLIGEIPLEIDIRTGSDEGTPIVISSPDSASAQAYIQ 268

Query: 332 ISDRI 336
           +++++
Sbjct: 269 VAEKV 273


>gi|113474938|ref|YP_720999.1| hypothetical protein Tery_1165 [Trichodesmium erythraeum IMS101]
 gi|110165986|gb|ABG50526.1| protein of unknown function DUF59 [Trichodesmium erythraeum IMS101]
          Length = 356

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 133/337 (39%), Positives = 215/337 (63%), Gaps = 9/337 (2%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           I+D L+ +  P  + ++VE+  +  + I+   V  ++ +        + +    Q+ ++ 
Sbjct: 10  ILDVLRPVEDPELRKSLVELNMIRNVNIIDGQVKFTLVLTTPACPLREFIVEECQKAVKE 69

Query: 69  IPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKG 124
           +P VK  +V +T    + K  P ++    VK  +A++SGKGGVGKST  VN+A AL   G
Sbjct: 70  LPGVKEVIVDVTAETPQQKTLPDRQGIGGVKNIIAISSGKGGVGKSTVAVNVAVALAQMG 129

Query: 125 KNVAILDADVYGPSIPKLLKIS-GKVEI---SDKKFLKPKENYGIKIMSMASLVDENVAM 180
             V ++DAD+YGP+ P +L +   +V +      + L+P  N+G+K++SMA L+D++  +
Sbjct: 130 AKVGLIDADIYGPNDPTMLGLEDAQVMVQQGESGEVLQPAFNHGVKLVSMAFLIDKDQPV 189

Query: 181 IWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLA 240
           IWRGPM+   I   L+ V WG+LD+LL+D+PPGTGDA LT+AQ +P+SGVVIV+TPQ +A
Sbjct: 190 IWRGPMLNGIIRQFLYQVQWGELDYLLVDLPPGTGDAQLTLAQAVPMSGVVIVTTPQTVA 249

Query: 241 LIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPFLES 299
           L+D ++ + M+Q++ + ++G++ENMSYF+  D   KKYD+FG+GG    A+++G+P L  
Sbjct: 250 LLDSRKGLKMFQQLGVSVLGIVENMSYFVPPDMPDKKYDIFGSGGGEKTAQELGVPMLGG 309

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           VP +M VR   D GIPIVV +  S +++  Q I+  I
Sbjct: 310 VPLEMPVREGGDSGIPIVVGDPASVSAQKLQAIAQNI 346


>gi|300312382|ref|YP_003776474.1| chromosome partitioning ATPase [Herbaspirillum seropedicae SmR1]
 gi|300075167|gb|ADJ64566.1| ATPase involved in chromosome partitioning protein [Herbaspirillum
           seropedicae SmR1]
          Length = 362

 Score =  255 bits (651), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 198/322 (61%), Gaps = 4/322 (1%)

Query: 19  PGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIP--TVKNAV 76
           P    +++  +    I +    V L + + +  A Q+  +R   ++ +  +P  T   A 
Sbjct: 18  PNTGKDMIRGKEARNIRVEGPRVLLDVELGYPAASQVAPIRQLVEEALGKLPGVTAVEAN 77

Query: 77  VTLTENKNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV 134
           V      +  Q+   L  NVK  +AVASGKGGVGKSTT VN+A AL  +G  V ILDAD+
Sbjct: 78  VYFKIVAHAVQRGIKLKSNVKNIIAVASGKGGVGKSTTAVNLALALSAEGARVGILDADI 137

Query: 135 YGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHM 194
           YGPS P ++ ISG+ E  D K ++P EN+G+++ S+  ++D +  M+WRGP+V  A+  +
Sbjct: 138 YGPSQPMMMGISGQPETKDGKTMEPLENHGLQVSSIGFMIDPDEPMVWRGPIVTQALQQL 197

Query: 195 LHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKM 254
           L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+AL+D ++ + M++K+
Sbjct: 198 LDQTNWRDLDYLIVDMPPGTGDVQLTLSQKVPVTGAVIVTTPQDIALLDARKGLRMFEKV 257

Query: 255 NIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGI 314
            IPI+G++ENMS  + S+ G    +FG GG        G+ FL ++P  M++R  +D G 
Sbjct: 258 GIPILGIVENMSMHVCSNCGHAEPIFGVGGGEKMCADFGVDFLGALPLTMEIRQQTDSGK 317

Query: 315 PIVVHNMNSATSEIYQEISDRI 336
           P VV +     +EIY+ I+ ++
Sbjct: 318 PTVVADPEGKVAEIYKAIARKV 339


>gi|218193354|gb|EEC75781.1| hypothetical protein OsI_12698 [Oryza sativa Indica Group]
          Length = 288

 Score =  255 bits (651), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 176/245 (71%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVEI 151
            V   +AVASGKGGVGKSTT VNIA AL  K +  V +LDAD+YGPSIP ++ +  K E+
Sbjct: 25  GVSDIIAVASGKGGVGKSTTAVNIAVALAKKFQLKVGLLDADIYGPSIPTMMNLHAKPEV 84

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           S+   + P +NYG++ MS+  LVD++  ++WRGPMV SA+  +   V WG LD L++DMP
Sbjct: 85  SEDMRMIPVDNYGVQCMSIGFLVDKDAPIVWRGPMVMSALEKITRGVAWGNLDILVVDMP 144

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA L+++Q++ LSG +IVSTPQD+ALID +R  +M++K+ +PI+G++ENMS F   
Sbjct: 145 PGTGDAQLSMSQRLRLSGALIVSTPQDIALIDARRGANMFRKVQVPILGLVENMSCFKCP 204

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GG +  AE++ +  +  +P ++D+R  SD G PIV+ + +SA+++ Y +
Sbjct: 205 KCGEKSYIFGEGGGQRTAEEMDMKLIGEIPLEIDIRTGSDEGTPIVISSPDSASAQAYIQ 264

Query: 332 ISDRI 336
           +++++
Sbjct: 265 VAEKV 269


>gi|187923018|ref|YP_001894660.1| cobyrinic acid ac-diamide synthase [Burkholderia phytofirmans PsJN]
 gi|187714212|gb|ACD15436.1| Cobyrinic acid ac-diamide synthase [Burkholderia phytofirmans PsJN]
          Length = 362

 Score =  254 bits (650), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 121/312 (38%), Positives = 200/312 (64%), Gaps = 4/312 (1%)

Query: 29  QRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTEN--KNPP 86
           + +  + +  +TV + + + +    Q  ++R+     ++ +P V +  V +++    +  
Sbjct: 28  KNIKSVAVQGDTVSVDVVLGYPAMRQFDAIRAQFSDALRAVPGVADVRVQVSQQIAAHTV 87

Query: 87  QQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK 144
           Q+   L  NVK  VAVASGKGGVGKSTT VN+A AL ++G +V ILDAD+YGPS+P +L 
Sbjct: 88  QRGVKLLPNVKNIVAVASGKGGVGKSTTAVNLALALASEGASVGILDADIYGPSLPMMLG 147

Query: 145 ISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLD 204
           I G+ E  D+K + P   +G++  S+  L++++  M+WRGPM  SA+  +L    W  LD
Sbjct: 148 IVGRPESPDEKSMNPMTGHGLQANSIGFLIEQDNPMVWRGPMATSALEQLLRQTNWNDLD 207

Query: 205 FLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIEN 264
           +L++DMPPGTGD  LT++Q++P++G VIV+TPQD+AL+D K+ + M++K+ IPI+G++EN
Sbjct: 208 YLIVDMPPGTGDIQLTLSQRVPVTGAVIVTTPQDIALLDAKKGLKMFEKVGIPILGIVEN 267

Query: 265 MSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSA 324
           M   + S+ G +  +FG GG     ++ G+  L S+P D+ +R  +D G P VV +    
Sbjct: 268 MGMHICSNCGHEEHIFGAGGGERMGKEYGVDVLGSLPLDIAIREQADSGKPTVVADPQGR 327

Query: 325 TSEIYQEISDRI 336
            +EIY+ I+ ++
Sbjct: 328 IAEIYRSIARKV 339


>gi|188577740|ref|YP_001914669.1| hypothetical protein PXO_01241 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58427496|gb|AAW76533.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188522192|gb|ACD60137.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 285

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 111/232 (47%), Positives = 164/232 (70%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            ++  +AVASGKGGVGKSTT VN+A AL   G  V +LDAD+YGPS+P +L +SG+ E  
Sbjct: 23  RIRNVIAVASGKGGVGKSTTAVNVALALCQLGARVGVLDADIYGPSVPAMLGLSGRPESP 82

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P   +GI+ MS+  LVD++  MIWRGPM  SA+  + ++ +WG LD+LLID+PP
Sbjct: 83  DNKSIEPLRAFGIEAMSIGLLVDQDTPMIWRGPMATSALTQLFNDTLWGDLDYLLIDLPP 142

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++QKIP++G VIV+TPQD+A +D ++A+ M++K+ +P++G++ENM+    S+
Sbjct: 143 GTGDIQLTLSQKIPVAGAVIVTTPQDIATLDARKALKMFEKVEVPVLGIVENMAVHTCSN 202

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSA 324
            G +  LFG GG    A + G+P L S+P ++ +R   D G P+VV    S+
Sbjct: 203 CGHREHLFGEGGGERMAAQYGVPLLGSLPLEIAIREQGDAGQPVVVAAPESS 254


>gi|259416337|ref|ZP_05740257.1| Mrp/NBP35 family protein [Silicibacter sp. TrichCH4B]
 gi|259347776|gb|EEW59553.1| Mrp/NBP35 family protein [Silicibacter sp. TrichCH4B]
          Length = 356

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 131/348 (37%), Positives = 204/348 (58%), Gaps = 21/348 (6%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPH-TIAHQLQSLRSNA 62
           + K +I  +L  L++PG    +V    L  +     TV   I  P   +A Q+++LR  A
Sbjct: 3   VTKEEIRTALDRLALPG-GGTLVSRDMLRALSFEGGTVRFVIEAPSPEMAAQMETLRRAA 61

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQR-----------------NNLNVKKFVAVASGKG 105
           +  ++ +P V+   V LT +   PQ+                      V + +AVASGKG
Sbjct: 62  EACVKELPGVEEVSVVLTAHGPAPQKAAPSLKLGGHPKPQAAPMKPSGVGRILAVASGKG 121

Query: 106 GVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGI 165
           GVGKST   N+A AL  +G+ V +LDAD+YGPS P+++ +SG+    D   ++P   +G+
Sbjct: 122 GVGKSTVSANLAVALARQGRKVGLLDADIYGPSQPRMMGVSGRPASPDGTTIEPLHAHGV 181

Query: 166 KIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKI 225
            +MS+  +V+E  A++WRGPM+  A+  ML  V WG+LD L++D+PPGTGD  LT+  K 
Sbjct: 182 TVMSIGFMVEERKAVVWRGPMLMGALQQMLGQVNWGELDVLIVDLPPGTGDVQLTLCTKA 241

Query: 226 PLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGA 285
            LSG ++VSTPQD+AL+D ++A+ M+  +  P++G+IENMS+F   D G  +++FGNGG 
Sbjct: 242 ELSGAIVVSTPQDVALLDARKALDMFNTLKTPVLGLIENMSFFTCPDCGGTHNIFGNGGV 301

Query: 286 RFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
             EA+ +G+P L ++P D++ R+  D G PI         +E Y  I+
Sbjct: 302 AAEAKDLGLPLLGALPIDLETRLAGDNGTPIAAG--EGVMAEAYARIA 347


>gi|166712655|ref|ZP_02243862.1| hypothetical protein Xoryp_14670 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 283

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 111/232 (47%), Positives = 164/232 (70%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            ++  +AVASGKGGVGKSTT VN+A AL   G  V +LDAD+YGPS+P +L +SG+ E  
Sbjct: 21  RIRNVIAVASGKGGVGKSTTAVNVALALCRLGARVGVLDADIYGPSVPAMLGLSGRPESP 80

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P   +GI+ MS+  LVD++  MIWRGPM  SA+  + ++ +WG LD+LLID+PP
Sbjct: 81  DNKSIEPLRAFGIEAMSIGLLVDQDTPMIWRGPMATSALTQLFNDTLWGDLDYLLIDLPP 140

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++QKIP++G VIV+TPQD+A +D ++A+ M++K+ +P++G++ENM+    S+
Sbjct: 141 GTGDIQLTLSQKIPVAGAVIVTTPQDIATLDARKALKMFEKVEVPVLGIVENMAVHTCSN 200

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSA 324
            G +  LFG GG    A + G+P L S+P ++ +R   D G P+VV    S+
Sbjct: 201 CGHREHLFGEGGGERMAAQYGVPLLGSLPLEIAIREQGDAGQPVVVAAPESS 252


>gi|84624761|ref|YP_452133.1| hypothetical protein XOO_3104 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|122879250|ref|YP_201918.6| hypothetical protein XOO3279 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84368701|dbj|BAE69859.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 283

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 111/232 (47%), Positives = 164/232 (70%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            ++  +AVASGKGGVGKSTT VN+A AL   G  V +LDAD+YGPS+P +L +SG+ E  
Sbjct: 21  RIRNVIAVASGKGGVGKSTTAVNVALALCQLGARVGVLDADIYGPSVPAMLGLSGRPESP 80

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P   +GI+ MS+  LVD++  MIWRGPM  SA+  + ++ +WG LD+LLID+PP
Sbjct: 81  DNKSIEPLRAFGIEAMSIGLLVDQDTPMIWRGPMATSALTQLFNDTLWGDLDYLLIDLPP 140

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++QKIP++G VIV+TPQD+A +D ++A+ M++K+ +P++G++ENM+    S+
Sbjct: 141 GTGDIQLTLSQKIPVAGAVIVTTPQDIATLDARKALKMFEKVEVPVLGIVENMAVHTCSN 200

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSA 324
            G +  LFG GG    A + G+P L S+P ++ +R   D G P+VV    S+
Sbjct: 201 CGHREHLFGEGGGERMAAQYGVPLLGSLPLEIAIREQGDAGQPVVVAAPESS 252


>gi|302184710|ref|ZP_07261383.1| ParA family protein [Pseudomonas syringae pv. syringae 642]
          Length = 364

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 125/277 (45%), Positives = 178/277 (64%), Gaps = 6/277 (2%)

Query: 66  IQNIPTVKNAVVTLTE----NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I+N+  V +A V +T     +K   Q     NVK  VAVASGKGGVGKSTT  N+A AL 
Sbjct: 66  IENLDGVSSATVAITSVIGAHKAQSQIPGLANVKNIVAVASGKGGVGKSTTAANLALALS 125

Query: 122 NKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
            +G  V ILDAD+YGPS   +  I    + +I D+K+  P E +GI++MSMA L D+N  
Sbjct: 126 REGARVGILDADIYGPSQGVMFGIPEGTRPKIKDQKWFVPVEAHGIEVMSMAFLTDDNTP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TPQDL
Sbjct: 186 MVWRGPMVSGALLQLVTQTAWNDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTPQDL 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A +  +  L S
Sbjct: 246 ALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLATQYDVELLAS 305

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P  M +R  +D G P  +    S  + +YQE++  +
Sbjct: 306 LPLSMLIREQADGGKPTAIAEPESQIAMVYQELARHV 342


>gi|167647305|ref|YP_001684968.1| hypothetical protein Caul_3343 [Caulobacter sp. K31]
 gi|167349735|gb|ABZ72470.1| protein of unknown function DUF59 [Caulobacter sp. K31]
          Length = 369

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 129/305 (42%), Positives = 181/305 (59%), Gaps = 27/305 (8%)

Query: 45  ITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLT-----------------ENKN--- 84
           + VP +       +R  A++++  +P V  A V LT                 E+K    
Sbjct: 48  LEVPASKVAAYAPVREAAEKVLAGLPGVDVAQVVLTAQAAEGVTRARKGAKVAEDKQAKL 107

Query: 85  --PPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKL 142
             PP+     +VK  +AVASGKGGVGKST   N+ACA   +G  V +LDADVYGPS P++
Sbjct: 108 VPPPEAEKPAHVKHVIAVASGKGGVGKSTVATNLACAFAAQGLRVGLLDADVYGPSAPRM 167

Query: 143 LKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQ 202
           + + G+    D K L+P   +GI +MS+  LVDE  AMIWRGPM  SA+  M+H+V WG 
Sbjct: 168 MGVDGEPSFEDGK-LQPLVAHGIMLMSIGFLVDEGRAMIWRGPMASSAVRQMIHDVAWGS 226

Query: 203 ----LDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPI 258
               LD L++D+PPGTGD  LT+ QK+ + GVV+V+TPQ++ALID +RA +M+ K   PI
Sbjct: 227 EAAPLDVLVVDLPPGTGDIQLTLVQKLKIDGVVLVTTPQEIALIDARRAAAMFGKTATPI 286

Query: 259 IGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVV 318
           +G+IENM++F    TG    +FG GG   EA+ + +P L  VP ++ VR   D G P+V+
Sbjct: 287 LGLIENMAFFADPATGAPIPIFGAGGGVEEAKTLAVPLLAQVPIEIAVREAGDAGAPVVL 346

Query: 319 HNMNS 323
               S
Sbjct: 347 RAPGS 351


>gi|114777466|ref|ZP_01452463.1| mrP protein [Mariprofundus ferrooxydans PV-1]
 gi|114552248|gb|EAU54750.1| mrP protein [Mariprofundus ferrooxydans PV-1]
          Length = 358

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 127/336 (37%), Positives = 204/336 (60%), Gaps = 11/336 (3%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
           +QI+D       P    +IV +  + ++ I  ++V  +I +        +  R  A + +
Sbjct: 12  SQIID-------PDFGKDIVSLGFVKDVKIDGSSVSFTIELTTPACPVKEEFRRQADEAV 64

Query: 67  QNIPTVKNAVVTLTENKNP--PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKG 124
             +  ++   V +T         +     +   +A+ASGKGGVGKSTT VN+A A+   G
Sbjct: 65  MALTGIERVHVNMTSRVTAGISDKLAIPGIANIIAIASGKGGVGKSTTSVNLAVAMAQTG 124

Query: 125 KNVAILDADVYGPSIPKLLKISG-KVEIS-DKKFLKPKENYGIKIMSMASLVDENVAMIW 182
             V +LDAD+YGPS+P+++ +SG + E+  + K + P ENYG+K MS+  LV+EN AMIW
Sbjct: 125 ARVGLLDADIYGPSVPRMMGLSGFRPEVDVEGKTIYPLENYGVKTMSIGYLVEENKAMIW 184

Query: 183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI 242
           RGPMV  A+  +L +V WG+LD+L +DMPPGTGDA LT+ QK+P++G V+V+TPQD+AL+
Sbjct: 185 RGPMVAGALGQLLGDVAWGELDYLFVDMPPGTGDAQLTLTQKVPVTGAVMVTTPQDIALL 244

Query: 243 DVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPF 302
           D ++ I M+ ++++P +G++ENMS F+    G+   +F  GGA   A++     L  +P 
Sbjct: 245 DCRKGIDMFNEVHVPTLGIVENMSQFICPHCGESSPIFAEGGADRLAQEYKTGVLAHIPL 304

Query: 303 DMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           DM +R LSD G P+V    +S  +  Y++++  I +
Sbjct: 305 DMRIRELSDSGTPVVAALPDSEQAVAYRQLAGEIAR 340


>gi|297538809|ref|YP_003674578.1| ParA/MinD-like ATPase [Methylotenera sp. 301]
 gi|297258156|gb|ADI30001.1| ATPase-like, ParA/MinD [Methylotenera sp. 301]
          Length = 362

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 138/334 (41%), Positives = 206/334 (61%), Gaps = 10/334 (2%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPH---TIAHQLQSLRSNAQQI 65
           I  +LKV   P    + +  +    I I  N V + I + +   ++   +Q+L SNA   
Sbjct: 8   IQSTLKVCIDPHTGKDFISSKSAKNIQINGNDVSVDIVLGYPAKSVIADVQALVSNA--- 64

Query: 66  IQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALK 121
           ++ +P V N  V +      +  QQ   L  NVK  +AVASGKGGVGKSTT VN+A AL 
Sbjct: 65  LKALPDVGNVNVNIGSRIVAHKAQQGVTLLPNVKNIIAVASGKGGVGKSTTSVNLALALA 124

Query: 122 NKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMI 181
            +G  V +LDAD+YGPS P++L ISG+ E  D K + P E +GI+ MS+  L+D +  M+
Sbjct: 125 AEGATVGLLDADIYGPSQPQMLGISGRPESKDGKTMDPMEAHGIQSMSIGFLIDADTPMV 184

Query: 182 WRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLAL 241
           WRGPMV  A+  +L    W  LD+L++D+PPGTGD  LT+AQKIP++G +IV+TPQD+AL
Sbjct: 185 WRGPMVTGALEQLLRETKWRDLDYLIVDLPPGTGDIQLTLAQKIPVTGAIIVTTPQDIAL 244

Query: 242 IDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVP 301
           +D ++ + M++K+ IPI+G++ENMS  + S+ G +  +FG GG     +   +  L S+P
Sbjct: 245 LDARKGLKMFEKVGIPILGIVENMSTHICSNCGHEEHIFGAGGGALMCKDYNVDLLGSLP 304

Query: 302 FDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
            D+ +R  +D G P VV   +S  + IY+EI+ +
Sbjct: 305 LDITIREQADSGKPTVVATPDSKIANIYKEIARK 338


>gi|74318126|ref|YP_315866.1| chromosome partitioning ATPase [Thiobacillus denitrificans ATCC
           25259]
 gi|74057621|gb|AAZ98061.1| ATP-binding protein involved in chromosome partitioning
           [Thiobacillus denitrificans ATCC 25259]
          Length = 362

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 133/333 (39%), Positives = 204/333 (61%), Gaps = 4/333 (1%)

Query: 8   QIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQ 67
           Q+  +LK L  P    + V  +    I I  + V + I + +    QL +++   +  ++
Sbjct: 7   QVQSALKELIDPNTHKDYVTTKSARNIKIDGDAVSVDIALGYPAQSQLATIKQQVEDKLK 66

Query: 68  NIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNK 123
            +  V  A   ++     +  Q+   L  NVK  +AVASGKGGVGKSTT VN+A AL  +
Sbjct: 67  TLDGVSKATANVSFKIVSHSVQRGVKLIPNVKNIIAVASGKGGVGKSTTAVNLALALAAE 126

Query: 124 GKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWR 183
           G  V +LDAD+YGPS P +L I+ K E +D K L P   +GI+ MS+  L+D    M+WR
Sbjct: 127 GARVGMLDADIYGPSQPTMLGITDKPESTDGKNLDPLIGHGIQAMSIGFLIDVETPMVWR 186

Query: 184 GPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALID 243
           GPMV  A+  +L+N  W +LD+L++D+PPGTGD  LT+AQ++P++G VIV+TPQD+ALID
Sbjct: 187 GPMVTQALEQLLNNTNWNELDYLVVDLPPGTGDIQLTLAQRVPVTGAVIVTTPQDIALID 246

Query: 244 VKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFD 303
            ++ + M++K+ IPIIG++ENMS  + S+ G +  +FG GG         + FL ++P D
Sbjct: 247 ARKGLKMFEKVGIPIIGVVENMSLHICSNCGHEERIFGEGGGERMCRDYNVEFLGALPLD 306

Query: 304 MDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +R  +D G P VV + +   +EIY++I+ R+
Sbjct: 307 SSIRADTDSGKPSVVSDPDGRVTEIYKQIARRV 339


>gi|262167211|ref|ZP_06034923.1| Mrp protein [Vibrio cholerae RC27]
 gi|262024355|gb|EEY43044.1| Mrp protein [Vibrio cholerae RC27]
          Length = 365

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 166/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K E+
Sbjct: 100 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGGKVGLLDADIYGPSVPLMLGKTKAKPEV 159

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 160 RDNKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 219

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+++P+IG++ENMSY + S
Sbjct: 220 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICS 279

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +D+R   D G+P VV   NS  +E Y  
Sbjct: 280 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIDMREDIDAGVPTVVARPNSEHTERYLA 339

Query: 332 ISDRI 336
           ++ R+
Sbjct: 340 LAQRV 344


>gi|153952410|ref|YP_001398887.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. doylei 269.97]
 gi|152939856|gb|ABS44597.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. doylei 269.97]
          Length = 368

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 137/343 (39%), Positives = 210/343 (61%), Gaps = 10/343 (2%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +K QI++ LK +  PG + +IV    + +I I  N V++ I +          +R NA +
Sbjct: 1   MKEQILEKLKTVKYPGFEKDIVSFNFVKDIKIQDNGVFIDIEIVSANPEVANEIRKNATE 60

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKSTTVVNIA 117
            + ++  +KN  + +   K P ++ N+ +       VK F+ V+SGKGGVGKSTT VN+A
Sbjct: 61  ALSSL-ALKNIELNIITPKIPEEKSNSRSGKNIAPQVKNFIMVSSGKGGVGKSTTTVNLA 119

Query: 118 CALKNKGKNVAILDADVYGPSIPKLL-KISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
            ++   GK V ILDAD+YGP+IP++L +   + E+  ++ LKP   +G+ +MSM  L++E
Sbjct: 120 ISIAKMGKRVGILDADIYGPNIPRMLGETKTQPEVVGQR-LKPILTHGVYMMSMGVLIEE 178

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              ++WRG M+  AI  +L +V+W +LD L +DMPPGTGDA +T AQ IP++  V VSTP
Sbjct: 179 GQGLMWRGAMIMKAIEQLLADVIWPELDVLFLDMPPGTGDAQITSAQSIPITAGVCVSTP 238

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++L D KRA+ M+ K++IPI G+IENMS FL  D GK+YD+FG G A   A+      
Sbjct: 239 QTVSLDDSKRALDMFNKLHIPIAGVIENMSGFLCPDNGKEYDIFGKGTAEDMAKAYKSEV 298

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
           L  +P +M VR   D G P+  ++  S +S+ Y   +++I  F
Sbjct: 299 LAQIPIEMIVREGGDEGKPVSFYHPESVSSKRYLMAAEKIWSF 341


>gi|121728155|ref|ZP_01681190.1| mrp protein [Vibrio cholerae V52]
 gi|147674192|ref|YP_001216505.1| mrp protein [Vibrio cholerae O395]
 gi|121629552|gb|EAX61975.1| mrp protein [Vibrio cholerae V52]
 gi|146316075|gb|ABQ20614.1| mrp protein [Vibrio cholerae O395]
 gi|227012853|gb|ACP09063.1| mrp protein [Vibrio cholerae O395]
          Length = 382

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 166/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K E+
Sbjct: 117 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGGKVGLLDADIYGPSVPLMLGKTKAKPEV 176

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 177 RDNKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 236

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+++P+IG++ENMSY + S
Sbjct: 237 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICS 296

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +D+R   D G+P VV   NS  +E Y  
Sbjct: 297 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIDMREDIDAGVPTVVARPNSEHTERYLA 356

Query: 332 ISDRI 336
           ++ R+
Sbjct: 357 LAQRV 361


>gi|229523176|ref|ZP_04412583.1| Mrp protein [Vibrio cholerae TM 11079-80]
 gi|229339539|gb|EEO04554.1| Mrp protein [Vibrio cholerae TM 11079-80]
          Length = 382

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 166/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K E+
Sbjct: 117 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGGKVGLLDADIYGPSVPLMLGKTKAKPEV 176

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 177 RDNKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 236

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+++P+IG++ENMSY + S
Sbjct: 237 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICS 296

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +D+R   D G+P VV   NS  +E Y  
Sbjct: 297 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIDMREDIDAGVPTVVARPNSEHTERYLA 356

Query: 332 ISDRI 336
           ++ R+
Sbjct: 357 LAQRV 361


>gi|170077536|ref|YP_001734174.1| chromosome partitioning ATPase protein [Synechococcus sp. PCC 7002]
 gi|169885205|gb|ACA98918.1| ATPases involved in chromosome partitioning [Synechococcus sp. PCC
           7002]
          Length = 353

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 128/338 (37%), Positives = 211/338 (62%), Gaps = 11/338 (3%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           I+ +L+ +  P  + ++V++  +  + + + TV  ++ +        + +    +  +  
Sbjct: 7   ILAALRPVQDPELQKSLVDLNMIRNVSVENGTVKFTLVLTTPACPLKEFIVEECKNAVLP 66

Query: 69  IPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKG 124
           +P V    V +T    + K  P Q+   NVK  +A++SGKGGVGKS+  VN+A AL   G
Sbjct: 67  LPGVNAVDVEVTAETPQQKALPNQQGIDNVKNIIAISSGKGGVGKSSVAVNVAIALAQTG 126

Query: 125 KNVAILDADVYGPSIPKLLKISGKVEISDKK-----FLKPKENYGIKIMSMASLVDENVA 179
             V +LDAD+YGP++P ++ I G+VEI   K      L+P+ N+G+K++SMA L+D +  
Sbjct: 127 AKVGLLDADIYGPNVPNMMGI-GEVEIKVDKTGGQDILQPEFNHGVKLVSMAFLIDPDQP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           +IWRGPM+   I   L+ V WG+LD+L++DMPPGTGDA LT+AQ +P++G VIV+TPQ +
Sbjct: 186 VIWRGPMLNGIIRQFLYQVNWGELDYLIVDMPPGTGDAQLTMAQAVPMAGAVIVTTPQTV 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPFLE 298
           +L+D +R + M+Q+M + ++G++ENMSYF+  D   ++YDLFG+GG    A ++ +P L 
Sbjct: 246 SLLDSRRGLKMFQQMGVNVLGIVENMSYFIPPDLPDRQYDLFGSGGGEKTANELDVPLLG 305

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +P ++ +R   D G PIVV    SA+++    I+  I
Sbjct: 306 CIPLEIALREGGDTGTPIVVAQPESASAKALVSIAKAI 343


>gi|297578640|ref|ZP_06940568.1| mrp protein [Vibrio cholerae RC385]
 gi|297536234|gb|EFH75067.1| mrp protein [Vibrio cholerae RC385]
          Length = 382

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 166/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K E+
Sbjct: 117 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGGKVGLLDADIYGPSVPLMLGKTKAKPEV 176

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 177 RDNKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 236

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+++P+IG++ENMSY + S
Sbjct: 237 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICS 296

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +D+R   D G+P VV   NS  +E Y  
Sbjct: 297 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIDMREDIDAGVPTVVARPNSEHTERYLA 356

Query: 332 ISDRI 336
           ++ R+
Sbjct: 357 LAQRV 361


>gi|330949990|gb|EGH50250.1| ParA family protein [Pseudomonas syringae Cit 7]
          Length = 364

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 178/277 (64%), Gaps = 6/277 (2%)

Query: 66  IQNIPTVKNAVVTLTE----NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I+N+  V +A V ++     +K   Q     NVK  VAVASGKGGVGKSTT  N+A AL 
Sbjct: 66  IENLEGVSSATVAISSVISAHKAQSQIPGLANVKNIVAVASGKGGVGKSTTAANLALALS 125

Query: 122 NKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
            +G  V ILDAD+YGPS   +  I    + +I D+K+  P E +GI++MSMA L D+N  
Sbjct: 126 REGARVGILDADIYGPSQGVMFGIPEGTRPKIKDQKWFVPVEAHGIEVMSMAFLTDDNTP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TPQDL
Sbjct: 186 MVWRGPMVSGALLQLVTQTAWNDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTPQDL 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A +  +  L S
Sbjct: 246 ALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLATQYDVELLAS 305

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P  M +R  +D G P  +    S  + +YQE++  +
Sbjct: 306 LPLSMLIREQADGGKPTAIAEPESQIAMVYQELARHV 342


>gi|217970008|ref|YP_002355242.1| hypothetical protein Tmz1t_1588 [Thauera sp. MZ1T]
 gi|217507335|gb|ACK54346.1| protein of unknown function DUF59 [Thauera sp. MZ1T]
          Length = 363

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 122/336 (36%), Positives = 202/336 (60%), Gaps = 5/336 (1%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           +  + ++LK +  P    + V  + +  + +    V   + + +    Q   +R+   + 
Sbjct: 5   QQTVTEALKQVIDPNTGKDFVAGRSIRNLSVQGGEVRFDVELGYPAKSQHDPIRALLSEA 64

Query: 66  IQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALK 121
           +  +P V+   VT++     +  QQ   L   V+  +AVASGKGGVGKSTT VN+A AL 
Sbjct: 65  VAKLPGVERVAVTVSSKVVAHAVQQGVKLLPGVRNIIAVASGKGGVGKSTTAVNLALALS 124

Query: 122 NKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENVAM 180
            +G  V +LDAD+YGPS P++L I  +  +S D K + P + +G++ MS+  L+D +  M
Sbjct: 125 AEGARVGLLDADIYGPSQPQMLGIGDQRPVSEDGKTMTPLQAFGLQAMSIGFLIDPDTPM 184

Query: 181 IWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLA 240
           +WRGPM   A+  ML +  W  LD+L+IDMPPGTGD  LT++Q +P++G VIV+TPQD+A
Sbjct: 185 VWRGPMATQALNQMLKDTAWDDLDYLVIDMPPGTGDIQLTLSQSVPVTGAVIVTTPQDIA 244

Query: 241 LIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESV 300
           L+D ++ + M++K+ +PI+G++ENMS  + S  G +  +FG GG         +PFL ++
Sbjct: 245 LLDARKGVKMFEKVGVPILGVVENMSIHICSKCGHEEHIFGQGGGEKMCADFKVPFLGAL 304

Query: 301 PFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           P D+ +R  +D G P VV + +   + IY++I+ ++
Sbjct: 305 PLDIQIRTEADSGAPTVVADPDGRIASIYKQIARKV 340


>gi|116072594|ref|ZP_01469860.1| MRP protein-like [Synechococcus sp. BL107]
 gi|116064481|gb|EAU70241.1| MRP protein-like [Synechococcus sp. BL107]
          Length = 360

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 122/350 (34%), Positives = 214/350 (61%), Gaps = 18/350 (5%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
            Q   +L+ +   G     +E+  + ++ I        + +P     Q + + + A++++
Sbjct: 5   EQATRALEQIKDAGSGKTTLELGWIDQVRITPPRAVFRLNLPGFAQSQRERIAAEARELL 64

Query: 67  QNIPTVKNAVVTLTENKNP------------PQQRNNL-NVKKFVAVASGKGGVGKSTTV 113
             +  + +  + + +   P            P +R ++  V++ +AV+SGKGGVGKST  
Sbjct: 65  MGLEGINDVQIEVGQAPTPSQGSIGQAGHGQPAERQSIPGVRQVIAVSSGKGGVGKSTVA 124

Query: 114 VNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV-EIS---DKKFLKPKENYGIKIMS 169
           VN+ACAL  +G  V +LDAD+YGP+ P +L I+ +  E++   D + +KP E+ GI ++S
Sbjct: 125 VNLACALAQQGLKVGLLDADIYGPNAPTMLGIANQTPEVTGSGDTQRIKPIESCGIAMVS 184

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           M  L+DE+  +IWRGPM+   I   L+   WG+ D L++D+PPGTGDA L++AQ +P++G
Sbjct: 185 MGLLIDEHQPVIWRGPMLNGIIRQFLYQAEWGERDVLVVDLPPGTGDAQLSLAQAVPMAG 244

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFE 288
           V+IV+TPQ ++L D +R ++M++++ IP++G++ENMS F+  D   ++Y LFG+GG R  
Sbjct: 245 VIIVTTPQLVSLQDARRGLAMFRQLGIPVLGVVENMSAFIPPDMPDRRYALFGSGGGRRL 304

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           A+   +P L  VP +M V+   D G PIV+   +SA+++ +  +++R+QQ
Sbjct: 305 ADDYDVPLLAQVPMEMPVQEGGDSGSPIVISRSSSASAKEFTALAERVQQ 354


>gi|224438044|ref|ZP_03658983.1| putative ATP/GTP-binding protein [Helicobacter cinaedi CCUG 18818]
          Length = 366

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 136/344 (39%), Positives = 211/344 (61%), Gaps = 7/344 (2%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + + QI  +LK +  P    +IV    L E+ +    VY+ I +P +    + +L+   Q
Sbjct: 2   LTQEQITQNLKNVIYPNFSKDIVSFGFLKEVKVSDEGVYIRIDIPSSAQEVIDTLKIEVQ 61

Query: 64  QIIQNIPTVKN---AVVTLTENKNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIAC 118
           + + ++   +N    +        P  +  NL  ++K FV V+SGKGGVGKST+ VN+A 
Sbjct: 62  KQLDSLLQGQNLNLEINPPKPAPKPQPKTKNLAPHIKHFVMVSSGKGGVGKSTSSVNLAI 121

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISG-KVEISD-KKFLKPKENYGIKIMSMASLVDE 176
           AL  +GK V +LDAD+YGP+IP++L ++  K E+++ +K L P + +G+++MSM  L DE
Sbjct: 122 ALAQQGKRVGLLDADIYGPNIPRMLGLNATKAEVNEAQKKLIPLKAFGVEMMSMGVLYDE 181

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
             ++IWRGPM+  AI  ML +V+W +LD L+IDMPPGTGDA LT+AQ +P+S  VIV+TP
Sbjct: 182 GQSLIWRGPMIMRAIEQMLTDVLWSELDVLVIDMPPGTGDAQLTLAQSVPVSAGVIVTTP 241

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++L D  R++ M+ K+ +PI G+IENMS F+  D GK+YD+FG G +   A + G   
Sbjct: 242 QKVSLDDSARSLDMFDKLKVPIAGLIENMSGFICPDCGKEYDIFGKGTSEDLASQYGTST 301

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
           L  VP +  VR   D G PI     +S +++ Y + + ++  F 
Sbjct: 302 LAQVPLEPKVREGGDSGKPIAFFEPDSKSAKAYMQAAVKLLSFL 345


>gi|330973104|gb|EGH73170.1| ParA family protein [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 364

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 178/277 (64%), Gaps = 6/277 (2%)

Query: 66  IQNIPTVKNAVVTLTE----NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I+N+  V +A V ++     +K   Q     NVK  VAVASGKGGVGKSTT  N+A AL 
Sbjct: 66  IENLDGVSSATVAISSVISAHKAQSQIPGLANVKNIVAVASGKGGVGKSTTAANLALALS 125

Query: 122 NKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
            +G  V ILDAD+YGPS   +  I    + +I D+K+  P E +GI++MSMA L D+N  
Sbjct: 126 REGARVGILDADIYGPSQGVMFGIPEGTRPKIKDQKWFVPVEAHGIEVMSMAFLTDDNTP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TPQDL
Sbjct: 186 MVWRGPMVSGALLQLVTQTAWNDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTPQDL 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A +  +  L S
Sbjct: 246 ALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGAKLATQYDVELLAS 305

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P  M +R  +D G P  +    S  + +YQE++  +
Sbjct: 306 LPLSMLIREQADGGRPTAIAEPESQIAMVYQELARHV 342


>gi|225012594|ref|ZP_03703029.1| Mrp/Nbp35 family ATP-binding protein [Flavobacteria bacterium
           MS024-2A]
 gi|225003127|gb|EEG41102.1| Mrp/Nbp35 family ATP-binding protein [Flavobacteria bacterium
           MS024-2A]
          Length = 376

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 132/346 (38%), Positives = 205/346 (59%), Gaps = 14/346 (4%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I K  ++++L  +S+PGE  NI++   +S I I  + + + I + +      + L     
Sbjct: 3   ITKEAVINALNKISLPGEGKNIIDRGAVSNIMIFGDQIDIDIQLENPSLQARKKLEVTIL 62

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQRNNL------NVKKFVAVASGKGGVGKSTTVVNIA 117
           + I  +   K  +    +  +PP + N +       ++  +A++SGKGGVGKST   NIA
Sbjct: 63  KTIHEMVYEKAKIKINIKVVSPPAEENTIKGKPIKGIENVIAISSGKGGVGKSTVTANIA 122

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISG----KVEISDKKFLKPKENYGIKIMSMASL 173
             L   G  V +LDAD+YGPSIP +  + G     V++  K  ++P ENYG+K++S+   
Sbjct: 123 VTLAQMGCKVGVLDADIYGPSIPTMFDMEGARPLSVQVDGKSMMEPIENYGVKVLSIGFF 182

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
                A+IWRGPM   A+  M+ +  WG+LDFLLID+PPGTGD HL+I Q +PL+G V+V
Sbjct: 183 TKPEQAVIWRGPMAAKALNQMIFDASWGELDFLLIDLPPGTGDIHLSIVQSLPLNGAVVV 242

Query: 234 STPQDLALIDVKRAISMYQKMNI--PIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAE 290
           STPQ++AL D K+ ISM+Q+ NI  P++G+IENMSYF   +    KY +FG  GA + A+
Sbjct: 243 STPQNVALADAKKGISMFQQENIQVPVLGIIENMSYFTPPELPDNKYYIFGKKGAEYLAK 302

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              +PFL ++P +  VR  +D G P  +  + +  +  +QEIS ++
Sbjct: 303 DKEVPFLGALPIEQSVREAADAGRPAALQ-VQTPIAIAFQEISKKL 347


>gi|196230577|ref|ZP_03129439.1| protein of unknown function DUF59 [Chthoniobacter flavus Ellin428]
 gi|196225507|gb|EDY20015.1| protein of unknown function DUF59 [Chthoniobacter flavus Ellin428]
          Length = 349

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 126/345 (36%), Positives = 201/345 (58%), Gaps = 11/345 (3%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I   Q+ + L  +  PG   +I+    L ++ I    V + +T+        Q+++  ++
Sbjct: 2   ITPEQVREKLSTVKYPGFSRDIISFGLLKDVKITGVDVVVQMTLATNDPKIPQTIKEGSE 61

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQ--QRNNL--------NVKKFVAVASGKGGVGKSTTV 113
             +  IP V    V + + + PPQ  Q  +          +K+ +AVASGKGGVGKST  
Sbjct: 62  AALAQIPDVGRVTVRI-DIQAPPQAPQAGSAPMSAGAIEGIKRVIAVASGKGGVGKSTVA 120

Query: 114 VNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASL 173
            N+A AL   G +V + D D+YGPSI  +   + +   ++   + P E YG+++MSM  L
Sbjct: 121 ANLAVALSQTGASVGLCDCDLYGPSIGLMFGSNERPMATEDNRILPIERYGLRLMSMGFL 180

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           +D+    I RGPMV       L  V WG+LD+L++D+PPGTGD  LTI Q + L+G VIV
Sbjct: 181 LDDASPAILRGPMVTKYTQQFLRQVEWGELDYLILDLPPGTGDIQLTIVQTVALAGAVIV 240

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQ++ALID ++A +M+QK+N+P++G+IENMSYF++   GK+YD+FG GG   EA ++ 
Sbjct: 241 TTPQEVALIDARKAATMFQKVNVPVLGLIENMSYFVSPSDGKRYDIFGQGGGEREAARLK 300

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           +P L  +P D+  R   D G P+   +  +  S+ +++I + + Q
Sbjct: 301 VPLLGQIPIDIPTREAGDRGQPVTAADPANPVSQAFKKIVEHLTQ 345


>gi|206602900|gb|EDZ39380.1| putative integration host factor, alpha subunit HimA-like
           [Leptospirillum sp. Group II '5-way CG']
          Length = 358

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 126/339 (37%), Positives = 202/339 (59%), Gaps = 4/339 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M Q+ + ++  +L  +  P  K ++V ++ +  + I    V  +I +          +++
Sbjct: 1   MTQVAEEKVWQALSRVIEPDFKKDLVTLKMIENLKIEDGKVSFTIVLTTPACPLKDEMKN 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNN---LNVKKFVAVASGKGGVGKSTTVVNIA 117
              + ++++P V +  +  T                V+  +AV+SGKGGVGKSTT VN+A
Sbjct: 61  ACNEALRSVPGVTSTEIAFTARTTSGTFSGKAPITGVRNVLAVSSGKGGVGKSTTSVNLA 120

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDEN 177
             L+  G  V ILDADVYGP+IP +L I  + +  + +F+ P  N GI  MSMA LV   
Sbjct: 121 VGLQALGAKVGILDADVYGPNIPMMLGIKTQPKQVENRFIPPSSN-GIACMSMAFLVPPG 179

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
             +IWRGPM+   I   + +V WG+LD+L++DMPPGTGDA L++AQ +PLSG VIV+TPQ
Sbjct: 180 TPLIWRGPMLHGVIQQFVRDVEWGELDYLIVDMPPGTGDAQLSLAQLVPLSGAVIVTTPQ 239

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           +++L D +R ++M+QK+N+PI+G+IENMS F+  +   +  +F  GG    A+++ +PFL
Sbjct: 240 EVSLSDSRRGLAMFQKVNVPILGIIENMSMFVCPNCHHETPIFSQGGGEMAAKELKVPFL 299

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P D+ +R   D G+PI +    S  S+ Y+ I+ +I
Sbjct: 300 GRIPIDLSIREGGDQGVPIGIAQPQSPISKSYETIAGQI 338


>gi|66047112|ref|YP_236953.1| ParA family protein [Pseudomonas syringae pv. syringae B728a]
 gi|63257819|gb|AAY38915.1| ParA family protein [Pseudomonas syringae pv. syringae B728a]
          Length = 364

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 178/277 (64%), Gaps = 6/277 (2%)

Query: 66  IQNIPTVKNAVVTLTE----NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I+N+  V +A V ++     +K   Q     NVK  VAVASGKGGVGKSTT  N+A AL 
Sbjct: 66  IENLDGVSSATVAISSVISAHKAQSQIPGLANVKNIVAVASGKGGVGKSTTAANLALALS 125

Query: 122 NKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
            +G  V ILDAD+YGPS   +  I    + +I D+K+  P E +GI++MSMA L D+N  
Sbjct: 126 REGARVGILDADIYGPSQGVMFGIPEGTRPKIKDQKWFVPVEAHGIEVMSMAFLTDDNTP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TPQDL
Sbjct: 186 MVWRGPMVSGALLQLVTQTAWNDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTPQDL 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A +  +  L S
Sbjct: 246 ALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGAKLATQYDVELLAS 305

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P  M +R  +D G P  +    S  + +YQE++  +
Sbjct: 306 LPLSMLIREQADGGKPTAIAEPESQIAMVYQELARHV 342


>gi|303277761|ref|XP_003058174.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226460831|gb|EEH58125.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 308

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 124/264 (46%), Positives = 168/264 (63%), Gaps = 10/264 (3%)

Query: 83  KNPP---QQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNK-GKNVAILDADVYGPS 138
           K+PP        L V++ +AVASGKGGVGKSTT VN+ACA  +  G  V ILDADV+GPS
Sbjct: 32  KHPPVPDSLEGALGVQRIIAVASGKGGVGKSTTAVNLACAAASSLGLRVGILDADVFGPS 91

Query: 139 IPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLH 196
           +P L+ +  SG   I  +  + P ENYG+K MSM  L+ E  A +WRGPMV  A+  M+ 
Sbjct: 92  VPILMNLASSGTPAIDKENRMLPLENYGVKCMSMGFLIAEQSAAVWRGPMVMGALGKMIR 151

Query: 197 NVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNI 256
              W  LD L +DMPPGTGDA ++I+Q++PL+G VIVSTPQ++AL D +R ++MY K+N 
Sbjct: 152 ETKWHPLDVLFVDMPPGTGDAQISISQRLPLTGAVIVSTPQEIALADARRGVNMYSKVNT 211

Query: 257 PIIGMIENMSYFLA----SDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDL 312
           PI+G +ENMSY+       D   +  +FG GG +  AE +G+  L  VP D  +R  SD 
Sbjct: 212 PILGFVENMSYYAPPGSEDDASARAYIFGKGGVKHTAEAMGVELLAEVPLDQRIRERSDE 271

Query: 313 GIPIVVHNMNSATSEIYQEISDRI 336
           G PI V +  SA   +Y  ++ R+
Sbjct: 272 GRPIAVSDPESAAGRLYAAVARRL 295


>gi|157415825|ref|YP_001483081.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni 81116]
 gi|157386789|gb|ABV53104.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni 81116]
 gi|307748462|gb|ADN91732.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni M1]
 gi|315931649|gb|EFV10610.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni 327]
          Length = 368

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 136/343 (39%), Positives = 210/343 (61%), Gaps = 10/343 (2%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +K QI++ LK +  PG + +IV    + +I I  + V++ I +          +R NA +
Sbjct: 1   MKEQILEKLKTVKYPGFEKDIVSFNFVKDIKIQDDGVFIDIEIVSANPEVANEIRKNATE 60

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKSTTVVNIA 117
            + ++  +KN  + +   K P ++ N+ +       VK F+ V+SGKGGVGKSTT VN+A
Sbjct: 61  ALSSL-ALKNIELNIITPKIPEEKSNSRSGKNIAPQVKNFIMVSSGKGGVGKSTTTVNLA 119

Query: 118 CALKNKGKNVAILDADVYGPSIPKLL-KISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
            ++   GK V ILDAD+YGP+IP++L +   + E+  ++ LKP   +G+ +MSM  L++E
Sbjct: 120 ISMAKMGKRVGILDADIYGPNIPRMLGETKTQPEVVGQR-LKPILTHGVYMMSMGVLIEE 178

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              ++WRG M+  AI  +L +V+W +LD L +DMPPGTGDA +T AQ IP++  V VSTP
Sbjct: 179 GQGLMWRGAMIMKAIEQLLADVIWPELDVLFLDMPPGTGDAQITSAQSIPITAGVCVSTP 238

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++L D KRA+ M+ K++IPI G+IENMS FL  D GK+YD+FG G A   A+      
Sbjct: 239 QTVSLDDSKRALDMFNKLHIPIAGVIENMSGFLCPDNGKEYDIFGKGTAEDMAKAYKSEV 298

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
           L  +P +M VR   D G P+  ++  S +S+ Y   +++I  F
Sbjct: 299 LAQIPIEMIVREGGDEGKPVSFYHPESVSSKRYLTAAEKIWGF 341


>gi|330898585|gb|EGH30004.1| ParA family protein [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 364

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 178/277 (64%), Gaps = 6/277 (2%)

Query: 66  IQNIPTVKNAVVTLTE----NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I+N+  V +A V ++     +K   Q     NVK  VAVASGKGGVGKSTT  N+A AL 
Sbjct: 66  IENLDGVSSATVAISSVISAHKAQSQIPGLANVKNIVAVASGKGGVGKSTTAANLALALS 125

Query: 122 NKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
            +G  V ILDAD+YGPS   +  I    + +I D+K+  P E +GI++MSMA L D+N  
Sbjct: 126 REGARVGILDADIYGPSQGVMFGIPEGTRPKIKDQKWFVPVEAHGIEVMSMAFLTDDNTP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TPQDL
Sbjct: 186 MVWRGPMVSGALLQLVTQTAWNDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTPQDL 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A +  +  L S
Sbjct: 246 ALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGAKLATQYDVELLAS 305

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P  M +R  +D G P  +    S  + +YQE++  +
Sbjct: 306 LPLSMLIREQADGGKPTAIAEPESQIAMVYQELARHV 342


>gi|86152777|ref|ZP_01070982.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|283956989|ref|ZP_06374461.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni 1336]
 gi|85843662|gb|EAQ60872.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|283791490|gb|EFC30287.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni 1336]
          Length = 368

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 136/343 (39%), Positives = 210/343 (61%), Gaps = 10/343 (2%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +K QI++ LK +  PG + +IV    + +I I  + V++ I +          +R NA +
Sbjct: 1   MKEQILEKLKTVKYPGFEKDIVSFNFVKDIKIQDDGVFIDIEIVSANPEVANEIRKNATE 60

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKSTTVVNIA 117
            + ++  +KN  + +   K P ++ N+ +       VK F+ V+SGKGGVGKSTT VN+A
Sbjct: 61  ALSSL-ALKNIELNIITPKIPEEKSNSRSGKNIAPQVKNFIMVSSGKGGVGKSTTTVNLA 119

Query: 118 CALKNKGKNVAILDADVYGPSIPKLL-KISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
            ++   GK V ILDAD+YGP+IP++L +   + E+  ++ LKP   +G+ +MSM  L++E
Sbjct: 120 ISMAKMGKRVGILDADIYGPNIPRMLGETKTQPEVVGQR-LKPILTHGVYMMSMGVLIEE 178

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              ++WRG M+  AI  +L +V+W +LD L +DMPPGTGDA +T AQ IP++  V VSTP
Sbjct: 179 GQGLMWRGAMIMKAIEQLLADVIWPELDVLFLDMPPGTGDAQITSAQSIPITAGVCVSTP 238

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++L D KRA+ M+ K++IPI G+IENMS FL  D GK+YD+FG G A   A+      
Sbjct: 239 QTVSLDDSKRALDMFNKLHIPIAGVIENMSGFLCPDNGKEYDIFGKGTAEDMAKAYKSEV 298

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
           L  +P +M VR   D G P+  ++  S +S+ Y   +++I  F
Sbjct: 299 LAQIPIEMIVREGGDEGKPVSFYHPESVSSKRYLMAAEKIWSF 341


>gi|332285414|ref|YP_004417325.1| amidase [Pusillimonas sp. T7-7]
 gi|330429367|gb|AEC20701.1| amidase [Pusillimonas sp. T7-7]
          Length = 361

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 115/251 (45%), Positives = 170/251 (67%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI 145
           P  R   NV+  +AVASGKGGVGKSTT VNIA AL+ +G    +LDAD+YGPS+P +L +
Sbjct: 88  PGLRPLPNVRNIIAVASGKGGVGKSTTAVNIALALQQQGARTGLLDADIYGPSVPLMLGL 147

Query: 146 SGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDF 205
           SGK +  D K ++P   +G++  S+  L++E+   IWRGPMV  A++ +L+   W  LD+
Sbjct: 148 SGKPKSDDGKSMQPLVGHGLQANSIGFLIEEDAPAIWRGPMVTQALVQLLNQTAWDDLDY 207

Query: 206 LLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENM 265
           L++DMPPGTGD  LT+AQK+PL+G VIV+TPQDLAL D +R + M+QK+N+P++G++ENM
Sbjct: 208 LIVDMPPGTGDIALTMAQKVPLTGAVIVTTPQDLALADARRGLRMFQKVNVPVLGVVENM 267

Query: 266 SYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSAT 325
           S  + ++ G    +FG  G R  A +  +P+L ++P  M +R  +D G P VV   +   
Sbjct: 268 SVHVCTNCGHAEPIFGEHGGRDMAAEFNLPWLGALPLAMAIRTQTDSGTPSVVAEPDGKA 327

Query: 326 SEIYQEISDRI 336
           +  Y +I+ +I
Sbjct: 328 ALAYHDIARQI 338


>gi|229525646|ref|ZP_04415051.1| Mrp protein [Vibrio cholerae bv. albensis VL426]
 gi|229339227|gb|EEO04244.1| Mrp protein [Vibrio cholerae bv. albensis VL426]
          Length = 382

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 166/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K E+
Sbjct: 117 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGAKVGLLDADIYGPSVPLMLGKTKAKPEV 176

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 177 RDNKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 236

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+++P+IG++ENMSY + S
Sbjct: 237 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICS 296

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +++R   D G+P VV   NS  +E Y  
Sbjct: 297 HCGEKEHIFGVGGAQTLAAEFGLSLLTQIPLHIEMREDIDAGVPTVVARPNSEHTERYLA 356

Query: 332 ISDRI 336
           ++ R+
Sbjct: 357 LAQRV 361


>gi|159028874|emb|CAO90679.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 353

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 125/336 (37%), Positives = 211/336 (62%), Gaps = 8/336 (2%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           I++ L+ +  P  + ++VE+  +  + I    V  ++ +        + +  + Q+ ++ 
Sbjct: 8   ILEVLRPVQDPELQKSLVELNMIRNVAIDGGKVSFTLVLTTPACPLREFIVEDCQKAVKQ 67

Query: 69  IPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKG 124
           +P V++  V +T    + K  P ++    VK  +AV+SGKGGVGKST  VNIA AL + G
Sbjct: 68  LPGVESVAVDVTAETPQQKALPDRQGVEGVKNIIAVSSGKGGVGKSTVAVNIAVALAHLG 127

Query: 125 KNVAILDADVYGPSIPKLLKISGK---VEISDKKFLKPKENYGIKIMSMASLVDENVAMI 181
             V +LDAD+YGP+ P +L ++     V+ ++ + L+P  N+GIK++SM  L++ +  +I
Sbjct: 128 AKVGLLDADIYGPNAPTMLGLNDAQVTVQGANGEILEPAFNHGIKMVSMGFLINPDQPVI 187

Query: 182 WRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLAL 241
           WRGPM+   I   L+ V WG LD+L++DMPPGTGDA LT+ Q +PL+G VIV+TPQ ++L
Sbjct: 188 WRGPMLNGIIRQFLYQVNWGDLDYLIVDMPPGTGDAQLTLIQSVPLAGAVIVTTPQTVSL 247

Query: 242 IDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPFLESV 300
           ID +R + M+Q++   ++G++ENMSYF+  D   + YDLFG+GG    ++++GIP L  V
Sbjct: 248 IDARRGLKMFQQLGARVLGIVENMSYFIPPDQPDRSYDLFGSGGGEKTSQELGIPLLGCV 307

Query: 301 PFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           P ++ +R   D G+P+V+    SA+++    I+ ++
Sbjct: 308 PLEISLREGGDTGVPVVLGQPESASAKALIAIARQV 343


>gi|121612767|ref|YP_001001249.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni 81-176]
 gi|167006141|ref|ZP_02271899.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni 81-176]
 gi|87249623|gb|EAQ72582.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni 81-176]
          Length = 368

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 136/343 (39%), Positives = 209/343 (60%), Gaps = 10/343 (2%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +K QI++ LK +  PG + +IV    + +I I  + V++ I +          +R NA +
Sbjct: 1   MKEQILEKLKTVKYPGFEKDIVSFNFVKDIKIQDDGVFIDIEIVSANPEVANEIRKNATE 60

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKSTTVVNIA 117
            + ++  +KN  + +   K P ++ N+ +       VK F+ V+SGKGGVGKSTT VN+A
Sbjct: 61  ALSSL-ALKNIELNIITPKIPEEKSNSRSGKNIAPQVKNFIMVSSGKGGVGKSTTTVNLA 119

Query: 118 CALKNKGKNVAILDADVYGPSIPKLL-KISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
            ++   GK V ILDAD+YGP+IP++L +   + E+  ++ LKP   +G+ +MSM  L++E
Sbjct: 120 ISMAKMGKRVGILDADIYGPNIPRMLGETKTQPEVVGQR-LKPILTHGVYMMSMGVLIEE 178

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              ++WRG M+  AI  +L +V+W +LD L +DMPPGTGDA +T AQ IP++  V VSTP
Sbjct: 179 GQGLMWRGAMIMKAIEQLLADVIWPELDVLFLDMPPGTGDAQITSAQSIPITAGVCVSTP 238

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++L D KRA+ M+ K++IPI G+IENMS FL  D GK+YD+FG G A   A+      
Sbjct: 239 QTVSLDDSKRALDMFNKLHIPIAGVIENMSGFLCPDNGKEYDIFGKGTAEDMAKAYKSEV 298

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
           L  +P +M VR   D G P+  ++  S +S  Y   +++I  F
Sbjct: 299 LAQIPIEMIVREGGDEGKPVSFYHPESVSSRRYLMAAEKIWSF 341


>gi|289676764|ref|ZP_06497654.1| ParA family protein [Pseudomonas syringae pv. syringae FF5]
          Length = 364

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 177/277 (63%), Gaps = 6/277 (2%)

Query: 66  IQNIPTVKNAVVTLTE----NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I+N+  V +A V ++     +K   Q     NVK  VAVASGKGGVGKSTT  N+A AL 
Sbjct: 66  IENLDGVSSATVAISSVISAHKAQSQIPGLANVKNIVAVASGKGGVGKSTTAANLALALS 125

Query: 122 NKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
            +G  V ILDAD+YGPS   +  I    + +I D+K+  P E +GI++MSMA L D+N  
Sbjct: 126 REGARVGILDADIYGPSQGVMFGIPEGTRPKIKDQKWFVPVEAHGIEVMSMAFLTDDNTP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TPQDL
Sbjct: 186 MVWRGPMVSGALLQLVTQTAWNDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTPQDL 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D K+ + M++K+NIP++G++ENM+  + S  G    LFG GG    A +  +  L S
Sbjct: 246 ALLDAKKGVEMFRKVNIPVLGVVENMAVHICSSCGHAEHLFGEGGGAKLATQYDVELLAS 305

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P  M +R  +D G P  +    S  + +YQE++  +
Sbjct: 306 LPLSMLIREQADGGKPTAIAEPESQIAMVYQELARHV 342


>gi|167041871|gb|ABZ06611.1| putative 4Fe-4S iron sulfur cluster binding protein, NifH/frxC
           family protein [uncultured marine microorganism
           HF4000_133G03]
          Length = 332

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 134/311 (43%), Positives = 193/311 (62%), Gaps = 12/311 (3%)

Query: 31  LSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRN 90
           L  I I H+T+Y      + + + ++      ++ +    T+K      +  KNP +   
Sbjct: 34  LEIIIICHDTLYNDFISKNKLRYLVE------KKTVGLSNTLKGKTAPKSFTKNPIK--- 84

Query: 91  NLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVE 150
               K  +A++S KGGVGKST   N+A ALK     V ILDADVYGPS+PK++ I+ K +
Sbjct: 85  --GTKFTIAISSAKGGVGKSTVATNLALALKFLNHKVGILDADVYGPSLPKMMAINEKPK 142

Query: 151 ISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDM 210
             D K L P E YGI+ +S+  LVD+   MIWRGPMV SAI      V+W  LDFL++DM
Sbjct: 143 SEDGKSLMPIEQYGIQCISIGFLVDKETPMIWRGPMVISAIKTFTQKVLWNNLDFLVVDM 202

Query: 211 PPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLA 270
           PPGTGD  LT +Q+I + GVVIVSTPQ++AL+DV+R I M+ K+ +PIIG+++NMS+F  
Sbjct: 203 PPGTGDTQLTFSQEIKVDGVVIVSTPQEIALLDVRRGIKMFDKLKVPIIGLVDNMSFF-E 261

Query: 271 SDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQ 330
            D GK Y++FG GG    A      FL  +P ++D+RV +D G P+V  N +   S+I+ 
Sbjct: 262 GDDGKNYNIFGEGGVEKAANDYKKKFLGKIPLNIDLRVAADSGKPLVEINPDHKISKIFI 321

Query: 331 EISDRIQQFFV 341
           EI+ +I++ F+
Sbjct: 322 EIAKKIKESFL 332


>gi|332709011|ref|ZP_08428981.1| ATPase involved in chromosome partitioning [Lyngbya majuscula 3L]
 gi|332352200|gb|EGJ31770.1| ATPase involved in chromosome partitioning [Lyngbya majuscula 3L]
          Length = 354

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 129/339 (38%), Positives = 217/339 (64%), Gaps = 9/339 (2%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
           N ++D L+ +  P  + ++VE+  +  + + + TV  ++ +        + +  + Q+ +
Sbjct: 5   NSVLDVLRPVQDPELQKSLVELNMIRNVKVDNGTVSFTLVLTTPACPLREFIVEDCQKAV 64

Query: 67  QNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +  V+  VV +T    + K+ P +     VK  +A++SGKGGVGKST  VN+A AL  
Sbjct: 65  KQLSGVEEVVVDVTAETPQQKSLPDRTGIEGVKNILAISSGKGGVGKSTVAVNVAVALAQ 124

Query: 123 KGKNVAILDADVYGPSIPKLLKIS-GKVEISDKK---FLKPKENYGIKIMSMASLVDENV 178
            G  V +LDAD+YGP+ P +L ++  KV +   K    ++P  N+G+K++SM  L+D + 
Sbjct: 125 LGAKVGLLDADIYGPNAPAMLGLADAKVMVQKGKQGDVIEPAFNHGVKLVSMGFLIDPDQ 184

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            +IWRGPM+   I   L+ V WG+LD+L++DMPPGTGDA LT+AQ +P++G VIV+TPQ+
Sbjct: 185 PVIWRGPMLNGIIRQFLYQVEWGELDYLIVDMPPGTGDAQLTLAQAVPMAGAVIVTTPQN 244

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPFL 297
           +AL+D +R + M+++M +P++G+IENMSYF+  D   ++YDLFG+GG    ++++GIP L
Sbjct: 245 VALLDSRRGLKMFEQMGVPVLGIIENMSYFIPPDLPDRQYDLFGSGGGEKTSKELGIPLL 304

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P ++ +R   D G+PI V N  SA+++    I+ +I
Sbjct: 305 GCIPLEISLRQGGDQGLPIAVGNPESASAKALVAIASQI 343


>gi|124516112|gb|EAY57620.1| putative ATP binding protein, Mrp like [Leptospirillum rubarum]
          Length = 358

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 127/339 (37%), Positives = 202/339 (59%), Gaps = 4/339 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M QI + ++  +L  +  P  K ++V ++ +  + I    V  +I +          +++
Sbjct: 1   MAQIAEEKVWQALGRVIEPDFKKDLVTLKMIENLKIEDGKVSFTIVLTTPACPLKDEMKN 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNN---LNVKKFVAVASGKGGVGKSTTVVNIA 117
              + ++++P V +  +  T                V+  +AV+SGKGGVGKSTT VN+A
Sbjct: 61  ACNEALRSVPGVTSTEIAFTARTTSGTFSGKAPITGVRNVLAVSSGKGGVGKSTTSVNLA 120

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDEN 177
             L+  G  V ILDADVYGP+IP +L I  + +  + +F+ P  N GI  MSMA LV   
Sbjct: 121 VGLQALGAKVGILDADVYGPNIPMMLGIKTQPKQVENRFIPPSSN-GIACMSMAFLVPPG 179

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
             +IWRGPM+   I   + +V WG+LD+L++DMPPGTGDA L++AQ +PLSG VIV+TPQ
Sbjct: 180 TPLIWRGPMLHGVIQQFVRDVEWGELDYLIVDMPPGTGDAQLSLAQLVPLSGAVIVTTPQ 239

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           +++L D +R ++M+QK+N+PI+G+IENMS F+  +   +  +F  GG    A+++ +PFL
Sbjct: 240 EVSLSDSRRGLAMFQKVNVPILGIIENMSMFVCPNCHHETPIFSQGGGEMAAKELKVPFL 299

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P D+ +R   D G+PI +    S  S+ Y+ I+ +I
Sbjct: 300 GRIPIDLSIREGGDQGVPIGIAQPQSPISKSYETIAGQI 338


>gi|166365156|ref|YP_001657429.1| ATPase [Microcystis aeruginosa NIES-843]
 gi|166087529|dbj|BAG02237.1| MRP protein homolog [Microcystis aeruginosa NIES-843]
          Length = 353

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 125/336 (37%), Positives = 211/336 (62%), Gaps = 8/336 (2%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           I++ L+ +  P  + ++VE+  +  + I    V  ++ +        + +  + Q+ ++ 
Sbjct: 8   ILEVLRPVQDPELQKSLVELNMIRNVAIDGGKVSFTLVLTTPACPLREFIVEDCQKAVKQ 67

Query: 69  IPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKG 124
           +P V++  V +T    + K  P ++    VK  +AV+SGKGGVGKST  VNIA AL + G
Sbjct: 68  LPGVESVAVDVTAETPQQKALPDRQGVEGVKNIIAVSSGKGGVGKSTVAVNIAVALAHLG 127

Query: 125 KNVAILDADVYGPSIPKLLKISGK---VEISDKKFLKPKENYGIKIMSMASLVDENVAMI 181
             V +LDAD+YGP+ P +L ++     V+ ++ + L+P  N+GIK++SM  L++ +  +I
Sbjct: 128 AKVGLLDADIYGPNAPTMLGLNDAQVTVQGANGEILEPAFNHGIKMVSMGFLINPDQPVI 187

Query: 182 WRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLAL 241
           WRGPM+   I   L+ V WG LD+L++DMPPGTGDA LT+ Q +PL+G VIV+TPQ ++L
Sbjct: 188 WRGPMLNGIIRQFLYQVNWGDLDYLIVDMPPGTGDAQLTLIQSVPLAGAVIVTTPQTVSL 247

Query: 242 IDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPFLESV 300
           ID +R + M+Q++   ++G++ENMSYF+  D   + YDLFG+GG    ++++GIP L  V
Sbjct: 248 IDARRGLKMFQQLGARVLGIVENMSYFIPPDQPDRSYDLFGSGGGEKTSQELGIPLLGCV 307

Query: 301 PFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           P ++ +R   D G+P+V+    SA+++    I+ ++
Sbjct: 308 PLEIALREGGDTGVPVVLGQPESASAKALIAIARQV 343


>gi|119510698|ref|ZP_01629826.1| hypothetical protein N9414_22038 [Nodularia spumigena CCY9414]
 gi|119464652|gb|EAW45561.1| hypothetical protein N9414_22038 [Nodularia spumigena CCY9414]
          Length = 356

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 131/340 (38%), Positives = 213/340 (62%), Gaps = 15/340 (4%)

Query: 9   IVDSLKVLSI------PGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           ++DS  VL +      P  + ++VE+  +  + I    V  ++ +        + +  + 
Sbjct: 4   VLDSASVLEVLRPVEDPELRKSLVELNMIRNVKIDAGKVSFTLVLTTPACPLREFIVEDC 63

Query: 63  QQIIQNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
           ++ I  +P V    V +T    + K+ P +     VK  +AV+SGKGGVGKST  VN+A 
Sbjct: 64  KKAINKLPGVTEVSVDVTAETPQQKSLPDRTGITGVKNILAVSSGKGGVGKSTVAVNVAV 123

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGK---VEISDK-KFLKPKENYGIKIMSMASLV 174
           AL   G  V +LDAD+YGP+ P +L ++     V  +DK   L+P  N+G+K++SM  L+
Sbjct: 124 ALAQTGAKVGLLDADIYGPNDPTMLGLADAEIVVRSTDKGDILEPAFNHGVKLVSMGFLI 183

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
           D +  +IWRGPM+   I   L+ V WG+LD+L++DMPPGTGDA LT+ Q +P+SG VIV+
Sbjct: 184 DRDQPVIWRGPMLNGVIRQFLYQVEWGELDYLIVDMPPGTGDAQLTLTQAVPMSGAVIVT 243

Query: 235 TPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIG 293
           TPQ++AL+D ++ + M+Q+MN+P++G++ENMSYF+  D   K+YD+FG+GG    A ++G
Sbjct: 244 TPQNVALLDSRKGLRMFQQMNVPVLGIVENMSYFIPPDMPDKQYDIFGSGGGSKTATELG 303

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           +P L  +P ++  R+  D G+PIVV + +SA+++  + I+
Sbjct: 304 VPLLGCIPLEISTRIGGDSGVPIVVADPDSASAKALKAIA 343


>gi|71734992|ref|YP_273636.1| ATP-binding Mrp/Nbp35 family protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257486636|ref|ZP_05640677.1| ATP-binding Mrp/Nbp35 family protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|71555545|gb|AAZ34756.1| ATP-binding protein, Mrp/Nbp35 family [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320325638|gb|EFW81700.1| ATP-binding Mrp/Nbp35 family protein [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320327079|gb|EFW83093.1| ATP-binding Mrp/Nbp35 family protein [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330876901|gb|EGH11050.1| ATP-binding Mrp/Nbp35 family protein [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330984848|gb|EGH82951.1| ATP-binding Mrp/Nbp35 family protein [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331010116|gb|EGH90172.1| ATP-binding Mrp/Nbp35 family protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 364

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 178/277 (64%), Gaps = 6/277 (2%)

Query: 66  IQNIPTVKNAVVTL----TENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I+N+  V +A V +    + +K   Q     NVK  VAVASGKGGVGKSTT  N+A AL 
Sbjct: 66  IENLDGVSSATVAIKSVISAHKAQSQIPGLANVKNIVAVASGKGGVGKSTTAANLALALS 125

Query: 122 NKGKNVAILDADVYGPSIPKLLKIS--GKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
            +G  V ILDAD+YGPS   +  I+   + +I D+K+  P + +GI +MSMA L D+N  
Sbjct: 126 REGARVGILDADIYGPSQGVMFGIAEGTRPKIKDQKWFVPVQAHGIDVMSMAFLTDDNTP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TPQDL
Sbjct: 186 MVWRGPMVSGALLQLVTQTAWNDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTPQDL 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A +  +  L S
Sbjct: 246 ALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLASQYNVELLAS 305

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P  M +R  +D G P  +    S  + +YQE++  +
Sbjct: 306 LPLSMLIREQADGGKPTAIAEPESQIAMVYQELARHV 342


>gi|330793000|ref|XP_003284574.1| Mrp/NBP35 family protein [Dictyostelium purpureum]
 gi|325085488|gb|EGC38894.1| Mrp/NBP35 family protein [Dictyostelium purpureum]
          Length = 341

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 127/282 (45%), Positives = 190/282 (67%), Gaps = 6/282 (2%)

Query: 61  NAQQIIQNIPTVKN---AVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVVNI 116
           N  +I   I T K        L ++K+P   + ++  +K  +AV+S KGGVGKST+ VN+
Sbjct: 34  NNNKIATPITTTKRYYFKTTCLQKHKHPHVAKVSIEGIKHIIAVSSAKGGVGKSTSAVNL 93

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVE--ISDKKFLKPKENYGIKIMSMASLV 174
           A  L ++  +V +LDADV+GPSIP ++ + G+ +  ++D   + P  NYGIK MSM  LV
Sbjct: 94  ALGLSSQDLSVGLLDADVFGPSIPLMMDLKGQEKPLVNDNNQMVPLINYGIKCMSMGFLV 153

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
           DE+ A++WRGPMV SA+  +L    WG LD L++D+PPGTGDA LT+ Q++PLSG VI+S
Sbjct: 154 DEDDAIVWRGPMVMSALEKLLRQTNWGLLDVLVVDLPPGTGDAILTMCQRVPLSGAVIIS 213

Query: 235 TPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGI 294
           TPQD+AL DV R ++M++K+N+PI+G++ENMS+F      +   +FG+ GA+  A+K+GI
Sbjct: 214 TPQDVALADVVRGVNMFKKVNVPILGLVENMSHFNCPHCHESTHIFGSEGAKKTAQKMGI 273

Query: 295 PFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            FL  +P  +++R  SD G PI +   NS  ++IY++IS  I
Sbjct: 274 NFLGDIPIHLEIRETSDSGKPITITQPNSPQAKIYKDISKEI 315


>gi|255071951|ref|XP_002499650.1| hypothetical protein MICPUN_107712 [Micromonas sp. RCC299]
 gi|226514912|gb|ACO60908.1| hypothetical protein MICPUN_107712 [Micromonas sp. RCC299]
          Length = 301

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 120/257 (46%), Positives = 170/257 (66%), Gaps = 4/257 (1%)

Query: 83  KNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNK-GKNVAILDADVYGPSIPK 141
           K PP   +   V++ +AVASGKGGVGKSTT VN+ACA        V +LDADV+GPS+P 
Sbjct: 35  KQPPVPESLRGVQRIIAVASGKGGVGKSTTAVNLACATARALNLRVGLLDADVFGPSVPI 94

Query: 142 LLKIS--GKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVV 199
           L+ ++  G   I ++K + P ENYG+K MSM  L+ E  A +WRGPMV  A+  M+ +  
Sbjct: 95  LMNLAEAGMPAIDERKRMLPLENYGVKCMSMGFLIPEERAAVWRGPMVMGALGKMVRDTA 154

Query: 200 WGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPII 259
           W  LD L +DMPPGTGDA ++I+Q+IPL+G VIVSTPQ++AL DV+R ++MY K+  PI+
Sbjct: 155 WAPLDVLFVDMPPGTGDAQISISQQIPLTGAVIVSTPQEIALADVRRGVNMYTKVAAPIL 214

Query: 260 GMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVH 319
           G +ENM++F+ +D G+K  +FG GG R  AE+ G+  L  VP D  +   SD G P+ V 
Sbjct: 215 GFVENMAHFVDAD-GRKVYVFGQGGVRRTAEEHGVELLGEVPLDPSIGTSSDAGRPVAVS 273

Query: 320 NMNSATSEIYQEISDRI 336
             +     +Y+ ++ R+
Sbjct: 274 APDGGAGRLYEAMARRL 290


>gi|32267004|ref|NP_861036.1| putative ATP/GTP-binding protein [Helicobacter hepaticus ATCC
           51449]
 gi|32263056|gb|AAP78102.1| putative ATP/GTP-binding protein [Helicobacter hepaticus ATCC
           51449]
          Length = 367

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 208/345 (60%), Gaps = 13/345 (3%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           + QI + L  +  P    +IV    L E+ +  N V + I +P +    ++ LR    Q 
Sbjct: 5   QEQITEILSSVIYPNFSKDIVSFGFLKEVKVSDNEVRVRIDIPSSSQEIIEKLRQEISQK 64

Query: 66  IQNIPTVKNAVVTLTENKNPPQQ-----RNNL--NVKKFVAVASGKGGVGKSTTVVNIAC 118
           ++++  ++ A + L  N   P         NL  ++K FV V+SGKGGVGKST+ VN+A 
Sbjct: 65  LESV--LQGATLHLEINSPKPAPQPQPKTKNLAPHIKHFVMVSSGKGGVGKSTSSVNLAI 122

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISG---KVEISDKKFLKPKENYGIKIMSMASLVD 175
           AL  +GK V +LDAD+YGP+IP++L ++    +V+ S KK + P + +G+++MSM  L D
Sbjct: 123 ALAQQGKKVGLLDADIYGPNIPRMLGLNANKAQVDESQKKLI-PLKAFGVEMMSMGVLYD 181

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
           E  ++IWRGPM+  AI  ML +V+W  LD L+IDMPPGTGDA LT+AQ +P+S  VIV+T
Sbjct: 182 EGQSLIWRGPMIMRAIEQMLTDVIWSNLDVLVIDMPPGTGDAQLTLAQSVPVSAGVIVTT 241

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQ ++L D  R++ M+ K+ +PI G+IENMS F+  D GK+YD+FG G +   A +    
Sbjct: 242 PQKVSLDDSARSLDMFDKLKVPIAGIIENMSGFICPDCGKEYDIFGKGTSEVLANEYSTH 301

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
            L  VP +  VR   D G PI     +S +++ Y + + +I  F 
Sbjct: 302 ILAQVPLEPKVREGGDSGKPIAFFEPDSQSAKAYMQAAAKILNFL 346


>gi|225437266|ref|XP_002282449.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297735519|emb|CBI17959.3| unnamed protein product [Vitis vinifera]
          Length = 341

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 176/245 (71%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVEI 151
            VK  VA+ASGKGGVGKSTT VN+A AL  K +  V +LDADVYGPS+P ++ + G+ E+
Sbjct: 79  GVKNIVAIASGKGGVGKSTTAVNLAVALAKKCQLKVGVLDADVYGPSVPTMMNLHGEPEV 138

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           ++ + + P +NYG+K MS+  LV ++  ++WRGPMV SA+  +   V WG LD L++DMP
Sbjct: 139 TEDRKIVPFQNYGVKCMSIGFLVPKDSPLVWRGPMVASALEKLSRGVDWGNLDILVVDMP 198

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  +TI+Q++ L+GV+IV+TPQD+ALID +R ++M+ K+ +PI+G+IENMS F   
Sbjct: 199 PGTGDTQITISQRLQLTGVLIVTTPQDVALIDARRGVTMFSKVEVPILGIIENMSCFKCP 258

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
           + G    +FGNGGAR  A+++ + +L  +P ++D+   SD G+P+VV   +S  ++ Y +
Sbjct: 259 NCGHPSYIFGNGGARKTADEMCLDYLGEIPLEVDIVKASDEGVPLVVSAPDSTVTKGYND 318

Query: 332 ISDRI 336
           ++ ++
Sbjct: 319 LAQKL 323


>gi|147777913|emb|CAN75726.1| hypothetical protein VITISV_031406 [Vitis vinifera]
          Length = 341

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 176/245 (71%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVEI 151
            VK  VA+ASGKGGVGKSTT VN+A AL  K +  V +LDADVYGPS+P ++ + G+ E+
Sbjct: 79  GVKNIVAIASGKGGVGKSTTAVNLAVALAKKCQLKVGVLDADVYGPSVPTMMNLHGEPEV 138

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           ++ + + P +NYG+K MS+  LV ++  ++WRGPMV SA+  +   V WG LD L++DMP
Sbjct: 139 TEDRKIVPFQNYGVKCMSIGFLVPKDSPLVWRGPMVASALEKLSRGVDWGNLDILVVDMP 198

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  +TI+Q++ L+GV+IV+TPQD+ALID +R ++M+ K+ +PI+G+IENMS F   
Sbjct: 199 PGTGDTQITISQRLQLTGVLIVTTPQDVALIDARRGVTMFSKVEVPILGIIENMSCFKCP 258

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
           + G    +FGNGGAR  A+++ + +L  +P ++D+   SD G+P+VV   +S  ++ Y +
Sbjct: 259 NCGHPSYIFGNGGARKTADEMCLDYLGEIPLEVDIVKASDEGVPLVVSAPDSTVTKGYND 318

Query: 332 ISDRI 336
           ++ ++
Sbjct: 319 LAQKL 323


>gi|239817044|ref|YP_002945954.1| hypothetical protein Vapar_4075 [Variovorax paradoxus S110]
 gi|239803621|gb|ACS20688.1| protein of unknown function DUF59 [Variovorax paradoxus S110]
          Length = 363

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 129/332 (38%), Positives = 208/332 (62%), Gaps = 4/332 (1%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           ++D+LK ++ P    N V  + L  + I    V   + + +    Q  ++R       + 
Sbjct: 8   LMDALKAVADPNTGKNFVATRSLKNLQIADGDVSFDLELGYPAKSQHAAMRKALVAAAKT 67

Query: 69  IPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKG 124
           +P V N  V +T     +  Q+   L  NVK  +AVASGKGGVGKSTT  N+A AL  +G
Sbjct: 68  VPGVSNVSVNITTKVISHAVQRGVQLMPNVKNIIAVASGKGGVGKSTTAANLALALAAEG 127

Query: 125 KNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRG 184
             V +LDAD+YGPS P +L I G+ E  D K ++P EN+G+++MS+  LVD++ AMIWRG
Sbjct: 128 AAVGLLDADIYGPSQPMMLGIEGRPESEDGKTMEPLENHGVQVMSIGFLVDQDEAMIWRG 187

Query: 185 PMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDV 244
           PM   A+  +L    W  LD+L++DMPPGTGD  LT++Q++P++G VIV+TPQD+AL+D 
Sbjct: 188 PMATQALEQLLRQTNWKDLDYLIVDMPPGTGDIQLTLSQRVPMTGAVIVTTPQDIALLDA 247

Query: 245 KRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDM 304
           K+ I M++K+ +PI+G++ENM+  + S+ G    +FG+ G +  A +  + +L ++P D+
Sbjct: 248 KKGIKMFEKVGVPILGIVENMAVHICSNCGHVEHIFGSEGGKKMAAQYQMDYLGALPLDI 307

Query: 305 DVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           ++R+ +D G P VV + +   + IY+ ++ ++
Sbjct: 308 NIRLQADSGKPTVVADPDGEVAGIYKAVARQV 339


>gi|288940933|ref|YP_003443173.1| ATPase-like, ParA/MinD [Allochromatium vinosum DSM 180]
 gi|288896305|gb|ADC62141.1| ATPase-like, ParA/MinD [Allochromatium vinosum DSM 180]
          Length = 363

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 129/339 (38%), Positives = 207/339 (61%), Gaps = 4/339 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+Q  K+ I  ++K    P    ++V    + +I I  + V + + +        Q++  
Sbjct: 1   MSQPTKDAIESAIKEYREPHLGRDLVAAHAIQDIAIEGDQVRIKVVLGFPAKGIQQTIAE 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNI 116
              + +  +  V    V ++        + +L    NVK  +AVASGKGGVGKSTT VN+
Sbjct: 61  ALTERVSKVDGVGAVAVDVSWEIKAHSVQKSLKPIDNVKNIIAVASGKGGVGKSTTAVNL 120

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           A AL  +G  V +LDAD+YGPS P++L ISG+ E  D + L+P  ++ I+ MS+  L++E
Sbjct: 121 ALALAAEGAKVGLLDADIYGPSQPRMLGISGQPESKDGRTLEPMVSHDIQTMSIGFLIEE 180

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              MIWRGPMV  A+  +L++  W  LD+L+ID+PPGTGD  LT+AQK+P+SG +IV+TP
Sbjct: 181 ETPMIWRGPMVTQALEQLLNDTNWSDLDYLVIDLPPGTGDTQLTLAQKVPVSGAIIVTTP 240

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QD+AL+D ++ + M+QK+ +P++G++ENMS  + S  G +  +FG GG +  +++ GI  
Sbjct: 241 QDIALLDARKGLKMFQKVEVPVLGIVENMSIHICSKCGHEEHIFGQGGGQSMSDQYGIDL 300

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
           L ++P D+ +R  +D G P V     S  ++IY+EI+ +
Sbjct: 301 LGALPLDIQIRQETDGGKPTVAAQPESRITQIYREIARK 339


>gi|283953780|ref|ZP_06371311.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni 414]
 gi|283794821|gb|EFC33559.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni 414]
          Length = 368

 Score =  251 bits (642), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 137/343 (39%), Positives = 210/343 (61%), Gaps = 10/343 (2%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +K QI++ LK +  PG + +IV    + +I I  N V + I +          +R N  +
Sbjct: 1   MKEQILEKLKTVKYPGFEKDIVSFNFVKDIKIQDNGVLIDIEIVSANPEVANEIRKNVNE 60

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKSTTVVNIA 117
            + ++  +KN  + +   K P ++ N+ +       VK F+ V+SGKGGVGKSTT VN+A
Sbjct: 61  ALSSL-ALKNIELNIIVPKIPEEKSNSRSGKNIAPQVKNFIMVSSGKGGVGKSTTTVNLA 119

Query: 118 CALKNKGKNVAILDADVYGPSIPKLL-KISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
            ++   GK V ILDAD+YGP+IP++L +   + E+  ++ LKP  ++G+ +MSM  L++E
Sbjct: 120 ISMAKMGKRVGILDADIYGPNIPRMLGETKTQPEVVGQR-LKPILSHGVYMMSMGVLIEE 178

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              ++WRG M+  AI  +L +V+W +LD L +DMPPGTGDA +T AQ IP++  V VSTP
Sbjct: 179 GQGLMWRGAMIMKAIEQLLADVIWPELDVLFLDMPPGTGDAQITSAQSIPITAGVCVSTP 238

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++L D KRA+ M+ K++IPI G+IENMS FL  D GK+YD+FG G A   AE      
Sbjct: 239 QTVSLDDSKRALDMFNKLHIPIAGVIENMSGFLCPDNGKEYDIFGKGTALAMAEAYKSEV 298

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
           L  +P +M VR  +D G P+  ++  S +S+ Y   +++I  F
Sbjct: 299 LAQIPIEMIVREGADEGKPVSFYHPESVSSKRYLMAAEKIWNF 341


>gi|218439996|ref|YP_002378325.1| hypothetical protein PCC7424_3055 [Cyanothece sp. PCC 7424]
 gi|218172724|gb|ACK71457.1| protein of unknown function DUF59 [Cyanothece sp. PCC 7424]
          Length = 353

 Score =  251 bits (642), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 125/338 (36%), Positives = 211/338 (62%), Gaps = 11/338 (3%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           +++ L+ +  P  + ++V++  +  + I   TV  ++ +        + +  + Q+ ++ 
Sbjct: 7   VLEVLRPVQDPELQKSLVDLNMIRNVKIDAGTVSFTLVLTTPACPLREFIVEDCQKAVKQ 66

Query: 69  IPTVKNAVVTLTEN----KNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKG 124
           +P V+   V +T      K+ P +++   +K  +A++SGKGGVGKST  VN+A AL   G
Sbjct: 67  LPGVEKVDVDVTAETPTQKSLPNKQSVEGIKNIIAISSGKGGVGKSTIAVNVAVALAQAG 126

Query: 125 KNVAILDADVYGPSIPKLLKISGKVEI-----SDKKFLKPKENYGIKIMSMASLVDENVA 179
             V +LDAD+YGP+ P +L ++ + EI     ++ + L+P  N+G+K++SM  L+D +  
Sbjct: 127 AKVGLLDADIYGPNTPTMLGLT-QAEIQVKQGTNGEILEPAFNHGVKMVSMGFLIDPDQP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           +IWRGPM+   I   L+ V WG LD+L++DMPPGTGDA LT+AQ +PL+G VIV+TPQ +
Sbjct: 186 VIWRGPMLNGIIRQFLYQVNWGNLDYLVVDMPPGTGDAQLTLAQAVPLAGAVIVTTPQTV 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPFLE 298
           +L D +R + M+Q++ + ++G++ENMSYFL  D   + YDLFG+GG    + ++ +P L 
Sbjct: 246 SLQDARRGLKMFQQLGVNVLGIVENMSYFLPPDMPDRSYDLFGSGGGEKASSELQVPLLG 305

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            VP ++ +R   D GIPIVV    SA+++    I+ +I
Sbjct: 306 CVPLEISLRQGGDAGIPIVVGEPESASAKALTAITQQI 343


>gi|262402618|ref|ZP_06079179.1| Mrp protein [Vibrio sp. RC586]
 gi|262351400|gb|EEZ00533.1| Mrp protein [Vibrio sp. RC586]
          Length = 365

 Score =  251 bits (642), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 166/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K  +
Sbjct: 100 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGAKVGLLDADIYGPSVPLMLGKTKAKPVV 159

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 160 RDNKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 219

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G +IV+TPQDLAL D ++  +M+ K+++P+IG++ENMSY + S
Sbjct: 220 PGTGDIQLTLAQQIPVTGAIIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICS 279

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +++R  +D GIP VV    S  ++ Y E
Sbjct: 280 HCGEKEHIFGEGGAQTLAAEFGLSLLAQIPLHIEMREDTDAGIPTVVARPRSEHTQRYLE 339

Query: 332 ISDRI 336
           ++ R+
Sbjct: 340 LAQRV 344


>gi|284052970|ref|ZP_06383180.1| hypothetical protein AplaP_15993 [Arthrospira platensis str.
           Paraca]
 gi|291567256|dbj|BAI89528.1| mrp protein homolog [Arthrospira platensis NIES-39]
          Length = 356

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 126/348 (36%), Positives = 224/348 (64%), Gaps = 13/348 (3%)

Query: 2   NQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSN 61
           +++  + +++ L+ +  P  + ++VE+  +  + I    V  ++ +        + +  +
Sbjct: 3   DKLDASSVLEVLRPVQDPELQKSLVELNMIRNVEITGGDVRFTLVLTTPACPLREFIVED 62

Query: 62  AQQIIQNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIA 117
            Q+ ++ +P V+   V +T    + K+ P ++    VK   A++SGKGGVGKST  VN+A
Sbjct: 63  CQKAVKQLPGVETVEVDVTAETPQQKSLPDRQGISGVKNIFAISSGKGGVGKSTVAVNVA 122

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKV----EISDKKFLKPKENYGIKIMSMASL 173
            AL + G  V ++DAD+YGP+ P +L ++       +  +   L+P  NYG+K++SMA L
Sbjct: 123 VALASTGAKVGLIDADIYGPNDPTMLGLADTQVMVQQTPEGDRLEPAFNYGVKLVSMAFL 182

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           +D +  +IWRGPM+   I   L+ V WG+LD+L++DMPPGTGDA LT+AQ +P+SG VIV
Sbjct: 183 IDRDQPVIWRGPMLNGIIRQFLYQVYWGELDYLIVDMPPGTGDAQLTLAQAVPMSGAVIV 242

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKI 292
           +TPQ+++L+D ++ + M++++ + I+G++ENMSYF+  D   +KYD+FG+GG +  A+++
Sbjct: 243 TTPQEVSLLDSRKGLKMFEQLGVSILGIVENMSYFVPPDLPDRKYDIFGSGGGQKTADEL 302

Query: 293 GIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSE----IYQEISDRI 336
           G+P L ++P +M VR   D G+PIV+ + +SA+++    I Q+I+ R+
Sbjct: 303 GVPLLGAIPLEMPVRQGGDSGVPIVISHPDSASAQELTAIAQKIAARV 350


>gi|158334619|ref|YP_001515791.1| chromosome partitioning ATPase [Acaryochloris marina MBIC11017]
 gi|158304860|gb|ABW26477.1| ATPase involved in chromosome partitioning [Acaryochloris marina
           MBIC11017]
          Length = 357

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 221/340 (65%), Gaps = 14/340 (4%)

Query: 8   QIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHN--TVYLSITVPHTIAHQLQSLRSNAQQI 65
           +I++ L+ +  P  + ++V++  +  + + +   T  L +T P     ++  +  + ++ 
Sbjct: 11  KILEVLQPVQDPELQKSLVDLNMIRNVKVENGIATFTLVLTTPACPLKEM--IVDDCKKA 68

Query: 66  IQNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           +Q +P +++  V +T    + K+ P +     VK  +AV+SGKGGVGKST  VNIA AL 
Sbjct: 69  VQALPGIESVEVEVTAETPQQKSVPDRTGVPGVKNIIAVSSGKGGVGKSTVAVNIAAALA 128

Query: 122 NKGKNVAILDADVYGPSIPKLLKISGKV----EISDKKFLKPKENYGIKIMSMASLVDEN 177
             G +V ++DAD+YGP++P +L +   V    + +    ++P    GIK++SM  L+D++
Sbjct: 129 QSGASVGMIDADIYGPNVPTMLGLEDAVVEVRKEAQGDVMEPAIAQGIKLVSMGFLIDKD 188

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
             +IWRGPM+   I   L+ V WG LD+L+ID+PPGTGDA LT+AQ +P++GVVIVSTPQ
Sbjct: 189 QPVIWRGPMLNGIIRQFLYQVDWGTLDYLIIDLPPGTGDAQLTLAQAVPMAGVVIVSTPQ 248

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGK-KYDLFGNGGARFEAEKIGIPF 296
           ++AL+D ++ + M+Q++ +P++G++ENMSYF+  D  + +YD+FG+GG    ++++G+P 
Sbjct: 249 NVALLDARKGLKMFQQLGVPVLGVVENMSYFIPPDRPETQYDIFGSGGGEKISKELGVPL 308

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +  VP ++ VR   D G PIV+ N +SA+++ +Q+I+  +
Sbjct: 309 IGCVPLEIPVREGGDQGKPIVL-NGSSASAQAFQKIATEV 347


>gi|300722470|ref|YP_003711758.1| putative ATP-binding protein with nucleotide triphosphate hydrolase
           domain [Xenorhabdus nematophila ATCC 19061]
 gi|297628975|emb|CBJ89560.1| putative ATP-binding protein with nucleotide triphosphate hydrolase
           domain [Xenorhabdus nematophila ATCC 19061]
          Length = 370

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 131/338 (38%), Positives = 197/338 (58%), Gaps = 5/338 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           +LK  +   L     P  + +++ ++ L    I+   ++L   +P       + L+    
Sbjct: 13  LLKEHVAKILATFKHPTLERDLMALKALHHCTILDGVLHLEFIMPFVWKRAFEVLKEETT 72

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIACA 119
           Q +Q     K+    L  + +  ++ NNL     V+  VAV+SGKGGVGKS+T VN+A A
Sbjct: 73  QALQAATGAKSVEWRLNHDISTLRRANNLPGVNGVRNIVAVSSGKGGVGKSSTAVNVALA 132

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENV 178
           L  +G  V ILDAD+YGPSIP +L  + +   S D + + P   +GI   S+  LV ++ 
Sbjct: 133 LAQEGAKVGILDADIYGPSIPNMLGTTKERPTSPDGQHMAPIMVHGIATNSIGYLVTDDN 192

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
           AM+WRGPM   A+M ML + +W  LD+L+IDMPPGTGD  LT++Q IP++G ++V+TPQD
Sbjct: 193 AMVWRGPMASKALMQMLQDTLWPDLDYLVIDMPPGTGDIQLTLSQNIPVTGALVVTTPQD 252

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +ALID  + I M+QK+N+P++G+IENMS  + S  G    +FG GGA   AEK     L 
Sbjct: 253 IALIDAMKGIVMFQKVNVPVLGIIENMSTHICSHCGHHEPIFGTGGAEKLAEKYSCRLLG 312

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +P  + +R   D G P V    +S  ++IY+EI+  I
Sbjct: 313 QIPLHISLREDLDRGEPTVSRQPDSEFADIYREIAANI 350


>gi|307728929|ref|YP_003906153.1| ATPase-like, ParA/MinD [Burkholderia sp. CCGE1003]
 gi|307583464|gb|ADN56862.1| ATPase-like, ParA/MinD [Burkholderia sp. CCGE1003]
          Length = 362

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 197/307 (64%), Gaps = 4/307 (1%)

Query: 34  IFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTEN--KNPPQQRNN 91
           + +  +TV +++ V +    +  ++R      ++ +P V    V +++    +  Q+   
Sbjct: 33  VAVEGDTVSVAVVVGYPAMREFDAIRKQFDDALRAVPGVAQTRVQVSQEIAAHTVQRGVK 92

Query: 92  L--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV 149
           L  NVK  VAVASGKGGVGKSTT VN+A AL ++G +V ILDAD+YGPS+P +L I G+ 
Sbjct: 93  LLPNVKNIVAVASGKGGVGKSTTAVNLALALASEGASVGILDADIYGPSLPLMLGIEGRP 152

Query: 150 EISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID 209
           E  D+K + P   +G++  S+  L++++  M+WRGPM  SA+  +L    W  LD+L++D
Sbjct: 153 ESPDEKTMNPMTGHGLQANSIGFLIEQDNPMVWRGPMATSALEQLLRQTNWRDLDYLIVD 212

Query: 210 MPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFL 269
           MPPGTGD  LT++Q++P++G VIV+TPQD+AL+D ++ + M++K+ IPI+G++ENM+  +
Sbjct: 213 MPPGTGDIQLTLSQRVPVTGAVIVTTPQDIALLDARKGLKMFEKVGIPILGIVENMAIHI 272

Query: 270 ASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
            S+ G +  +FG GG     ++ G+  L S+P D+ +R  +D G P VV +     ++ Y
Sbjct: 273 CSNCGHEEHIFGAGGGERMGKEYGVDLLGSLPLDIAIREQADSGRPTVVADPQGRIAQTY 332

Query: 330 QEISDRI 336
           + I+ ++
Sbjct: 333 RAIARKV 339


>gi|291333735|gb|ADD93421.1| conserved domain protein [uncultured marine bacterium
           MedDCM-OCT-S04-C103]
          Length = 361

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 139/350 (39%), Positives = 208/350 (59%), Gaps = 29/350 (8%)

Query: 13  LKVLSIPGEKNNIVEMQRLSEIFIV--HNTVYLSI-----TVPHTIAHQLQSLRSNAQQI 65
           L+ +  PG   +IV    +SE  ++  H  V + I     T+P+T+ H++++       +
Sbjct: 15  LQKVKYPGYTRDIVSFGLISEASLIQGHAKVKVEIGGSDSTLPNTLKHEIET-------V 67

Query: 66  IQNIPTVKNAVVTLTENKNPPQQ--------RNNL-NVKKFVAVASGKGGVGKSTTVVNI 116
           ++  P+V +  V +   K+   Q        +N L  +K+ +A+ASGKGGVGKST   N+
Sbjct: 68  LEAEPSVTSHEVRVIFKKDNEGQSSQEADNGKNTLAGIKRIIAIASGKGGVGKSTITANL 127

Query: 117 ACALK----NKGK--NVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSM 170
           A AL     ++G+   + ++D D+YGPSIP  L IS +    ++  L P EN+GIK+MSM
Sbjct: 128 ASALSKINNDQGEPLTIGVMDCDLYGPSIPLQLGISEQPTALEENLLSPVENHGIKVMSM 187

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGV 230
             LVDE   ++WRGPMV   I     NV WG+LD+LL+D+PPGTGDA L++AQ +PL GV
Sbjct: 188 GLLVDEETPVVWRGPMVMKTIQQFAANVDWGELDYLLVDLPPGTGDAQLSLAQILPLDGV 247

Query: 231 VIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAE 290
           VIV+TPQ  A+   +R   M+ K+N+PI+G+IENMS+    +TG+K  LFG GG    A+
Sbjct: 248 VIVTTPQKAAVEVARRGAMMFPKVNVPILGVIENMSFLQDQETGEKRFLFGQGGGPLTAK 307

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
            +   FL  VP D ++R+  D GIPI+  + +SA S  + EI+  I    
Sbjct: 308 NLETVFLGEVPLDEEIRLGGDHGIPIIFGHPDSAASAAFTEIAGEISSLL 357


>gi|330966552|gb|EGH66812.1| ParA family protein [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 364

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/274 (44%), Positives = 179/274 (65%), Gaps = 6/274 (2%)

Query: 66  IQNIPTVKNAVVTL----TENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I+N+  V +A V++    + +K   Q     NVK  VAVASGKGGVGKSTT  N+A AL 
Sbjct: 66  IENLDGVGSATVSIKSVISAHKAQSQIPGLANVKNIVAVASGKGGVGKSTTAANLALALS 125

Query: 122 NKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
            +G  V ILDAD+YGPS   +  I    + +I ++K+  P E +GI++MSMA L D+N  
Sbjct: 126 REGARVGILDADIYGPSQGVMFGIPEGTRPKIKEQKWFVPIEAHGIEVMSMAFLTDDNTP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TPQDL
Sbjct: 186 MVWRGPMVSGALLQLVTQTAWNDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTPQDL 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A +  +  L S
Sbjct: 246 ALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLASQYDVELLAS 305

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           +P  M +R  +D G P  +   +S  + +YQE++
Sbjct: 306 LPLSMLIREQADGGKPTAIAEPDSQIAMVYQELA 339


>gi|330877325|gb|EGH11474.1| ParA family protein [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 364

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/274 (44%), Positives = 179/274 (65%), Gaps = 6/274 (2%)

Query: 66  IQNIPTVKNAVVTL----TENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I+N+  V +A V++    + +K   Q     NVK  VAVASGKGGVGKSTT  N+A AL 
Sbjct: 66  IENLDGVGSATVSIKSVISAHKAQSQIPGLANVKNIVAVASGKGGVGKSTTAANLALALS 125

Query: 122 NKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
            +G  V ILDAD+YGPS   +  I    + +I ++K+  P E +GI++MSMA L D+N  
Sbjct: 126 REGARVGILDADIYGPSQGVMFGIPEGTRPKIKEQKWFVPIEAHGIEVMSMAFLTDDNTP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TPQDL
Sbjct: 186 MVWRGPMVSGALLQLVTQTAWNDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTPQDL 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A +  +  L S
Sbjct: 246 ALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLASQYDVELLAS 305

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           +P  M +R  +D G P  +   +S  + +YQE++
Sbjct: 306 LPLSMLIREQADGGKPTAIAEPDSQIAMVYQELA 339


>gi|240851487|ref|ZP_04752238.1| Mrp-like protein, ATP-binding protein [Actinobacillus minor 202]
 gi|240310005|gb|EER48297.1| Mrp-like protein, ATP-binding protein [Actinobacillus minor 202]
          Length = 365

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 135/344 (39%), Positives = 206/344 (59%), Gaps = 8/344 (2%)

Query: 1   MNQILK---NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS 57
           MNQ+ +   N+I   L+  S P  K +++ +  L +  +    + + +T+P       ++
Sbjct: 1   MNQLTEQQLNEIKFVLQNFSHPTLKKDLIALNALKKAELGAGILRIELTMPFAWNSGFEA 60

Query: 58  LRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTV 113
           L++  ++ ++ I         L  N    ++ NN      VK  +AV SGKGGVGKSTT 
Sbjct: 61  LKATTEEKLKEITAASGVKWVLNYNIATLKRANNHPAVNGVKNIIAVTSGKGGVGKSTTS 120

Query: 114 VNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMAS 172
           VN+A ALK +G  V ILDAD+YGPSIP +L    +   S D K + P E YGI+  S+  
Sbjct: 121 VNLALALKAQGARVGILDADIYGPSIPHMLGAKDQRPTSPDNKHITPVEVYGIQSNSIGY 180

Query: 173 LVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVI 232
           L+ E+ A IWRGPM  SA+  +L+   W +LD+L+IDMPPGTGD  LT++Q+IP++G V+
Sbjct: 181 LMSEDSATIWRGPMASSALSQLLNETWWNELDYLVIDMPPGTGDIQLTLSQQIPVTGAVV 240

Query: 233 VSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKI 292
           V+TPQD+AL+D  + ISM+QK+++P++G+IENMS  +  + G   D+FG GGA   A+K 
Sbjct: 241 VTTPQDIALLDAVKGISMFQKVSVPVLGVIENMSVHICQNCGHHEDIFGTGGAEKIAKKY 300

Query: 293 GIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           G   L  +P  + +R   D G+P V       TS+ Y E++ ++
Sbjct: 301 GTQVLGQLPLHIRLREDLDNGMPTVEAAPEHETSQAYLELAAKV 344


>gi|330957739|gb|EGH57999.1| ATP-binding Mrp/Nbp35 family protein [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 364

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 178/277 (64%), Gaps = 6/277 (2%)

Query: 66  IQNIPTVKNAVVTLTE----NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I+N+  V +A V ++     +K   Q     NVK  VAVASGKGGVGKSTT  N+A AL 
Sbjct: 66  IENLDGVASARVDISSVIVAHKAQSQIPGLANVKNIVAVASGKGGVGKSTTAANLALALS 125

Query: 122 NKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
            +G  V ILDAD+YGPS   +  I    + +I D+K+  P E +GI +MSMA L D+N  
Sbjct: 126 REGARVGILDADIYGPSQGVMFGIPEGTRPKIKDQKWFVPIEAHGIDVMSMAFLTDDNTP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TPQDL
Sbjct: 186 MVWRGPMVSGALLQLVTQTAWNDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTPQDL 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A +  +  L S
Sbjct: 246 ALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLASQYNVELLAS 305

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P  M +R  +D G P  +   +S  + +YQE++  +
Sbjct: 306 LPLSMLIREQADGGKPTAIAEPDSQIAMVYQELARHV 342


>gi|255559965|ref|XP_002521001.1| Protein mrp, putative [Ricinus communis]
 gi|223539838|gb|EEF41418.1| Protein mrp, putative [Ricinus communis]
          Length = 293

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 120/245 (48%), Positives = 167/245 (68%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVEI 151
            VK  +AVASGKGGVGKSTT VN+A AL  K +  V +LDADVYGPSIP +++I  K ++
Sbjct: 30  GVKDVIAVASGKGGVGKSTTAVNLAVALATKCQLKVGLLDADVYGPSIPTMMRIDRKPDV 89

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           +    + P ENYG+K MS+  LV+++  ++WRGPMV SA+  ML  V WG LD L++DMP
Sbjct: 90  TADTKMIPIENYGVKCMSIGFLVEKDAPIVWRGPMVMSALEKMLRGVDWGNLDILVVDMP 149

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA LT++Q + LSG +IVSTPQD+ALID +R + M+ K+ +PI+G IENMS F   
Sbjct: 150 PGTGDAQLTVSQNLQLSGALIVSTPQDVALIDARRGVKMFSKVQVPILGFIENMSCFKCP 209

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+   +FG GG R  A  +G  F+  +P ++++R  SD GIPI +   +S  S+ Y  
Sbjct: 210 HCGEPSYIFGEGGTRKTAASMGYNFIGEIPLEVEIRKSSDEGIPITISLPDSVVSKAYSG 269

Query: 332 ISDRI 336
            ++ +
Sbjct: 270 AAENV 274


>gi|86605268|ref|YP_474031.1| CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein
           [Synechococcus sp. JA-3-3Ab]
 gi|86553810|gb|ABC98768.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein
           [Synechococcus sp. JA-3-3Ab]
          Length = 360

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 121/335 (36%), Positives = 211/335 (62%), Gaps = 10/335 (2%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           I+++L+ +  P  + ++VE+  + +I +    V  ++ +        + +    +  I+ 
Sbjct: 11  ILEALRPVQDPELRRSLVELNMIRDIRVEPKRVAFTLVLTTPACPLREFIVDECKAAIRR 70

Query: 69  IPTVKNAVVTLTEN--KNP--PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKG 124
           +  V+   VT+T    ++P  P +++   V+  +A++SGKGGVGK++  VN+A AL   G
Sbjct: 71  LAPVEAIDVTVTAETPRSPSLPDRQSVPGVRNIIAISSGKGGVGKTSVSVNVAVALAQSG 130

Query: 125 KNVAILDADVYGPSIPKLLKISGKVEISDKKF-----LKPKENYGIKIMSMASLVDENVA 179
             V +LDAD+YGP++P +L +  +  +  K+      + P ENYG+K++SM  LV  +  
Sbjct: 131 ARVGLLDADIYGPNVPLMLGLQDRSLLVRKREDGGEDIFPLENYGVKMVSMGLLVGRDQP 190

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           +IWRGPM+   I   L+ V WG+LD+L++DMPPGTGDA LT+ Q +PL+G VIV+TPQ +
Sbjct: 191 VIWRGPMLNGVIRQFLYQVQWGELDYLIVDMPPGTGDAQLTLVQAVPLAGAVIVTTPQSV 250

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPFLE 298
           AL+D ++ ++M++++ +PI+G++ENMSYF+  D   ++YD+FG+ G    A ++G+P L 
Sbjct: 251 ALLDSRKGLNMFRQLGVPILGIVENMSYFIPPDLPDRQYDIFGSAGGETTARELGVPLLG 310

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
            +P ++ +R   D G PIVV    SA+++  Q+I+
Sbjct: 311 RIPLEIALRQGGDAGQPIVVGQPESASAQALQQIA 345


>gi|292492767|ref|YP_003528206.1| hypothetical protein Nhal_2752 [Nitrosococcus halophilus Nc4]
 gi|291581362|gb|ADE15819.1| protein of unknown function DUF59 [Nitrosococcus halophilus Nc4]
          Length = 361

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 128/337 (37%), Positives = 207/337 (61%), Gaps = 4/337 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + + Q+ ++LK    P  + ++V  + +  I I  + + L I +       +  L +  Q
Sbjct: 2   VTQAQVEETLKSYHDPYLEQDLVSAKAVDSIAIEGDRIDLKIKLGFPAKGYIPELVAAIQ 61

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIACA 119
           +   ++  V +  V ++      + +  +     +K  +AVASGKGGVGKSTT VN+A A
Sbjct: 62  KATASLDGVTHTQVDVSWEVAAHKVQQGVKPYPTIKNVIAVASGKGGVGKSTTAVNLALA 121

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
           L  +G +V +LDAD+YGPS P++L +  + E  D K ++P  NYGI+ MS+  L+DE   
Sbjct: 122 LAAEGASVGVLDADIYGPSQPRMLGVQRRPESRDGKSIEPLMNYGIQAMSIGFLIDEEEP 181

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           MIWRGPMV SA+  ML +  W  LD+L++D+PPGTGD  LT+AQ++P+SG VIV+TPQD+
Sbjct: 182 MIWRGPMVTSALQQMLQDTNWRDLDYLVVDLPPGTGDTQLTLAQRVPVSGAVIVTTPQDI 241

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D ++ + M++K+N+P++G++ENMS  + S  G +  +FG GG    A + G+  L  
Sbjct: 242 ALLDARKGLKMFEKVNVPVLGIVENMSIHICSQCGHEEPIFGEGGGERMAAQYGVTLLGQ 301

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P D  +R  +D G P VV +     ++IY++I+ R+
Sbjct: 302 LPLDKRIREDADNGHPSVVTDPEGRIAQIYRDIARRV 338


>gi|172035839|ref|YP_001802340.1| MRP protein-like protein [Cyanothece sp. ATCC 51142]
 gi|171697293|gb|ACB50274.1| MRP protein-like protein [Cyanothece sp. ATCC 51142]
          Length = 353

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 122/338 (36%), Positives = 208/338 (61%), Gaps = 11/338 (3%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           I+D L+ +  P  + ++V++  +  + +    V  ++ +        + +  + ++ +Q 
Sbjct: 7   ILDVLRPVQDPELQKSLVDLNMIRNVAVDGGNVSFTLVLTTPACPLREFIVDDCKKAVQT 66

Query: 69  IPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKG 124
           +P V+N  + +T    + K  P Q++    K  +AV+SGKGGVGKST  VNIA AL   G
Sbjct: 67  LPGVENIDIAVTAETPQQKALPNQQSVAGTKNIIAVSSGKGGVGKSTVAVNIAVALAQTG 126

Query: 125 KNVAILDADVYGPSIPKLLKISGKVEISDKK-----FLKPKENYGIKIMSMASLVDENVA 179
             V +LDAD+YGP+ P +L +    E+  +K      L+P  NYG+K++SM  L+D +  
Sbjct: 127 AKVGLLDADIYGPNAPTMLGLE-NTEVQVEKNEAGDILQPAFNYGVKMVSMGFLIDPDQP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           +IWRGPM+   I   L+ V WG LD+L++DMPPGTGDA LT+ Q +P++G VIV+TPQ +
Sbjct: 186 VIWRGPMLNGIIRQFLYQVNWGDLDYLVVDMPPGTGDAQLTMTQAVPMAGAVIVTTPQTV 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDT-GKKYDLFGNGGARFEAEKIGIPFLE 298
           +L+D +R + M++++ + ++G++ENMSYF+  D   ++YDLFG+GG    ++++ +P L 
Sbjct: 246 SLLDARRGLKMFEQLGVKVLGIVENMSYFIPPDAPDRQYDLFGSGGGEKASKELQVPLLG 305

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +P ++ +R   D G+PIV+    SA+++    I+  I
Sbjct: 306 CIPLEIALREGGDKGVPIVMSAPESASAQALTAIAQNI 343


>gi|224824467|ref|ZP_03697574.1| Cobyrinic acid ac-diamide synthase [Lutiella nitroferrum 2002]
 gi|224602960|gb|EEG09136.1| Cobyrinic acid ac-diamide synthase [Lutiella nitroferrum 2002]
          Length = 383

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 171/244 (70%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            VK  +AVASGKGGVGKSTT VN+A AL  +G  V +LDAD+YGPS P ++ + G+   +
Sbjct: 117 GVKNIIAVASGKGGVGKSTTAVNLALALAAEGARVGLLDADIYGPSQPLMMGLQGQKPET 176

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K L+P  NYG++ MS+  LVD + AM+WRGPMV  A+  +L++  W  LD+L+IDMPP
Sbjct: 177 DGKSLQPVVNYGVQTMSIGYLVDTDQAMVWRGPMVSQALQQLLNDTRWDDLDYLVIDMPP 236

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQK+P++G VIV+TPQD+AL+D ++ + M++K+++PI+G++ENM+  + S+
Sbjct: 237 GTGDIQLTLAQKVPVTGAVIVTTPQDIALLDARKGLKMFEKVSVPILGLVENMAIHICSN 296

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    +FG+GGA    E+ G+  L S+P D+ +R   D G P VV + N   +  YQ I
Sbjct: 297 CGHAEHIFGSGGAAKMTEEYGVELLGSLPLDLAIRQAVDEGKPSVVADPNGPIAAAYQAI 356

Query: 333 SDRI 336
           + R+
Sbjct: 357 ARRV 360


>gi|126659301|ref|ZP_01730437.1| put. ATPase [Cyanothece sp. CCY0110]
 gi|126619383|gb|EAZ90116.1| put. ATPase [Cyanothece sp. CCY0110]
          Length = 353

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/338 (36%), Positives = 209/338 (61%), Gaps = 11/338 (3%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           I++ L+ +  P  + ++V++  +  + +    V  ++ +        + +  + ++ +Q 
Sbjct: 7   ILNVLRPVQDPELQKSLVDLNMIRNVAVDDGNVSFTLVLTTPACPLREFIVDDCKKAVQT 66

Query: 69  IPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKG 124
           +P V+   V +T    + K+ P Q++    K  +AV+SGKGGVGKST  VNIA AL   G
Sbjct: 67  LPGVETVNVEVTAETPQQKSLPHQQSVAGTKNIIAVSSGKGGVGKSTVAVNIAVALAQTG 126

Query: 125 KNVAILDADVYGPSIPKLLKISGKVEISDKK-----FLKPKENYGIKIMSMASLVDENVA 179
             V +LDAD+YGP+ P +L +    E+  +K      L+P  NYG+K++SM  L+D +  
Sbjct: 127 AKVGLLDADIYGPNAPTMLGLE-NTEVQVEKNEAGDILQPAFNYGVKMVSMGFLIDPDQP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           +IWRGPM+   I   L+ V WG LD+L++DMPPGTGDA LT+AQ +P++G VIV+TPQ +
Sbjct: 186 VIWRGPMLNGIIRQFLYQVNWGALDYLVVDMPPGTGDAQLTMAQAVPMAGAVIVTTPQTV 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDT-GKKYDLFGNGGARFEAEKIGIPFLE 298
           +L+D +R + M++++ + ++G++ENMSYF+  D   ++YDLFG+GG    ++++ +P L 
Sbjct: 246 SLLDARRGLKMFEQLGVKVLGLVENMSYFIPPDAPERQYDLFGSGGGEKASKELQVPLLG 305

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +P ++ +R   D GIPIV+    SA+++    I+  I
Sbjct: 306 CIPLEIALREGGDKGIPIVMSAPESASAQALTAIAQNI 343


>gi|313683616|ref|YP_004061354.1| ATPase-like, para/mind [Sulfuricurvum kujiense DSM 16994]
 gi|313156476|gb|ADR35154.1| ATPase-like, ParA/MinD [Sulfuricurvum kujiense DSM 16994]
          Length = 346

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 138/340 (40%), Positives = 203/340 (59%), Gaps = 25/340 (7%)

Query: 8   QIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTV-----------YLSI--TVPHTIAHQ 54
           +++++L  L  PG    + E++ +S + +V N+            YL++   +      +
Sbjct: 5   KLLEALNALPYPGLSRTLGELKLISTVKVVDNSASIELLTVSDDSYLTVKSAIETAFEKE 64

Query: 55  LQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVV 114
             +L    + ++Q      N+      N   P   N       +AV SGKGGVGKST  V
Sbjct: 65  FTALNITKKALVQKDTNYGNSAA---PNNRAPYAAN------VIAVTSGKGGVGKSTVSV 115

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKIS-GKVEISDKKFLKPKENYGIKIMSMA-S 172
           N+A AL  KG  V ILDADVYGP++P+L      K++ +D   + P ENYGIKIMS+A +
Sbjct: 116 NLAIALAQKGYRVGILDADVYGPNVPRLTNTDLEKIKWNDDNQIVPSENYGIKIMSVALT 175

Query: 173 LVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVI 232
               +  ++WR  +  SA++  L +V WG+LDFL+IDMPPGTGD  LT+AQ++P+S  VI
Sbjct: 176 TPTSDTPLVWRSSVAVSALIQFLEDVAWGELDFLVIDMPPGTGDIQLTMAQELPISAGVI 235

Query: 233 VSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKI 292
           V+TPQ +A  DV RAI M+Q +++P+ G++ENMSYF+A DTG +Y++FG+GG    AE+ 
Sbjct: 236 VTTPQLVASDDVSRAIRMFQDIHVPMAGLVENMSYFVAPDTGTRYNIFGSGGGERLAERY 295

Query: 293 GIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            IP L  +P +MD+R  SD G P VV   N+  S  Y+EI
Sbjct: 296 NIPLLGQIPLNMDIREGSDNGEPPVVLGNNTLKS-YYKEI 334


>gi|254492452|ref|ZP_05105624.1| hypothetical protein MDMS009_2794 [Methylophaga thiooxidans DMS010]
 gi|224462344|gb|EEF78621.1| hypothetical protein MDMS009_2794 [Methylophaga thiooxydans DMS010]
          Length = 360

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 173/244 (70%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NVK  +AVASGKGGVGKSTT VN+A AL  +G  V ILDAD+YGPS P++L  + + E  
Sbjct: 94  NVKNIIAVASGKGGVGKSTTSVNLALALAAEGARVGILDADIYGPSQPRMLGTTKRPESE 153

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P E+YG++ MS+  L+DE   MIWRGPMV  A+  ML +  W +LD+L+ID+PP
Sbjct: 154 DGKSIEPIESYGVQSMSIGFLIDEEEPMIWRGPMVTQALQQMLGDTNWKELDYLVIDLPP 213

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++QK+P+SG VIV+TPQD++L+D ++A  M++K+N+P++G+IENMS  + S 
Sbjct: 214 GTGDIQLTLSQKVPVSGAVIVTTPQDISLLDARKAFKMFEKVNVPVLGVIENMSTHICSQ 273

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG+GG    AE+  +  L S+P D+ +R  +D G P VV N +   +  Y++I
Sbjct: 274 CGHEEHIFGSGGGARMAEQYDLNMLGSLPLDIKIREDADSGQPSVVTNPDGDIAMAYRQI 333

Query: 333 SDRI 336
           + R+
Sbjct: 334 ARRV 337


>gi|269836673|ref|YP_003318901.1| hypothetical protein Sthe_0642 [Sphaerobacter thermophilus DSM
           20745]
 gi|269785936|gb|ACZ38079.1| protein of unknown function DUF59 [Sphaerobacter thermophilus DSM
           20745]
          Length = 365

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/328 (37%), Positives = 200/328 (60%), Gaps = 6/328 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + + Q++D+L+ +  P    ++V++  + ++ I    V++ + +          + ++ +
Sbjct: 6   LTREQVIDALRPVQDPEIGRSLVDLGMIKDVAIEGGRVHVHVELTTPACPLRGRIETDVR 65

Query: 64  QIIQNIPTVKNAVVTLTE-----NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
             +  +P V    V  +          P ++    VK  +AVASGKGGVGKST  VN+A 
Sbjct: 66  NAVTALPGVSEVSVQFSARVRAAGSGMPDRQPLPGVKNTIAVASGKGGVGKSTVAVNLAI 125

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENV 178
           AL   G +V +LDADVYGPSIP ++ +S +  + D K + P + +G+K+MS+  ++D   
Sbjct: 126 ALAQDGASVGLLDADVYGPSIPIMMGVSHRPTMRDGKIV-PLDAFGVKVMSVGFILDPEK 184

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
           A+IWRGP+V   I   L +V WG+LD+L+ID+PPGTGDA LT+ Q+IPLSG VIV+TPQD
Sbjct: 185 ALIWRGPLVSQLISQFLSDVDWGELDYLVIDLPPGTGDAQLTLVQRIPLSGAVIVTTPQD 244

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +AL D  + ++M++++   I+G+IENMSYF+    G + ++FG GG    A +  +P L 
Sbjct: 245 VALADAVKGLAMFREVKTTILGIIENMSYFVCPHCGGRSEIFGFGGGERTATRHDVPLLG 304

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATS 326
            +P +  +R   D+G PIVV + +SA +
Sbjct: 305 QIPLEGSIRQGGDIGFPIVVSDPDSAPA 332


>gi|255745457|ref|ZP_05419405.1| Mrp protein [Vibrio cholera CIRS 101]
 gi|262151291|ref|ZP_06028426.1| Mrp protein [Vibrio cholerae INDRE 91/1]
 gi|255736532|gb|EET91929.1| Mrp protein [Vibrio cholera CIRS 101]
 gi|262030907|gb|EEY49536.1| Mrp protein [Vibrio cholerae INDRE 91/1]
          Length = 365

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 165/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K  +
Sbjct: 100 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGGKVGLLDADIYGPSVPLMLGKTKAKPVV 159

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 160 RDNKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 219

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+++P+IG++ENMSY + S
Sbjct: 220 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICS 279

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +D+R   D G+P VV   NS  +E Y  
Sbjct: 280 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIDMREDIDAGVPTVVARPNSEHTERYLA 339

Query: 332 ISDRI 336
           ++ R+
Sbjct: 340 LAQRV 344


>gi|56750453|ref|YP_171154.1| chromosome partitioning ATPase protein [Synechococcus elongatus PCC
           6301]
 gi|81299914|ref|YP_400122.1| MRP protein-like [Synechococcus elongatus PCC 7942]
 gi|56685412|dbj|BAD78634.1| ATP-binding protein involved in chromosome partitioning
           [Synechococcus elongatus PCC 6301]
 gi|81168795|gb|ABB57135.1| MRP protein-like [Synechococcus elongatus PCC 7942]
          Length = 361

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 122/339 (35%), Positives = 214/339 (63%), Gaps = 13/339 (3%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTV--YLSITVPHTIAHQLQSLRSNAQQII 66
           ++D+L+ +  P  + ++VE+  + ++ I  + V   L +T P     +L  + ++ ++ +
Sbjct: 8   VLDALRPVEDPELRRSLVELNMIRDVAIAGDQVSFRLVLTTPACPLREL--IVADCEKAV 65

Query: 67  QNIPTVKNAVVT----LTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +P V +  +     + + ++ P ++    V+  +A++SGKGGVGKST  VN A AL  
Sbjct: 66  KALPGVASVAIEVGAEIPQQRSLPDRQGIGGVRNILAISSGKGGVGKSTVSVNTAVALAK 125

Query: 123 KGKNVAILDADVYGPSIPKLLKISG---KVEISDK-KFLKPKENYGIKIMSMASLVDENV 178
            G  V +LDAD+YGP+ P +L ++     V  S +   L P E +GIK++SMA L+D + 
Sbjct: 126 AGARVGLLDADIYGPNTPTMLGVADAQPSVRPSPQGDILVPIETHGIKLVSMAFLIDPDQ 185

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            ++WRGPM+   I   L+   WG+LD+L++DMPPGTGDA LT+AQ +PL+G VIV+TPQ 
Sbjct: 186 PVMWRGPMLNGIIRQFLYQTEWGELDYLIVDMPPGTGDAQLTLAQAVPLAGAVIVTTPQT 245

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPFL 297
           ++L+D ++ + M+Q++ +P++G++ENMSYF+  D   ++YD+FG+GG    A+++ +  L
Sbjct: 246 VSLLDSRKGLRMFQQLKVPVLGIVENMSYFIPPDLPDRRYDIFGSGGGEKTAKELEVSLL 305

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P ++ +R   D G+PIVV    SA+++    I+ +I
Sbjct: 306 GGIPLEIPLREGGDRGVPIVVSQPESASAQALTAIAQKI 344


>gi|229515419|ref|ZP_04404878.1| Mrp protein [Vibrio cholerae TMA 21]
 gi|229347188|gb|EEO12148.1| Mrp protein [Vibrio cholerae TMA 21]
          Length = 382

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 165/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K  +
Sbjct: 117 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGGKVGLLDADIYGPSVPLMLGKTQAKPVV 176

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 177 RDNKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 236

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+++P+IG++ENMSY + S
Sbjct: 237 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICS 296

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +D+R   D G+P VV   NS  +E Y  
Sbjct: 297 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIDMREDIDAGVPTVVARPNSEHTERYLA 356

Query: 332 ISDRI 336
           ++ R+
Sbjct: 357 LAQRV 361


>gi|213970876|ref|ZP_03398999.1| ParA family protein [Pseudomonas syringae pv. tomato T1]
 gi|301383773|ref|ZP_07232191.1| ParA family protein [Pseudomonas syringae pv. tomato Max13]
 gi|302059919|ref|ZP_07251460.1| ParA family protein [Pseudomonas syringae pv. tomato K40]
 gi|302130518|ref|ZP_07256508.1| ParA family protein [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213924399|gb|EEB57971.1| ParA family protein [Pseudomonas syringae pv. tomato T1]
 gi|331015680|gb|EGH95736.1| ParA family protein [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 364

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/274 (44%), Positives = 178/274 (64%), Gaps = 6/274 (2%)

Query: 66  IQNIPTVKNAVVTL----TENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I+N+  V +A V +    + +K   Q     NVK  VAVASGKGGVGKSTT  N+A AL 
Sbjct: 66  IENLDGVGSATVAIKSVISAHKAQSQIPGLANVKNIVAVASGKGGVGKSTTAANLALALS 125

Query: 122 NKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
            +G  V ILDAD+YGPS   +  I    + +I ++K+  P E +GI++MSMA L D+N  
Sbjct: 126 REGARVGILDADIYGPSQGVMFGIPEGTRPKIKEQKWFVPIEAHGIEVMSMAFLTDDNTP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TPQDL
Sbjct: 186 MVWRGPMVSGALLQLVTQTAWNDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTPQDL 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A +  +  L S
Sbjct: 246 ALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLASQYDVELLAS 305

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           +P  M +R  +D G P  +   +S  + +YQE++
Sbjct: 306 LPLSMLIREQADGGKPTAIAEPDSQIAMVYQELA 339


>gi|148244674|ref|YP_001219368.1| Mrp-ATPase [Candidatus Vesicomyosocius okutanii HA]
 gi|146326501|dbj|BAF61644.1| Mrp-ATPase [Candidatus Vesicomyosocius okutanii HA]
          Length = 357

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 171/244 (70%), Gaps = 1/244 (0%)

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG-KVEIS 152
           VK  +A+ASGKGGVGKSTT VN+A AL+ +G  VAILDAD+YGPS P++L +S  K E S
Sbjct: 94  VKNIIAIASGKGGVGKSTTAVNLALALQAEGAKVAILDADIYGPSQPRMLGVSKIKPESS 153

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
            +  L P   +GI+ MS+  LV E+  MIWRGPM+  A+  ML + +W  +D+++ID+PP
Sbjct: 154 TEGKLLPILGHGIQSMSIGYLVKEDNPMIWRGPMITQALEQMLRDTLWRGIDYMIIDLPP 213

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++QKIP+SG +IV+TPQD+ALID K+ + M++K+NIPI+G++ENMS  + S 
Sbjct: 214 GTGDTQLTLSQKIPVSGSIIVTTPQDIALIDAKKGLKMFEKVNIPILGIVENMSLHICSK 273

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG GG +  A   GI FL S+P  MD++   D G P V  +     ++IY+EI
Sbjct: 274 CGYEEAIFGTGGGKAMAINEGIEFLGSLPLKMDIQTDVDEGTPTVTKDPEGKIAKIYKEI 333

Query: 333 SDRI 336
           + ++
Sbjct: 334 AKKV 337


>gi|86152336|ref|ZP_01070547.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315125014|ref|YP_004067018.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|85840825|gb|EAQ58076.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315018736|gb|ADT66829.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
          Length = 368

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 135/343 (39%), Positives = 209/343 (60%), Gaps = 10/343 (2%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +K QI++ LK +  PG + +IV    + +I I  + V++ I +          +R N  +
Sbjct: 1   MKEQILEKLKTVKYPGFEKDIVSFNFVKDIKIQDDGVFIDIEIVSANPEVANEIRKNVTE 60

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKSTTVVNIA 117
            + ++  +KN  + +   K P ++ N+ +       VK F+ V+SGKGGVGKSTT VN+A
Sbjct: 61  ALSSL-ALKNIELNIITPKIPEEKSNSRSGKNIAPQVKNFIMVSSGKGGVGKSTTTVNLA 119

Query: 118 CALKNKGKNVAILDADVYGPSIPKLL-KISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
            ++   GK V ILDAD+YGP+IP++L +   + E+  ++ LKP   +G+ +MSM  L++E
Sbjct: 120 ISMAKMGKRVGILDADIYGPNIPRMLGETKTQPEVVGQR-LKPILTHGVYMMSMGVLIEE 178

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              ++WRG M+  AI  +L +V+W +LD L +DMPPGTGDA +T AQ IP++  V VSTP
Sbjct: 179 GQGLMWRGAMIMKAIEQLLADVIWPELDVLFLDMPPGTGDAQITSAQSIPITAGVCVSTP 238

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++L D KRA+ M+ K++IPI G+IENMS FL  D GK+YD+FG G A   A+      
Sbjct: 239 QTVSLDDSKRALDMFNKLHIPIAGVIENMSGFLCPDNGKEYDIFGKGTAEDMAKAYKSEV 298

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
           L  +P +M VR   D G P+  ++  S +S+ Y   +++I  F
Sbjct: 299 LAQIPIEMIVREGGDEGKPVSFYHPESVSSKRYLMAAEKIWSF 341


>gi|254291742|ref|ZP_04962528.1| mrp protein [Vibrio cholerae AM-19226]
 gi|150422335|gb|EDN14296.1| mrp protein [Vibrio cholerae AM-19226]
          Length = 382

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 165/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K  +
Sbjct: 117 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGGKVGLLDADIYGPSVPLMLGKTQAKPVV 176

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 177 RDNKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 236

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+++P+IG++ENMSY + S
Sbjct: 237 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICS 296

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +D+R   D G+P VV   NS  +E Y  
Sbjct: 297 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIDMREDIDAGVPTVVARPNSEHTERYLA 356

Query: 332 ISDRI 336
           ++ R+
Sbjct: 357 LAQRV 361


>gi|153800935|ref|ZP_01955521.1| mrp protein [Vibrio cholerae MZO-3]
 gi|124123526|gb|EAY42269.1| mrp protein [Vibrio cholerae MZO-3]
          Length = 382

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 165/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K  +
Sbjct: 117 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGGKVGLLDADIYGPSVPLMLGKTQAKPVV 176

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 177 RDNKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 236

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+++P+IG++ENMSY + S
Sbjct: 237 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICS 296

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +D+R   D G+P VV   NS  +E Y  
Sbjct: 297 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIDMREDIDAGVPTVVARPNSEHTERYLA 356

Query: 332 ISDRI 336
           ++ R+
Sbjct: 357 LAQRV 361


>gi|15235067|ref|NP_193689.1| INDL (IND1(IRON-SULFUR PROTEIN REQUIRED FOR NADH
           DEHYDROGENASE)-LIKE) [Arabidopsis thaliana]
 gi|2853081|emb|CAA16931.1| ATP binding protein-like [Arabidopsis thaliana]
 gi|7268750|emb|CAB78956.1| ATP binding protein-like [Arabidopsis thaliana]
 gi|110737938|dbj|BAF00906.1| ATP binding protein - like [Arabidopsis thaliana]
 gi|332658796|gb|AEE84196.1| ATP-binding protein involved in chromosome partitioning
           [Arabidopsis thaliana]
          Length = 313

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 169/245 (68%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVEI 151
            VK  +AVASGKGGVGKS+T VN+A AL NK +  + +LDADVYGPS+P ++ I+ K ++
Sbjct: 41  GVKDIIAVASGKGGVGKSSTAVNLAVALANKCELKIGLLDADVYGPSVPIMMNINQKPQV 100

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           +    + P ENYG+K MSM  LV+++  ++WRGPMV SA+  M   V WG LD L++DMP
Sbjct: 101 NQDMKMIPVENYGVKCMSMGLLVEKDAPLVWRGPMVMSALAKMTKGVDWGDLDILVVDMP 160

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA ++I+Q + LSG VIVSTPQD+AL D  R ISM+ K+ +PI+G++ENMS F+  
Sbjct: 161 PGTGDAQISISQNLKLSGAVIVSTPQDVALADANRGISMFDKVRVPILGLVENMSCFVCP 220

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
              +   +FG  GAR  A K G+  +  +P +M +R  SD G+P+VV +  S  S+ YQ+
Sbjct: 221 HCNEPSFIFGKEGARRTAAKKGLKLIGEIPLEMSIREGSDEGVPVVVSSPGSIVSKAYQD 280

Query: 332 ISDRI 336
           ++  +
Sbjct: 281 LAQNV 285


>gi|209522927|ref|ZP_03271484.1| protein of unknown function DUF59 [Arthrospira maxima CS-328]
 gi|209496514|gb|EDZ96812.1| protein of unknown function DUF59 [Arthrospira maxima CS-328]
          Length = 356

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 219/344 (63%), Gaps = 9/344 (2%)

Query: 2   NQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSN 61
           +++  + +++ L+ +  P  + ++VE+  +  + I    V  ++ +        + +  +
Sbjct: 3   DKLDASSVLEVLRPVQDPELQKSLVELNMIRNVKITGGDVRFTLVLTTPACPLREFIVED 62

Query: 62  AQQIIQNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIA 117
            Q+ ++ +P V+   V +T    + K+ P ++    VK   A++SGKGGVGKST  VN+A
Sbjct: 63  CQKAVKQLPGVETVEVDVTAETPQQKSLPDRQGISGVKNIFAISSGKGGVGKSTVAVNVA 122

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKV----EISDKKFLKPKENYGIKIMSMASL 173
            AL + G  V ++DAD+YGP+ P +L ++       +  +   L+P  NYG+K++SMA L
Sbjct: 123 VALASTGAKVGLIDADIYGPNDPTMLGLADTQVMVQQTPEGDRLEPAFNYGVKLVSMAFL 182

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           +D +  +IWRGPM+   I   L+ V WG+LD+L++DMPPGTGDA LT+AQ +P+SG VIV
Sbjct: 183 IDRDQPVIWRGPMLNGIIRQFLYQVYWGELDYLIVDMPPGTGDAQLTLAQAVPMSGAVIV 242

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKI 292
           +TPQ+++L+D ++ + M++++ + I+G++ENMSYF+  D   +KYD+FG GG +  A+ +
Sbjct: 243 TTPQEVSLLDSRKGLKMFEQLGVSILGIVENMSYFVPPDLPDRKYDIFGTGGGQKTADDL 302

Query: 293 GIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           G+P L ++P +M VR   D G+PIVV + +SA+++    I+ +I
Sbjct: 303 GVPLLGAIPLEMPVRQGGDSGVPIVVSHPDSASAQELTAIAKKI 346


>gi|330817986|ref|YP_004361691.1| Cobyrinic acid a,c-diamide synthase [Burkholderia gladioli BSR3]
 gi|327370379|gb|AEA61735.1| Cobyrinic acid a,c-diamide synthase [Burkholderia gladioli BSR3]
          Length = 362

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 133/329 (40%), Positives = 207/329 (62%), Gaps = 4/329 (1%)

Query: 12  SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPT 71
           +L  L  P         + + E+ I  +TV +S+ + +    Q + +R     ++  +P 
Sbjct: 11  ALAALVDPNTGRPYAANKGIREVSIDGDTVSVSVVLGYPALSQHEDVRQRVATVLAQVPG 70

Query: 72  VKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNV 127
           V+ A V ++++   +  Q+   L  NVK  VAVASGKGGVGKSTT VN+A AL  +G +V
Sbjct: 71  VRAARVAVSQDIVAHTVQRGVKLLPNVKNIVAVASGKGGVGKSTTAVNLALALSQEGASV 130

Query: 128 AILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMV 187
            ILDAD+YGPS+P +L + G+ +  D K + P   +G++  S+  L+DE+  M+WRGPM 
Sbjct: 131 GILDADIYGPSLPTMLGVHGRPDSPDDKSMNPLVGHGLQANSIGFLIDEDNPMVWRGPMA 190

Query: 188 QSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRA 247
            SA+  +L    W  LD+L++DMPPGTGD  LT+AQ++P++G VIV+TPQD+AL+D K+ 
Sbjct: 191 TSALEQLLRQTNWQDLDYLIVDMPPGTGDIQLTLAQRVPVTGAVIVTTPQDIALLDAKKG 250

Query: 248 ISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVR 307
           + M++K+ IPI+G++ENMS  + S+ G +  +FG GGA   A   G+P L S+P D+ +R
Sbjct: 251 LKMFEKVGIPILGIVENMSIHVCSNCGHEEHVFGAGGAARMAADYGVPVLGSLPLDIAIR 310

Query: 308 VLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +D G P V    +SA +  Y+EI+ ++
Sbjct: 311 EQADSGTPTVAAAPDSAVAARYREIARQV 339


>gi|21537349|gb|AAM61690.1| ATP binding protein-like [Arabidopsis thaliana]
          Length = 313

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 169/245 (68%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVEI 151
            VK  +AVASGKGGVGKS+T VN+A AL NK +  + +LDADVYGPS+P ++ I+ K ++
Sbjct: 41  GVKDIIAVASGKGGVGKSSTAVNLAVALANKCELKIGLLDADVYGPSVPIMMNINQKPQV 100

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           +    + P ENYG+K MSM  LV+++  ++WRGPMV SA+  M   V WG LD L++DMP
Sbjct: 101 NQDMKMIPVENYGVKCMSMGLLVEKDAPLVWRGPMVMSALAKMTKGVDWGDLDILVVDMP 160

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA ++I+Q + LSG VIVSTPQD+AL D  R ISM+ K+ +PI+G++ENMS F+  
Sbjct: 161 PGTGDAQISISQNLKLSGAVIVSTPQDVALADANRGISMFDKVRVPILGLVENMSCFVCP 220

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
              +   +FG  GAR  A K G+  +  +P +M +R  SD G+P+VV +  S  S+ YQ+
Sbjct: 221 HCNEPSFIFGKEGARRTAAKKGLKLIGEIPLEMSIREGSDEGVPVVVSSPGSIVSKAYQD 280

Query: 332 ISDRI 336
           ++  +
Sbjct: 281 LAQNV 285


>gi|89902041|ref|YP_524512.1| putative iron sulfur-binding protein [Rhodoferax ferrireducens
           T118]
 gi|89346778|gb|ABD70981.1| putative iron sulfur binding protein [Rhodoferax ferrireducens
           T118]
          Length = 363

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 127/337 (37%), Positives = 206/337 (61%), Gaps = 4/337 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + +  + D+LK +  P    + V  + +  + +    V   + + +    Q+  +R    
Sbjct: 3   LTEQTLTDALKGVLDPNTGADFVASKCIKNLTLTDGDVAFDVELGYPAKSQIPGIRKALI 62

Query: 64  QIIQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACA 119
              + +  V N  V +T     +  Q+   L   VK  VAVASGKGGVGKSTT VN+A A
Sbjct: 63  AAAKGVAGVNNVSVNVTMKIAAHAVQRGVQLLPKVKNIVAVASGKGGVGKSTTAVNLALA 122

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
           L  +G +V +LDAD+YGPSIP ++ I G+ E  D + ++P ENYG+++MS+  LV ++ A
Sbjct: 123 LAAEGASVGLLDADIYGPSIPMMMGIDGRPESEDGQTMEPLENYGVQVMSIGFLVAQDEA 182

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           MIWRGPM   A+  +L    W  LD+L++DMPPGTGD  LT++Q++P++G VIV+TPQD+
Sbjct: 183 MIWRGPMATQALEQLLRQTNWRDLDYLIVDMPPGTGDIQLTLSQRVPMTGAVIVTTPQDI 242

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D K+ I M++K+ +PI+G++ENM+  + S+ G    +FG  G +  A + G+ +L +
Sbjct: 243 ALMDAKKGIKMFEKVGVPILGIVENMAVHVCSNCGHVEHIFGADGGKKMAAEYGMDYLGA 302

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P  M +RV +D G P VV + +   + IY+ ++ ++
Sbjct: 303 LPLTMQIRVQADSGKPTVVSDPDGEVAGIYKAVARKV 339


>gi|153824905|ref|ZP_01977572.1| mrp protein [Vibrio cholerae MZO-2]
 gi|149741417|gb|EDM55447.1| mrp protein [Vibrio cholerae MZO-2]
          Length = 382

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 165/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K  +
Sbjct: 117 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGGKVGLLDADIYGPSVPLMLGKTKAKPVV 176

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 177 RDNKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 236

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+++P+IG++ENMSY + S
Sbjct: 237 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICS 296

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +D+R   D G+P VV   NS  +E Y  
Sbjct: 297 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIDMREDIDAGVPTVVARPNSEHTERYLA 356

Query: 332 ISDRI 336
           ++ R+
Sbjct: 357 LAQRV 361


>gi|153215081|ref|ZP_01949798.1| mrp protein [Vibrio cholerae 1587]
 gi|124114944|gb|EAY33764.1| mrp protein [Vibrio cholerae 1587]
          Length = 382

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 165/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K  +
Sbjct: 117 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGGKVGLLDADIYGPSVPLMLGKTKAKPVV 176

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 177 RDNKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 236

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+++P+IG++ENMSY + S
Sbjct: 237 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICS 296

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +D+R   D G+P VV   NS  +E Y  
Sbjct: 297 HCGEKEHIFGVGGAQTLATEFGLSLLAQIPLHIDMREDIDAGVPTVVARPNSEHTERYLA 356

Query: 332 ISDRI 336
           ++ R+
Sbjct: 357 LAQRV 361


>gi|28871288|ref|NP_793907.1| ParA family protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28854538|gb|AAO57602.1| ParA family protein [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 364

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/274 (44%), Positives = 178/274 (64%), Gaps = 6/274 (2%)

Query: 66  IQNIPTVKNAVVTL----TENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I+N+  V +A V +    + +K   Q     NVK  VAVASGKGGVGKSTT  N+A AL 
Sbjct: 66  IENLDGVGSATVAIKSVISAHKAQSQIPGLANVKNIVAVASGKGGVGKSTTAANLALALS 125

Query: 122 NKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
            +G  V ILDAD+YGPS   +  I    + +I ++K+  P E +GI++MSMA L D+N  
Sbjct: 126 REGARVGILDADIYGPSQGVMFGIPEGTRPKIKEQKWFVPIEAHGIEVMSMAFLTDDNTP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TPQDL
Sbjct: 186 MVWRGPMVSGALLQLVTQTAWNDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTPQDL 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A +  +  L S
Sbjct: 246 ALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEPLFGEGGGEKLASQYDVELLAS 305

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           +P  M +R  +D G P  +   +S  + +YQE++
Sbjct: 306 LPLSMLIREQADGGKPTAIAEPDSQIAMVYQELA 339


>gi|258626534|ref|ZP_05721373.1| mrp protein [Vibrio mimicus VM603]
 gi|258581181|gb|EEW06091.1| mrp protein [Vibrio mimicus VM603]
          Length = 365

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 166/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K E+
Sbjct: 100 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGAKVGLLDADIYGPSVPLMLGKTKAKPEV 159

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            + K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 160 RENKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 219

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+ +P+IG++ENMSY + S
Sbjct: 220 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVEVPVIGLVENMSYHICS 279

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +++R   D G+P VV   +S  ++ Y E
Sbjct: 280 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIEMREDIDAGVPTVVARPDSEHTQRYLE 339

Query: 332 ISDRI 336
           ++ R+
Sbjct: 340 LAQRV 344


>gi|15641050|ref|NP_230682.1| mrp protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121587383|ref|ZP_01677153.1| mrp protein [Vibrio cholerae 2740-80]
 gi|153822385|ref|ZP_01975052.1| mrp protein [Vibrio cholerae B33]
 gi|153828169|ref|ZP_01980836.1| mrp protein [Vibrio cholerae 623-39]
 gi|227081210|ref|YP_002809761.1| mrp protein [Vibrio cholerae M66-2]
 gi|229505368|ref|ZP_04394878.1| Mrp protein [Vibrio cholerae BX 330286]
 gi|229510962|ref|ZP_04400441.1| Mrp protein [Vibrio cholerae B33]
 gi|229518083|ref|ZP_04407527.1| Mrp protein [Vibrio cholerae RC9]
 gi|229608387|ref|YP_002879035.1| Mrp protein [Vibrio cholerae MJ-1236]
 gi|254848165|ref|ZP_05237515.1| mrp protein [Vibrio cholerae MO10]
 gi|298498855|ref|ZP_07008662.1| mrp protein [Vibrio cholerae MAK 757]
 gi|9655501|gb|AAF94196.1| mrp protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121548386|gb|EAX58448.1| mrp protein [Vibrio cholerae 2740-80]
 gi|126520092|gb|EAZ77315.1| mrp protein [Vibrio cholerae B33]
 gi|148876411|gb|EDL74546.1| mrp protein [Vibrio cholerae 623-39]
 gi|227009098|gb|ACP05310.1| mrp protein [Vibrio cholerae M66-2]
 gi|229344798|gb|EEO09772.1| Mrp protein [Vibrio cholerae RC9]
 gi|229350927|gb|EEO15868.1| Mrp protein [Vibrio cholerae B33]
 gi|229357591|gb|EEO22508.1| Mrp protein [Vibrio cholerae BX 330286]
 gi|229371042|gb|ACQ61465.1| Mrp protein [Vibrio cholerae MJ-1236]
 gi|254843870|gb|EET22284.1| mrp protein [Vibrio cholerae MO10]
 gi|297543188|gb|EFH79238.1| mrp protein [Vibrio cholerae MAK 757]
          Length = 382

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 165/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K  +
Sbjct: 117 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGGKVGLLDADIYGPSVPLMLGKTKAKPVV 176

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 177 RDNKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 236

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+++P+IG++ENMSY + S
Sbjct: 237 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICS 296

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +D+R   D G+P VV   NS  +E Y  
Sbjct: 297 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIDMREDIDAGVPTVVARPNSEHTERYLA 356

Query: 332 ISDRI 336
           ++ R+
Sbjct: 357 LAQRV 361


>gi|289626588|ref|ZP_06459542.1| ATP-binding Mrp/Nbp35 family protein [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289647566|ref|ZP_06478909.1| ATP-binding Mrp/Nbp35 family protein [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298488745|ref|ZP_07006774.1| ATP-binding protein, Mrp/Nbp35 family [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156818|gb|EFH97909.1| ATP-binding protein, Mrp/Nbp35 family [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330867253|gb|EGH01962.1| ATP-binding Mrp/Nbp35 family protein [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 364

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 178/277 (64%), Gaps = 6/277 (2%)

Query: 66  IQNIPTVKNAVVTL----TENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I+N+  V +A V +    + +K   Q     NVK  VAVASGKGGVGKSTT  N+A AL 
Sbjct: 66  IENLDGVSSATVAIKSVISAHKAQSQIPGLANVKNIVAVASGKGGVGKSTTAANLALALS 125

Query: 122 NKGKNVAILDADVYGPSIPKLLKIS--GKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
            +G  V ILDAD+YGPS   +  I+   + +I D+K+  P + +GI +MSMA L D+N  
Sbjct: 126 REGARVGILDADIYGPSQGVMFGIAEGTRPKIKDQKWFVPVQAHGIDVMSMAFLTDDNTP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TPQDL
Sbjct: 186 MVWRGPMVSGALLQLVTQTAWNDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTPQDL 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A +  +  L S
Sbjct: 246 ALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLASQYNVELLAS 305

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P  + +R  +D G P  +    S  + +YQE++  +
Sbjct: 306 LPLSILIREQADGGKPTAIAEPESQIAMVYQELARHV 342


>gi|258621821|ref|ZP_05716852.1| mrp protein [Vibrio mimicus VM573]
 gi|258586052|gb|EEW10770.1| mrp protein [Vibrio mimicus VM573]
          Length = 365

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 166/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K E+
Sbjct: 100 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGAKVGLLDADIYGPSVPLMLGKTKAKPEV 159

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            + K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 160 RENKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 219

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+ +P+IG++ENMSY + S
Sbjct: 220 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVEVPVIGLVENMSYHICS 279

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +++R   D G+P VV   +S  ++ Y E
Sbjct: 280 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIEMREDIDAGVPTVVARPDSEHTQRYLE 339

Query: 332 ISDRI 336
           ++ R+
Sbjct: 340 LAQRV 344


>gi|319957397|ref|YP_004168660.1| atpase-like, para/mind [Nitratifractor salsuginis DSM 16511]
 gi|319419801|gb|ADV46911.1| ATPase-like, ParA/MinD [Nitratifractor salsuginis DSM 16511]
          Length = 372

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 217/351 (61%), Gaps = 21/351 (5%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + +++++++L  +  PG   +IV    +  + I  N   + +T+  T      S      
Sbjct: 1   MTEDKVLEALSHVIYPGFTKDIVSFGFVKGVEIDDND-RVKVTIEIT-----SSADEVKM 54

Query: 64  QIIQNIPT------VKNAVVTLTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKS 110
           Q+I++I T       ++  V +   K P ++ N++        VK F+ ++SGKGGVGKS
Sbjct: 55  QLIKDIETELAKAGAEDVQVEIIAPKKPVERSNSMTGKNIAPQVKDFLMISSGKGGVGKS 114

Query: 111 TTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMS 169
           TT VN+A A+  +GK V +LDAD+YGP+IP+++ I   K E+   K +KP E YGI++MS
Sbjct: 115 TTAVNLAIAMAMQGKKVGLLDADIYGPNIPRMMGIENVKPEVVGNK-VKPIEAYGIEVMS 173

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           M SL++   ++IWRG M+  AI   L +++W  LD L+IDMPPGTGDA LT+AQ +P++ 
Sbjct: 174 MGSLMEPGQSLIWRGAMIMKAIEQFLRDILWSDLDVLVIDMPPGTGDAQLTLAQSVPVTA 233

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEA 289
            V V+TPQ+++L D +R++ M+QK++IPI G+IENMS F+    GK+YD+FG G ++  A
Sbjct: 234 GVTVTTPQEVSLDDSRRSLDMFQKLHIPIAGVIENMSGFICPGDGKEYDIFGMGTSKPVA 293

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
           E+ G   L  +P +  VR+  D G P+  H+  S T++ +QE ++++  F 
Sbjct: 294 EEYGTELLARIPIEPQVRIGGDTGKPVTYHHPESETAKRFQEAANKVIAFM 344


>gi|121998142|ref|YP_001002929.1| hypothetical protein Hhal_1360 [Halorhodospira halophila SL1]
 gi|121589547|gb|ABM62127.1| protein of unknown function DUF59 [Halorhodospira halophila SL1]
          Length = 365

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 190/315 (60%), Gaps = 4/315 (1%)

Query: 23  NNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTEN 82
            +++    L EI +   +V + +++ +      ++L    +  IQ     ++  V++   
Sbjct: 23  TDLISAGCLGEITVDGESVRVEVSLGYPAGGYRETLTDELRGAIQQATGCRDVQVSVQTR 82

Query: 83  KNP----PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPS 138
            +     P  +    +K  +AVASGKGGVGKST   N+A AL+  G  V +LDAD+YGPS
Sbjct: 83  IHAHAVQPGVKARDEIKNIIAVASGKGGVGKSTVTANLALALQADGARVGVLDADIYGPS 142

Query: 139 IPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNV 198
            P++L + G+ E  D K ++P   +GI++MS   LVDE   MIWRGPMV  A+  +L   
Sbjct: 143 QPRMLGVRGQPESKDGKHMQPMLGHGIQVMSAGFLVDEETPMIWRGPMVTQALEQLLTET 202

Query: 199 VWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPI 258
            W  LD+L++DMPPGTGD  LT+AQK+P+SG VIV+TPQD+AL+D ++ + M++K+++ +
Sbjct: 203 AWEALDYLIVDMPPGTGDIQLTLAQKVPVSGGVIVTTPQDIALLDARKGLRMFEKVDVAV 262

Query: 259 IGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVV 318
           +G++ENMS  + S+ G +  +FG+GG    A + G+  L S+P D+ +R  SD G P V 
Sbjct: 263 LGIVENMSTHICSNCGHEEHIFGSGGGAAMASQYGVHLLGSLPLDITIREQSDSGYPTVA 322

Query: 319 HNMNSATSEIYQEIS 333
            +     +  Y+ ++
Sbjct: 323 ADPEGRIATDYRHMA 337


>gi|186685245|ref|YP_001868441.1| hypothetical protein Npun_R5166 [Nostoc punctiforme PCC 73102]
 gi|186467697|gb|ACC83498.1| protein of unknown function DUF59 [Nostoc punctiforme PCC 73102]
          Length = 356

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 214/345 (62%), Gaps = 14/345 (4%)

Query: 1   MNQILKNQ-IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLR 59
           M  +L ++ I++ L+ +  P  + ++VE+  +  + I    V  ++ +        + + 
Sbjct: 1   MYDVLDSRSILEILRPVEDPELRKSLVELNMIRNVKIDGGKVSFTLVLTTPACPLREFIV 60

Query: 60  SNAQQIIQNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVN 115
            + Q+ ++ +P V +  + +T    + K+ P +     VK  +AV+SGKGGVGKST  VN
Sbjct: 61  EDCQKAVKKLPGVTDVSIEVTAETPQQKSLPDRTGISGVKNIIAVSSGKGGVGKSTVAVN 120

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISG------KVEISDKKFLKPKENYGIKIMS 169
           +A AL   G  V +LDAD+YGP+ P +L ++         E  D   L+P  N+G+K++S
Sbjct: 121 VAVALAQTGAKVGLLDADIYGPNDPTMLGLADAQIVVRSTETGD--ILEPAFNHGVKLVS 178

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           M  L+D +  +IWRGPM+   I   L+ V WG+LD+L++DMPPGTGDA LT+ Q +P++G
Sbjct: 179 MGFLIDRDQPVIWRGPMLNGVIRQFLYQVQWGELDYLIVDMPPGTGDAQLTLTQAVPMAG 238

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFE 288
            VIV+TPQ +AL+D ++ + M+Q+MN+P++G++ENMSYF+  D   K YD+FG+GG    
Sbjct: 239 AVIVTTPQTVALLDSRKGLRMFQQMNVPVLGLVENMSYFIPPDQPDKHYDIFGSGGGSKT 298

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           A ++G+P L  VP ++  RV  D G+PIVV + +SA+++    I+
Sbjct: 299 AAELGVPLLGCVPLEISTRVGGDSGVPIVVGDPDSASAKALTAIA 343


>gi|254423073|ref|ZP_05036791.1| conserved domain protein [Synechococcus sp. PCC 7335]
 gi|196190562|gb|EDX85526.1| conserved domain protein [Synechococcus sp. PCC 7335]
          Length = 356

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 122/336 (36%), Positives = 205/336 (61%), Gaps = 9/336 (2%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
           + I+  LK +  P  + ++VE+  +  + +    V  ++ +        + +  + ++ +
Sbjct: 8   DSILTVLKPVQDPELQKSLVELNMIRNVEVDGGKVSFTLVLTTPACPLREFIVEDCEKAV 67

Query: 67  QNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +P V++  V +T    + K  P +     VK  +AV SGKGGVGKST  VN+A AL  
Sbjct: 68  RTLPGVESVEVDVTAETPQQKGLPDRTGIDGVKNILAVTSGKGGVGKSTVAVNLAVALAK 127

Query: 123 KGKNVAILDADVYGPSIPKLLKISGK----VEISDKKFLKPKENYGIKIMSMASLVDENV 178
            G  V ++DAD+YGP+ P ++ +        E   ++ L+P  N+G+K++SM  L+D + 
Sbjct: 128 TGAAVGLIDADIYGPNAPTMMGLGESNVIVREDKGEQVLEPAFNHGVKMVSMGFLIDRDQ 187

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            ++WRGPM+   I   L+ V WG LD+L++DMPPGTGDA LT+AQ +P++G VIV+TPQD
Sbjct: 188 PVVWRGPMLNGVIRQFLYQVQWGDLDYLVVDMPPGTGDAQLTLAQAVPMAGAVIVTTPQD 247

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPFL 297
           +AL D +R + M++++ +PI+G++ENMSYF+  D   K+Y +FG GG    A ++G+  L
Sbjct: 248 VALSDARRGLKMFEQLKVPILGLVENMSYFVPPDMPEKQYAIFGEGGGEKAAAELGVELL 307

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
             VP +M VR   D G+PI++ +  SA+++   +I+
Sbjct: 308 GKVPLEMPVREGGDRGLPIILSDPESASAQSLMDIA 343


>gi|67925157|ref|ZP_00518529.1| Cobyrinic acid a,c-diamide synthase:Protein of unknown function
           DUF59 [Crocosphaera watsonii WH 8501]
 gi|67853004|gb|EAM48391.1| Cobyrinic acid a,c-diamide synthase:Protein of unknown function
           DUF59 [Crocosphaera watsonii WH 8501]
          Length = 354

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 125/341 (36%), Positives = 209/341 (61%), Gaps = 16/341 (4%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           I+D LK +  P  + ++VE+  +  + +    V  ++ +        + +  + ++ +Q 
Sbjct: 7   ILDVLKPVQDPELQKSLVELNMIRNVAVEGGNVSFTLVLTTPACPLREFIVEDCKKAVQT 66

Query: 69  IPTVKNAVVTLTENKNPPQQRNNL-------NVKKFVAVASGKGGVGKSTTVVNIACALK 121
           +P V +  V +T     PQQ+ +L         K  +AV+SGKGGVGKST  VNIA AL 
Sbjct: 67  LPGVTSVNVDVTSET--PQQQPSLPDQNSVAGAKNIIAVSSGKGGVGKSTVAVNIAVALA 124

Query: 122 NKGKNVAILDADVYGPSIPKLLKISGKVEISDKK-----FLKPKENYGIKIMSMASLVDE 176
             G  V +LDAD+YGP++P +L +    E+  +K      L+P  NYG+K++SM  L+D 
Sbjct: 125 QTGAKVGLLDADIYGPNVPTMLGLE-NTEVQVEKNPAGDILQPAFNYGVKMVSMGFLIDP 183

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           +  +IWRGPM+   I   L+ V WG+LD+L++DMPPGTGDA LT+AQ +P++G +IV+TP
Sbjct: 184 DQPVIWRGPMLNGIIRQFLYQVNWGELDYLVVDMPPGTGDAQLTMAQAVPMAGAIIVTTP 243

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKK-YDLFGNGGARFEAEKIGIP 295
           Q ++L D +R + M++++ + ++G++ENMSYF+  D  ++ YDLFG+GG    ++++ +P
Sbjct: 244 QTVSLQDARRGLKMFEQLGVNVLGIVENMSYFIPPDAPERSYDLFGSGGGEKTSKELQVP 303

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            L  +P ++ +R   D G+PIV+    SA+++    I+  I
Sbjct: 304 LLGCIPLEIALREGGDHGVPIVMSAPESASAKALTAIAQNI 344


>gi|262166072|ref|ZP_06033809.1| Mrp protein [Vibrio mimicus VM223]
 gi|262025788|gb|EEY44456.1| Mrp protein [Vibrio mimicus VM223]
          Length = 382

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 166/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K E+
Sbjct: 117 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGAKVGLLDADIYGPSVPLMLGKTKAKPEV 176

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            + K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 177 RENKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 236

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+ +P+IG++ENMSY + S
Sbjct: 237 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVEVPVIGLVENMSYHICS 296

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +++R   D G+P VV   +S  ++ Y E
Sbjct: 297 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIEMREDIDAGVPTVVARPDSEHTQRYLE 356

Query: 332 ISDRI 336
           ++ R+
Sbjct: 357 LAQRV 361


>gi|124266355|ref|YP_001020359.1| putative iron sulfur binding protein [Methylibium petroleiphilum
           PM1]
 gi|124259130|gb|ABM94124.1| putative iron sulfur binding protein [Methylibium petroleiphilum
           PM1]
          Length = 365

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 198/322 (61%), Gaps = 4/322 (1%)

Query: 19  PGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVT 78
           P    + V  ++L  + +    V   + + +    Q+ +LR       + +P V+N    
Sbjct: 20  PNTGRDFVSTRQLKNLKLEGGDVAFDVELGYPAKSQIAALRKALIAAARAVPGVENVSAN 79

Query: 79  LTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV 134
           L      +  Q+   L   VK  VAVASGKGGVGKSTT VN+A AL  +G +V +LDAD+
Sbjct: 80  LGVKIVSHAVQRGVQLLPGVKNIVAVASGKGGVGKSTTAVNLALALAAEGASVGVLDADI 139

Query: 135 YGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHM 194
           YGPS P +L I G+ E +D K ++P EN+G+++MS+  LVD +  MIWRGPM   A+  M
Sbjct: 140 YGPSQPMMLGIEGRPESADGKSMEPLENFGVQVMSIGFLVDADSPMIWRGPMATQALEQM 199

Query: 195 LHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKM 254
           L    W +LD+L++DMPPGTGD  LT++QK+PL+G VIV+TPQD+AL+D ++ + M++K+
Sbjct: 200 LRQTNWRELDYLIVDMPPGTGDIQLTLSQKVPLTGAVIVTTPQDIALLDARKGLKMFEKV 259

Query: 255 NIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGI 314
            +PI+G++ENM+  + S+ G    +FG  G +  + + G+ +L  +P  M +R  +D G 
Sbjct: 260 GVPILGVVENMAVHVCSNCGHTEHIFGADGGQKMSTEYGVDYLGGLPLSMAIREQADAGR 319

Query: 315 PIVVHNMNSATSEIYQEISDRI 336
           P VV + +   + IY+ ++ +I
Sbjct: 320 PTVVSDPDGDIAGIYKSVARKI 341


>gi|33601099|ref|NP_888659.1| putative iron sulfur binding protein [Bordetella bronchiseptica
           RB50]
 gi|33575534|emb|CAE32612.1| putative iron sulfur binding protein [Bordetella bronchiseptica
           RB50]
          Length = 365

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 170/239 (71%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NVK  +AVASGKGGVGKSTT VN+A AL  +G  V +LDAD+YGPS  +++ I G+ +  
Sbjct: 95  NVKNVIAVASGKGGVGKSTTAVNLALALAAEGARVGLLDADIYGPSQAQMMGIEGRPQSE 154

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P ENYG+++MS+  LVD + AMIWRGPM   A+  +L    W  LD+L+IDMPP
Sbjct: 155 DGKTMEPLENYGVQVMSIGFLVDADEAMIWRGPMAVQALEQLLRQTNWKNLDYLVIDMPP 214

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD HLT++QK+P++G VIV+TPQD+AL+D ++ + M++K+ +PI+G++ENM+  + S 
Sbjct: 215 GTGDIHLTLSQKVPVTGAVIVTTPQDIALLDARKGVKMFEKVGVPIVGVVENMAVHVCSQ 274

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
            G    +FG GG +  A+  G+ +L ++P D+D+R  +D G P VV + +   + +Y++
Sbjct: 275 CGHAEHIFGQGGGQRMAQDYGLAYLGALPLDIDIRQQADGGRPSVVADPDGEVAGLYKD 333


>gi|126282060|ref|XP_001368317.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 501

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 120/253 (47%), Positives = 172/253 (67%), Gaps = 2/253 (0%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACAL--KNKGKNVAILDADVYGPSIPKLL 143
           P+Q+    VK+ + VASGKGGVGKSTT VN+A AL   +  K + +LDADVYGPSIPK++
Sbjct: 240 PKQKPIDGVKQIIVVASGKGGVGKSTTAVNLALALGANDSSKAIGLLDADVYGPSIPKMM 299

Query: 144 KISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQL 203
            + G  E+S+   ++P  NYGI  MSM  LV+E   ++WRG MV SAI  ++  V WGQL
Sbjct: 300 NLQGNPELSESNLMRPLLNYGIFCMSMGFLVEETAPVVWRGLMVMSAIEKLIRQVDWGQL 359

Query: 204 DFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIE 263
           D+L+IDMPPGTGD  L+++Q IP+SG VIVSTPQD+AL+D  +   M++K+++P++G+I+
Sbjct: 360 DYLVIDMPPGTGDVQLSVSQNIPISGAVIVSTPQDIALMDAHKGAEMFRKVHVPVLGLIQ 419

Query: 264 NMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS 323
           NMS F       +  +FG  GA+  A+ + +  L  +P  +++R  SD G PIV HN NS
Sbjct: 420 NMSVFQCPKCKHETHIFGADGAKKLAKTLCLDVLGDIPLHLNIREASDSGQPIVFHNSNS 479

Query: 324 ATSEIYQEISDRI 336
            T++ Y  I+  +
Sbjct: 480 TTAKAYLRIAAEV 492


>gi|57238619|ref|YP_179750.1| ATP/GTP-binding protein [Campylobacter jejuni RM1221]
 gi|57167423|gb|AAW36202.1| ATP/GTP-binding protein [Campylobacter jejuni RM1221]
          Length = 368

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 135/343 (39%), Positives = 208/343 (60%), Gaps = 10/343 (2%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +K QI++ LK +  PG + +IV    + +I I  + V++ I +          +R N  +
Sbjct: 1   MKEQILEKLKTVKYPGFEKDIVSFNFVKDIKIQDDGVFIDIEIVSANPEVANEIRKNTIE 60

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKSTTVVNIA 117
            + ++  +KN  + +   K P ++ N+ +       VK F+ V+SGKGGVGKSTT VN+A
Sbjct: 61  ALSSL-ALKNIELNIITPKIPEEKSNSRSGKNIAPQVKNFIMVSSGKGGVGKSTTTVNLA 119

Query: 118 CALKNKGKNVAILDADVYGPSIPKLL-KISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
            ++   GK V ILDAD+YGP+IP++L +   + E+  ++ LKP   +G+ +MSM  L++E
Sbjct: 120 ISMAKMGKRVGILDADIYGPNIPRMLGETKTQPEVVGQR-LKPILTHGVYMMSMGVLIEE 178

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              ++WRG M+  AI  +L +V+W +LD L +DMPPGTGDA +T AQ IP++  V VSTP
Sbjct: 179 GQGLMWRGAMIMKAIEQLLADVIWPELDVLFLDMPPGTGDAQITSAQSIPITAGVCVSTP 238

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++L D KRA+ M+ K++IPI G+IENMS FL  D GK+YD+FG G A   A+      
Sbjct: 239 QTVSLDDSKRALDMFNKLHIPIAGVIENMSGFLCPDNGKEYDIFGKGTAEDMAKAYKSEV 298

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
           L  +P +M VR   D G P+  ++  S +S  Y   +++I  F
Sbjct: 299 LAQIPIEMIVREGGDEGKPVSFYHPESVSSRRYLMAAEKIWSF 341


>gi|315059057|gb|ADT73386.1| putative ATP/GTP-binding protein [Campylobacter jejuni subsp.
           jejuni S3]
          Length = 368

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 135/343 (39%), Positives = 209/343 (60%), Gaps = 10/343 (2%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +K QI++ LK +  PG + +IV    + +I I  + V++ I +          +R N  +
Sbjct: 1   MKEQILEKLKTVKYPGFEKDIVSFNFVKDIKIQDDGVFIDIEIVSANPEVANEIRKNTIE 60

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKSTTVVNIA 117
            + ++  +KN  + +   K P ++ N+ +       VK F+ V+SGKGGVGKSTT VN+A
Sbjct: 61  ALSSL-ALKNIELNIITPKIPEEKSNSRSGKNIAPQVKNFIMVSSGKGGVGKSTTTVNLA 119

Query: 118 CALKNKGKNVAILDADVYGPSIPKLL-KISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
            ++   GK V ILDAD+YGP+IP++L +   + E+  ++ LKP   +G+ +MSM  L++E
Sbjct: 120 ISMAKMGKRVGILDADIYGPNIPRMLGETKTQPEVVGQR-LKPILTHGVYMMSMGVLIEE 178

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              ++WRG M+  AI  +L +V+W +LD L +DMPPGTGDA +T AQ IP++  V VSTP
Sbjct: 179 GQGLMWRGAMIMKAIEQLLADVIWPELDVLFLDMPPGTGDAQITSAQSIPITAGVCVSTP 238

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++L D KRA+ M+ K++IPI G+IENMS FL  D GK+YD+FG G A   A+      
Sbjct: 239 QTVSLDDSKRALDMFNKLHIPIAGVIENMSGFLCPDNGKEYDIFGKGTAEDMAKAYKSEV 298

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
           L  +P +M VR   D G P+  ++  S +S+ Y   +++I  F
Sbjct: 299 LAQIPIEMIVREGGDEGKPVSFYHPESVSSKRYLMAAEKIWSF 341


>gi|238028340|ref|YP_002912571.1| Cobyrinic acid a,c-diamide synthase [Burkholderia glumae BGR1]
 gi|237877534|gb|ACR29867.1| Cobyrinic acid a,c-diamide synthase [Burkholderia glumae BGR1]
          Length = 362

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 136/329 (41%), Positives = 204/329 (62%), Gaps = 4/329 (1%)

Query: 12  SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPT 71
           +L  L  P         + L E+ I  +TV +S+ + +    Q + LR      +  +P 
Sbjct: 11  ALAALVDPNTGRPYAANKGLREVAIDGDTVSVSVVLGYPARSQHEDLRRRVADALAAVPG 70

Query: 72  VKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNV 127
           V+ A V + +    +  Q+   L  NVK  VAVASGKGGVGKSTT VN+A AL  +G +V
Sbjct: 71  VRAARVAVQQEIAAHTVQRGVKLLPNVKNIVAVASGKGGVGKSTTAVNLALALAAEGASV 130

Query: 128 AILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMV 187
            ILDAD+YGPS+P +L I G+ +  D + + P E +G++  S+  L+DE+  M+WRGPM 
Sbjct: 131 GILDADIYGPSLPTMLGIRGRPDSPDNQSMNPMEGHGLQANSIGFLIDEDNPMVWRGPMA 190

Query: 188 QSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRA 247
            SA+  +L    W  LD+L++DMPPGTGD  LT+AQ++P++G VIV+TPQD+AL+D K+ 
Sbjct: 191 TSALEQLLRQTNWRDLDYLIVDMPPGTGDIQLTLAQRVPVTGAVIVTTPQDIALLDAKKG 250

Query: 248 ISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVR 307
           + M++K+ IPIIG++ENMS  + S+ G +  +FG GGA   A   G+P L S+P D+ +R
Sbjct: 251 LKMFEKVGIPIIGIVENMSLHVCSNCGHEEPIFGAGGAARMAANYGVPVLGSLPLDIAIR 310

Query: 308 VLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +D G P V    +S  +  Y+EI+ ++
Sbjct: 311 EQADGGTPTVAAAPDSPVAARYREIARQV 339


>gi|224062188|ref|XP_002300792.1| predicted protein [Populus trichocarpa]
 gi|222842518|gb|EEE80065.1| predicted protein [Populus trichocarpa]
          Length = 260

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 168/245 (68%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACAL-KNKGKNVAILDADVYGPSIPKLLKISGKVEI 151
            VK  +AVASGKGGVGKSTT VN+A AL KN    V +LDADVYGPS+P ++KI  K +I
Sbjct: 9   GVKDVIAVASGKGGVGKSTTAVNLAVALAKNCQLKVGLLDADVYGPSVPMMMKIDRKPDI 68

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           ++ K + P ENYG+K MSM  LV+++  ++WRGPMV SA+  M   V WG LD L++DMP
Sbjct: 69  TEDKKMIPIENYGVKCMSMGFLVEKDAPIVWRGPMVMSALAKMTRGVDWGNLDILVVDMP 128

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA LT+ Q + LSG +IVSTPQD+AL+D +R  +M+ K+++PI+G +ENMS+F   
Sbjct: 129 PGTGDAQLTMTQNLQLSGALIVSTPQDIALMDARRGANMFSKVDVPILGFVENMSFFKCP 188

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+   +FG  G R  A  +G   +  +P ++D+R  SD G+P+V+   +S  S+ Y +
Sbjct: 189 HCGEPSFIFGKEGTRNAAASMGYKLIGEIPLEVDIRKGSDEGVPVVISAPDSVISKAYGD 248

Query: 332 ISDRI 336
            +  +
Sbjct: 249 TAQNV 253


>gi|290473993|ref|YP_003466867.1| putative ATP-binding protein with nucleotide triphosphate hydrolase
           domain [Xenorhabdus bovienii SS-2004]
 gi|289173300|emb|CBJ80075.1| putative ATP-binding protein with nucleotide triphosphate hydrolase
           domain [Xenorhabdus bovienii SS-2004]
          Length = 370

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 126/338 (37%), Positives = 202/338 (59%), Gaps = 5/338 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           +LK  +V  L     P  + +++ ++ L    ++   +++ + +P         L+    
Sbjct: 13  LLKEHVVKILATFKHPTLERDLIALKALHHCAMLDGVLHIELMMPFVWKRAFAKLKEETT 72

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIACA 119
           Q +Q     K+    LT +    ++ NNL     V+  +AV+SGKGGVGKS+T VN+A A
Sbjct: 73  QSLQTATGAKSVDWRLTYDICTLRRANNLPGVNGVRNILAVSSGKGGVGKSSTAVNLALA 132

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENV 178
           L  +G  V ILDAD+YGPS+P +L  + +   S D + + P   +G+   S+  LV ++ 
Sbjct: 133 LAQEGAKVGILDADIYGPSVPNMLGTAQERPTSPDGQHMAPIMVHGMATNSIGYLVTDDN 192

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
           AM+WRGPM   A+M ML + +W  LD+L+IDMPPGTGD  LT++Q IP++G ++++TPQD
Sbjct: 193 AMVWRGPMASKALMQMLQDTLWPDLDYLVIDMPPGTGDIQLTLSQNIPVTGALVITTPQD 252

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +ALID  + I+M+QK+N+P++G+IENMS  + S+ G +  +FG GGA   AEK     L 
Sbjct: 253 IALIDAIKGIAMFQKVNVPVLGIIENMSIHICSNCGHQEPIFGTGGAEKLAEKYHCQLLG 312

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +P  + +R   D G P V+   +S  ++IY++I+  I
Sbjct: 313 QIPLHISLREDLDRGEPTVISQPDSELADIYRDIAANI 350


>gi|227356724|ref|ZP_03841110.1| ATPase [Proteus mirabilis ATCC 29906]
 gi|227163232|gb|EEI48163.1| ATPase [Proteus mirabilis ATCC 29906]
          Length = 375

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 128/339 (37%), Positives = 201/339 (59%), Gaps = 5/339 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           +ILK ++   L     P  K N++ ++ L +  ++ + +++ + +P       Q L    
Sbjct: 17  EILKEKVSGVLSTFEHPTLKRNLLSLKALHQCAMIDDVLHIELVMPFVWKKPFQQLIEEK 76

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIAC 118
              ++N+   K     L  N    ++ N+L     V+  +AV+SGKGGVGKS+T VN+A 
Sbjct: 77  TAELRNMTGAKAVEWKLKHNIATLRRANDLPGINGVRNILAVSSGKGGVGKSSTAVNLAL 136

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G  V ILDAD+YGPSIP +L  + +   S D + + P   YG+   S+  LV ++
Sbjct: 137 ALAQEGAKVGILDADIYGPSIPNMLGTTMERPTSPDGQHMAPIMAYGLASNSIGYLVTDD 196

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A+M ML + +W  LD+L+IDMPPGTGD  LT++Q IP++G V+V+TPQ
Sbjct: 197 NAMVWRGPMASKALMQMLQDTLWPDLDYLVIDMPPGTGDIQLTLSQNIPVTGAVVVTTPQ 256

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D  + I M++K+N+P++G+IENMS  + S+ G    +FG GGA   AEK     L
Sbjct: 257 DIALVDAMKGIVMFKKVNVPVLGIIENMSAHICSNCGHLEPIFGTGGAEKLAEKYHCQLL 316

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P  + +R   D G P V+ +     ++IY+EI+  +
Sbjct: 317 GQIPLHISLREDLDRGQPTVMRDPEGEFADIYREIASTV 355


>gi|86149282|ref|ZP_01067513.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88596695|ref|ZP_01099932.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni 84-25]
 gi|218563195|ref|YP_002344975.1| putative ATP/GTP-binding protein [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|85840064|gb|EAQ57322.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88191536|gb|EAQ95508.1| ATP/GTP-binding protein [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112360902|emb|CAL35703.1| putative ATP/GTP-binding protein (Mrp protein homolog)
           [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|284926801|gb|ADC29153.1| putative ATP/GTP-binding protein (Mrp protein-like protein)
           [Campylobacter jejuni subsp. jejuni IA3902]
 gi|315927648|gb|EFV06979.1| Putative ATP/GTP-binding protein [Campylobacter jejuni subsp.
           jejuni DFVF1099]
 gi|315929302|gb|EFV08512.1| putative ATP/GTP-binding protein [Campylobacter jejuni subsp.
           jejuni 305]
          Length = 368

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 135/343 (39%), Positives = 209/343 (60%), Gaps = 10/343 (2%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +K QI++ LK +  PG + +IV    + +I I  + V++ I +          +R N  +
Sbjct: 1   MKEQILEKLKTVKYPGFEKDIVSFNFVKDIKIQDDGVFIDIEIVSANPEVANEIRKNTIE 60

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKSTTVVNIA 117
            + ++  +KN  + +   K P ++ N+ +       VK F+ V+SGKGGVGKSTT VN+A
Sbjct: 61  ALSSL-ALKNIELNIITPKIPEEKSNSRSGKNIAPQVKNFIMVSSGKGGVGKSTTTVNLA 119

Query: 118 CALKNKGKNVAILDADVYGPSIPKLL-KISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
            ++   GK V ILDAD+YGP+IP++L +   + E+  ++ LKP   +G+ +MSM  L++E
Sbjct: 120 ISMAKMGKRVGILDADIYGPNIPRMLGETKTQPEVVGQR-LKPILTHGVYMMSMGVLIEE 178

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              ++WRG M+  AI  +L +V+W +LD L +DMPPGTGDA +T AQ IP++  V VSTP
Sbjct: 179 GQGLMWRGAMIMKAIEQLLADVIWPELDVLFLDMPPGTGDAQITSAQSIPIAAGVCVSTP 238

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++L D KRA+ M+ K++IPI G+IENMS FL  D GK+YD+FG G A   A+      
Sbjct: 239 QTVSLDDSKRALDMFNKLHIPIAGVIENMSGFLCPDNGKEYDIFGKGTAEDMAKAYKSEV 298

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
           L  +P +M VR   D G P+  ++  S +S+ Y   +++I  F
Sbjct: 299 LAQIPIEMIVREGGDEGKPVSFYHPESVSSKRYLMAAEKIWSF 341


>gi|197284544|ref|YP_002150416.1| ATPase [Proteus mirabilis HI4320]
 gi|194682031|emb|CAR41527.1| putative ATP-binding protein [Proteus mirabilis HI4320]
          Length = 370

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 128/339 (37%), Positives = 201/339 (59%), Gaps = 5/339 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           +ILK ++   L     P  K N++ ++ L +  ++ + +++ + +P       Q L    
Sbjct: 12  EILKEKVSGVLSTFEHPTLKRNLLSLKALHQCAMIDDVLHIELVMPFVWKKPFQQLIEEK 71

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIAC 118
              ++N+   K     L  N    ++ N+L     V+  +AV+SGKGGVGKS+T VN+A 
Sbjct: 72  TAELRNMTGAKAVEWKLKHNIATLRRANDLPGINGVRNILAVSSGKGGVGKSSTAVNLAL 131

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G  V ILDAD+YGPSIP +L  + +   S D + + P   YG+   S+  LV ++
Sbjct: 132 ALAQEGAKVGILDADIYGPSIPNMLGTTMERPTSPDGQHMAPIMAYGLASNSIGYLVTDD 191

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A+M ML + +W  LD+L+IDMPPGTGD  LT++Q IP++G V+V+TPQ
Sbjct: 192 NAMVWRGPMASKALMQMLQDTLWPDLDYLVIDMPPGTGDIQLTLSQNIPVTGAVVVTTPQ 251

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D  + I M++K+N+P++G+IENMS  + S+ G    +FG GGA   AEK     L
Sbjct: 252 DIALVDAMKGIVMFKKVNVPVLGIIENMSAHICSNCGHLEPIFGTGGAEKLAEKYHCQLL 311

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P  + +R   D G P V+ +     ++IY+EI+  +
Sbjct: 312 GQIPLHISLREDLDRGQPTVMRDPEGEFADIYREIASTV 350


>gi|229529873|ref|ZP_04419263.1| Mrp protein [Vibrio cholerae 12129(1)]
 gi|229333647|gb|EEN99133.1| Mrp protein [Vibrio cholerae 12129(1)]
          Length = 382

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 117/245 (47%), Positives = 165/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K  +
Sbjct: 117 GVKNIIAVTSGKGGVGKSTTAVNLALAIAQSGGKVGLLDADIYGPSVPLMLGKTKAKPVV 176

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            + K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 177 RENKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 236

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+++P+IG++ENMSY + S
Sbjct: 237 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICS 296

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +D+R   D G+P VV   NS  +E Y  
Sbjct: 297 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIDMREDIDAGVPTVVARPNSEHTERYLA 356

Query: 332 ISDRI 336
           ++ R+
Sbjct: 357 LAQRV 361


>gi|262171952|ref|ZP_06039630.1| Mrp protein [Vibrio mimicus MB-451]
 gi|261893028|gb|EEY39014.1| Mrp protein [Vibrio mimicus MB-451]
          Length = 365

 Score =  249 bits (635), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 166/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K E+
Sbjct: 100 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGAKVGLLDADIYGPSVPLMLGKTKAKPEV 159

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            + K+++P E +G+   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 160 RENKWMQPIEAHGMATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 219

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+ +P+IG++ENMSY + S
Sbjct: 220 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVEVPVIGLVENMSYHICS 279

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +++R   D G+P VV   +S  ++ Y E
Sbjct: 280 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIEMREDIDAGVPTVVARPDSEHTQRYLE 339

Query: 332 ISDRI 336
           ++ R+
Sbjct: 340 LAQRV 344


>gi|148925750|ref|ZP_01809438.1| putative ATP/GTP-binding protein (mrp protein like protein)
           [Campylobacter jejuni subsp. jejuni CG8486]
 gi|205355620|ref|ZP_03222390.1| putative ATP/GTP binding protein (Mrp protein ) [Campylobacter
           jejuni subsp. jejuni CG8421]
 gi|145845760|gb|EDK22851.1| putative ATP/GTP-binding protein (mrp protein like protein)
           [Campylobacter jejuni subsp. jejuni CG8486]
 gi|205346397|gb|EDZ33030.1| putative ATP/GTP binding protein (Mrp protein ) [Campylobacter
           jejuni subsp. jejuni CG8421]
          Length = 368

 Score =  249 bits (635), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 135/343 (39%), Positives = 209/343 (60%), Gaps = 10/343 (2%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +K QI++ LK +  PG + +IV    + +I I  + V++ I +          +R N  +
Sbjct: 1   MKEQILEKLKTVKYPGFEKDIVSFNFVKDIKIQDDGVFIDIEIVSANPEVANEIRKNIIE 60

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKSTTVVNIA 117
            + ++  +KN  + +   K P ++ N+ +       VK F+ V+SGKGGVGKSTT VN+A
Sbjct: 61  ALSSL-ALKNIELNIITPKIPEEKSNSRSGKNIAPQVKNFIMVSSGKGGVGKSTTTVNLA 119

Query: 118 CALKNKGKNVAILDADVYGPSIPKLL-KISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
            ++   GK V ILDAD+YGP+IP++L +   + E+  ++ LKP   +G+ +MSM  L++E
Sbjct: 120 ISMAKMGKRVGILDADIYGPNIPRMLGETKTQPEVVGQR-LKPILTHGVYMMSMGVLIEE 178

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              ++WRG M+  AI  +L +V+W +LD L +DMPPGTGDA +T AQ IP++  V VSTP
Sbjct: 179 GQGLMWRGAMIMKAIEQLLADVIWPELDVLFLDMPPGTGDAQITSAQSIPITAGVCVSTP 238

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++L D KRA+ M+ K++IPI G+IENMS FL  D GK+YD+FG G A   A+      
Sbjct: 239 QTVSLDDSKRALDMFNKLHIPIAGVIENMSGFLCPDNGKEYDIFGKGTAEDMAKAYKSEV 298

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
           L  +P +M VR   D G P+  ++  S +S+ Y   +++I  F
Sbjct: 299 LAQIPIEMIVREGGDEGKPVSFYHPESVSSKRYLMAAEKIWSF 341


>gi|126726607|ref|ZP_01742447.1| Mrp/NBP35 family protein [Rhodobacterales bacterium HTCC2150]
 gi|126703936|gb|EBA03029.1| Mrp/NBP35 family protein [Rhodobacterales bacterium HTCC2150]
          Length = 359

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 126/352 (35%), Positives = 205/352 (58%), Gaps = 24/352 (6%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQL-QSLRSNAQQ 64
           ++ I+ +L  ++ P   N++    R+  + I    V   I V  +    L + +R+ A+ 
Sbjct: 5   RDSILAALANVTTP-AGNDLTASDRVRAVSIDDGDVKFVIEVLDSNEAVLYEGVRTAAEA 63

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNL--------------------NVKKFVAVASGK 104
            I+N+  V +    LT +   P                           V + +AVASGK
Sbjct: 64  AIKNLDGVNSVSAVLTAHSGAPAAPKLATPSLKIGGHPKPQAGPAQISGVDRILAVASGK 123

Query: 105 GGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYG 164
           GGVGKST   N+A AL  +G+ V +LDAD+YGPS P+++ I+ +    D K + P   +G
Sbjct: 124 GGVGKSTVSSNLAVALAKQGRRVGLLDADIYGPSQPRMMGINKRPGSPDGKKIIPLHAHG 183

Query: 165 IKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQK 224
           + +MS+  +VD + A++WRGPM+  A+  ML  V WG+LD L++D+PPGTGD  LT+ QK
Sbjct: 184 VTLMSIGFMVDPDKAVVWRGPMLMGALQQMLGQVEWGELDVLIVDLPPGTGDVQLTLCQK 243

Query: 225 IPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGG 284
             ++G ++VSTPQD+AL+D ++A+ M++ +N P++GMIENMS ++  + G +  +FG+GG
Sbjct: 244 THMTGALVVSTPQDVALLDARKALDMFKTLNTPVLGMIENMSSYICPECGNEAHIFGHGG 303

Query: 285 ARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              EAEK+G+PFL S+P  +DVR+  D G P+         ++ Y +++ R+
Sbjct: 304 VADEAEKLGLPFLGSLPLHLDVRMAGDAGTPVAAG--EGPLADAYGQLAGRL 353


>gi|94311699|ref|YP_584909.1| cobyrinic acid a,c-diamide synthase [Cupriavidus metallidurans
           CH34]
 gi|93355551|gb|ABF09640.1| antiporter inner membrane protein [Cupriavidus metallidurans CH34]
          Length = 362

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 123/333 (36%), Positives = 207/333 (62%), Gaps = 4/333 (1%)

Query: 8   QIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQ 67
           Q+ + L+ +  P    ++V  +    + +    V + + + +    Q + +R      ++
Sbjct: 7   QVTEVLRTVIDPNTGKDLVSTRSARNVRVDGGDVSVEVELGYPGKSQFEPIRKLVIGALR 66

Query: 68  NIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNK 123
           N+P V N  V ++     +  Q+   L   V+  +AVASGKGGVGKSTT VN+A AL  +
Sbjct: 67  NLPGVTNVSVAMSMKIVAHAVQRGVKLLPGVRNVIAVASGKGGVGKSTTAVNLALALAAE 126

Query: 124 GKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWR 183
           G  V +LDAD+YGPS+P +L I G+ E +D + ++P E +G++  S+  L++++  M+WR
Sbjct: 127 GARVGMLDADIYGPSLPMMLGIDGRPESTDGQTMEPMEGHGLQANSIGFLIEQDNPMVWR 186

Query: 184 GPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALID 243
           GPMV SA+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+AL+D
Sbjct: 187 GPMVTSALEQLLRQTNWHDLDYLIVDMPPGTGDIQLTLSQKVPVTGAVIVTTPQDIALLD 246

Query: 244 VKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFD 303
            ++ + M++K+ IPI+G++ENM+ +   + G    +FG GGA   + + G+  L S+P +
Sbjct: 247 ARKGLKMFEKVGIPILGIVENMAVYCCPNCGHVEHIFGEGGAERMSTEYGVDLLGSLPLN 306

Query: 304 MDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           + +R  +D G P VV   +S  S IY+E++ ++
Sbjct: 307 LSIREQADSGRPTVVAEPDSPISTIYREVARKV 339


>gi|16126334|ref|NP_420898.1| Mrp/Nbp345 family GTP-binding protein [Caulobacter crescentus CB15]
 gi|221235117|ref|YP_002517553.1| iron-sulfur cluster assembly/repair protein ApbC [Caulobacter
           crescentus NA1000]
 gi|13423578|gb|AAK24066.1| GTP-binding protein, Mrp/Nbp345 family [Caulobacter crescentus
           CB15]
 gi|220964289|gb|ACL95645.1| iron-sulfur cluster assembly/repair protein ApbC [Caulobacter
           crescentus NA1000]
          Length = 366

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 126/344 (36%), Positives = 195/344 (56%), Gaps = 27/344 (7%)

Query: 12  SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPT 71
           +L  ++ P     +V+   +  + + +      + VP ++      +R  A++ +  +P 
Sbjct: 11  ALDRIADPASGQGLVKAGLVQGLVVRNGRAGFMLEVPASVVASYAPVREAAEKALAALPG 70

Query: 72  VKNAVVTLTENKN----------------------PPQQRNNLNVKKFVAVASGKGGVGK 109
           V+ A V LT                          PP+     +V+  +AVASGKGGVGK
Sbjct: 71  VEQAQVVLTAQAAEGATRVRKGAKISEDPQARMVPPPEAEKPQHVRHVIAVASGKGGVGK 130

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMS 169
           ST   N+A A    G  V +LDAD+YGPS PK++ + G     ++K L+P E +G+K+MS
Sbjct: 131 STVSTNLAVAFAKMGLRVGLLDADIYGPSAPKMMGVDGDPLFENEK-LQPLEAHGVKLMS 189

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQ----LDFLLIDMPPGTGDAHLTIAQKI 225
           +  +VDE  AMIWRGPM  SA+  M+H+V WG     LD L++D+PPGTGD  LT+ QK+
Sbjct: 190 IGFIVDEGKAMIWRGPMASSAVRQMIHDVAWGSEAQPLDVLVVDLPPGTGDVQLTLVQKL 249

Query: 226 PLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGA 285
            + G V+V+TPQ++ALID +RA +M++K   PI+G+IENM++F    TG    +FG GG 
Sbjct: 250 RIDGAVLVTTPQEIALIDARRAAAMFEKTATPILGLIENMAFFADPSTGAPIPIFGEGGG 309

Query: 286 RFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
             EA ++ +P L  VP ++ VR+  D G+P V+       +E++
Sbjct: 310 VAEAARLNVPLLGRVPIEIAVRLGGDQGVPAVIGEPKGQAAEVF 353


>gi|322379364|ref|ZP_08053735.1| ATP-binding protein [Helicobacter suis HS1]
 gi|322380865|ref|ZP_08054955.1| ATP-binding plasmid-partitioning protein [Helicobacter suis HS5]
 gi|321146716|gb|EFX41526.1| ATP-binding plasmid-partitioning protein [Helicobacter suis HS5]
 gi|321148182|gb|EFX42711.1| ATP-binding protein [Helicobacter suis HS1]
          Length = 365

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 131/350 (37%), Positives = 207/350 (59%), Gaps = 18/350 (5%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + ++ ++D LK +  P  + +IV    +  I +    V L + +P + A   Q+LR++  
Sbjct: 2   VTQDTVLDVLKTVIYPNFEKDIVSFGFVKNITLHEKKVALLLDIPSSSAEVAQTLRTDIM 61

Query: 64  QIIQNIPTVKNAVVTLTENKNPP---------QQRNNL--NVKKFVAVASGKGGVGKSTT 112
             +Q +      ++   + K PP         Q   NL  N+K  V ++SGKGGVGKSTT
Sbjct: 62  AKMQEL-----DLICQIDIKTPPKRERQSQQEQTTKNLAPNIKHVVMISSGKGGVGKSTT 116

Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDK--KFLKPKENYGIKIMSM 170
            VN+A AL  + K V +LDADVYGP++P++L +      +D   K L P E YGI++MSM
Sbjct: 117 SVNLAIALAQQDKKVGLLDADVYGPNVPRMLGLMTTNPTTDPSGKKLIPLEAYGIRVMSM 176

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGV 230
             L +E  ++IWRGPM+  AI  ML +++WG+LD L++DMPPGTGDA LT+AQ +P+S  
Sbjct: 177 GLLYEEGQSLIWRGPMLMRAIEQMLTDIIWGELDVLVVDMPPGTGDAQLTLAQAVPISAG 236

Query: 231 VIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAE 290
           + V+TPQ ++L D  R++ M+ ++NIPI G++ENMS F+      + D+FG    +  ++
Sbjct: 237 ITVTTPQTVSLDDASRSLDMFMRLNIPIAGIVENMSGFICPHCAHESDIFGKDTLQSLSK 296

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
           +     L  +P ++ VR   D G PI + N NSA S+ Y + + ++ +F 
Sbjct: 297 QYKTQVLAQIPIELQVREGGDKGTPITILNPNSAISQAYTQAAHKLLEFL 346


>gi|194290513|ref|YP_002006420.1| Na+/H+ antiporter [Cupriavidus taiwanensis LMG 19424]
 gi|193224348|emb|CAQ70359.1| Na+/H+ antiporter [Cupriavidus taiwanensis LMG 19424]
          Length = 374

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 124/334 (37%), Positives = 203/334 (60%), Gaps = 4/334 (1%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
            Q+ ++L+ +  P    ++V  +    I +    V L + + +    Q   +R      +
Sbjct: 18  EQVTEALRTVIDPNTGKDLVSTRSARNIRVDGGEVSLEVELGYPAKSQFDPIRKMVVAAV 77

Query: 67  QNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +P V N  V +      +  Q+   L   VK  +AVASGKGGVGKSTT VN+A AL  
Sbjct: 78  RQVPGVTNVSVAVNMKIVAHAVQRGVKLLPGVKNVIAVASGKGGVGKSTTAVNLALALAA 137

Query: 123 KGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIW 182
           +G  V +LDAD+YGPS+P +L I G+ E +D + ++P E +G++  S+  L++++  M+W
Sbjct: 138 EGARVGMLDADIYGPSLPMMLGIDGRPESADGQTMEPLEGHGLQANSIGFLIEQDNPMVW 197

Query: 183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI 242
           RGPMV SA+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+AL+
Sbjct: 198 RGPMVTSALEQLLRQTNWHDLDYLIVDMPPGTGDVQLTLSQKVPVTGAVIVTTPQDIALL 257

Query: 243 DVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPF 302
           D K+ + M++K+ IPI+G++ENM+ +   + G    +FG+GG        G+  L S+P 
Sbjct: 258 DAKKGLKMFEKVGIPILGIVENMAVYCCPNCGHVEHIFGHGGGEKMCADYGVDLLGSLPL 317

Query: 303 DMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           ++ +R  +D G P VV   +S  +E+Y+ I+ ++
Sbjct: 318 NLSIREQADSGRPTVVAEPDSPVAEMYRAIARKV 351


>gi|78185493|ref|YP_377928.1| MRP protein-like [Synechococcus sp. CC9902]
 gi|78169787|gb|ABB26884.1| MRP protein-like [Synechococcus sp. CC9902]
          Length = 360

 Score =  248 bits (634), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 121/350 (34%), Positives = 213/350 (60%), Gaps = 18/350 (5%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
            Q   +L+ +   G     +E+  + ++ I        + +P     Q + + + A++++
Sbjct: 5   EQATRALEQIKDAGSGKTTLELGWIDQVRISPPRAVFRLNLPGFAQSQRERIAAEARELL 64

Query: 67  QNIPTVKNAVVTLTENKNP------------PQQRNNL-NVKKFVAVASGKGGVGKSTTV 113
             +  + +  + + +   P            P +R ++  V++ +AV+SGKGGVGKST  
Sbjct: 65  MGLEGINDVQIEVGQAPTPSQGSIGQAGHGQPAERQSIPGVRQVIAVSSGKGGVGKSTVA 124

Query: 114 VNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV-EIS---DKKFLKPKENYGIKIMS 169
           VN+ACAL  +G  V +LDAD+YGP+ P +L I+ +  E++   D + +KP E+ GI ++S
Sbjct: 125 VNLACALAQQGLKVGLLDADIYGPNAPTMLGIANQTPEVTGSGDTQRIKPIESCGIAMVS 184

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           M  L+DE+  +IWRGPM+   I   L+   WG+ D L++D+PPGTGDA L++AQ +P++G
Sbjct: 185 MGLLIDEHQPVIWRGPMLNGIIRQFLYQAEWGERDVLVVDLPPGTGDAQLSLAQAVPMAG 244

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFE 288
           V+IV+TPQ ++L D +R ++M++++ IP++G++ENMS F+  D   ++Y LFG+GG R  
Sbjct: 245 VIIVTTPQLVSLQDARRGLAMFRQLGIPVLGVVENMSAFIPPDMPDRRYALFGSGGGRQL 304

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           A+   +P L  VP +M V+   D G PIV+   +SA+++ +  +++ +QQ
Sbjct: 305 ADDYEVPLLAQVPMEMPVQEGGDSGSPIVISRSSSASAKEFTALAELVQQ 354


>gi|16761096|ref|NP_456713.1| ATPase [Salmonella enterica subsp. enterica serovar Typhi str.
           CT18]
 gi|29141208|ref|NP_804550.1| ATPase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
 gi|213428245|ref|ZP_03360995.1| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|213609386|ref|ZP_03369212.1| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-2068]
 gi|213650019|ref|ZP_03380072.1| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
 gi|213864933|ref|ZP_03387052.1| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. M223]
 gi|289810790|ref|ZP_06541419.1| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. AG3]
 gi|289824249|ref|ZP_06543844.1| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-3139]
 gi|25309610|pir||AG0776 conserved hypothetical protein STY2383 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503394|emb|CAD02533.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136834|gb|AAO68399.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 369

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 200/341 (58%), Gaps = 13/341 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+     
Sbjct: 13  LRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWNSAFEVLKEQCSA 72

Query: 65  IIQNIPTVKNA-------VVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVVNI 116
            +  I   K         + TL   KN P     +N VK  +AV+SGKGGVGKS+T VN+
Sbjct: 73  DLLRITGAKAIDWKLSYNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAVNL 128

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVD 175
           A AL+ +G  V +LDAD+YGPSIP +L    +   S D   + P  ++G+   S+  LV 
Sbjct: 129 ALALEAEGAKVGVLDADIYGPSIPTMLGAEDQRPTSPDGTHMAPIMSHGLATNSIGYLVT 188

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
           ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+T
Sbjct: 189 DDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTT 248

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK    
Sbjct: 249 PQDIALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAQKLAEKYHTQ 308

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            L  +P  + +R   D G P VV    S  + IY+E++DR+
Sbjct: 309 LLGQMPLHISLREDLDRGTPTVVSRPESEFTAIYRELADRV 349


>gi|254226391|ref|ZP_04919979.1| mrp protein [Vibrio cholerae V51]
 gi|125621080|gb|EAZ49426.1| mrp protein [Vibrio cholerae V51]
          Length = 382

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 117/245 (47%), Positives = 164/245 (66%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K  +
Sbjct: 117 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGGKVGLLDADIYGPSVPLMLGKTKAKPVV 176

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 177 RDNKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 236

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+++P+IG++ENMSY +  
Sbjct: 237 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVDVPVIGLVENMSYHICR 296

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +D+R   D G+P VV   NS  +E Y  
Sbjct: 297 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIDMREDIDAGVPTVVARPNSEHTERYLA 356

Query: 332 ISDRI 336
           ++ R+
Sbjct: 357 LAQRV 361


>gi|237798784|ref|ZP_04587245.1| ATP-binding Mrp/Nbp35 family protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331021637|gb|EGI01694.1| ATP-binding Mrp/Nbp35 family protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 364

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 178/277 (64%), Gaps = 6/277 (2%)

Query: 66  IQNIPTVKNAVV----TLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I+N+  V +A V     ++ +K   Q     NVK  VAVASGKGGVGKSTT  N+A AL 
Sbjct: 66  IENLDGVLSASVDIKSVISAHKAQSQIPGLANVKNIVAVASGKGGVGKSTTAANLALALS 125

Query: 122 NKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
            +G  V ILDAD+YGPS   +  I    + +I D+K+  P E +GI++MSMA L D+N  
Sbjct: 126 REGARVGILDADIYGPSQGVMFGIPEGTRPKIKDQKWFVPIEAHGIEVMSMAFLTDDNTP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TPQDL
Sbjct: 186 MVWRGPMVSGALLQLVTQTAWNDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTPQDL 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D ++ + M++K++IP++G++ENM+  + S+ G    LFG GG    A +  +  L S
Sbjct: 246 ALLDARKGVEMFRKVSIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLASQYDVELLAS 305

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P  M +R  +D G P  +    S  + +YQE++  +
Sbjct: 306 LPLSMLIREQADGGKPTAIAEPESQIAMVYQELARHV 342


>gi|56477939|ref|YP_159528.1| Mrp-chromosome partitioning ATPase [Aromatoleum aromaticum EbN1]
 gi|56313982|emb|CAI08627.1| Mrp-ATPases involved in chromosome partitioning [Aromatoleum
           aromaticum EbN1]
          Length = 363

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 129/339 (38%), Positives = 204/339 (60%), Gaps = 7/339 (2%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + +  ++++LK +  P    + V  + +  + I  + V + + + +    Q +S+R    
Sbjct: 3   LTQESVIEALKGVVDPNTGKDFVSTRCVRNVSISGSDVRVELELGYPAKTQHESIREMLA 62

Query: 64  QIIQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACA 119
             I  +P    A + +      +  QQ   L   VK  +AVASGKGGVGKSTT VN+A A
Sbjct: 63  AAIATLPGAGRATIDVHSKVVAHAVQQGVKLLPGVKNIIAVASGKGGVGKSTTAVNLALA 122

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMASLVDENV 178
           L  +G  V +LDAD+YGPS P +L I   + E  D K ++P + +G+++MS+  LVD   
Sbjct: 123 LTAEGATVGLLDADIYGPSQPHMLGIGEQRPESLDGKTMEPLQAHGLQVMSIGFLVDVET 182

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            M+WRGPM   A+  +L    W  LD+L+IDMPPGTGD  LT++Q +PL+G VIV+TPQD
Sbjct: 183 PMVWRGPMATQALNQLLKETNWKDLDYLVIDMPPGTGDIQLTLSQSVPLTGAVIVTTPQD 242

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGN-GGARFEAEKIGIPFL 297
           +AL+D ++ + M++K+ +PIIG+IENMS  + S  G +  +FG  GG R  A+   +PFL
Sbjct: 243 IALLDARKGLKMFEKVGVPIIGVIENMSIHICSSCGHEEAIFGTRGGERLCAD-YNVPFL 301

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            ++P D+ +R  +D G P VV + +   +E+Y+ I+ ++
Sbjct: 302 GALPLDLQIRQETDGGAPTVVSDPDGRIAELYKAIARKV 340


>gi|17228148|ref|NP_484696.1| hypothetical protein alr0652 [Nostoc sp. PCC 7120]
 gi|75910779|ref|YP_325075.1| hypothetical protein Ava_4583 [Anabaena variabilis ATCC 29413]
 gi|17129998|dbj|BAB72610.1| alr0652 [Nostoc sp. PCC 7120]
 gi|75704504|gb|ABA24180.1| Protein of unknown function DUF59 [Anabaena variabilis ATCC 29413]
          Length = 356

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 128/343 (37%), Positives = 217/343 (63%), Gaps = 10/343 (2%)

Query: 1   MNQILKNQ-IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLR 59
           M  +L +Q +++ L+ +  P  + ++VE+  +  + I    V  ++ +        + + 
Sbjct: 1   MYDVLDSQSVLEVLRPVQDPELRKSLVELNMIRNVKIDGGQVSFTLVLTTPACPLREFIV 60

Query: 60  SNAQQIIQNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVN 115
            + Q+ ++ +P V +  V +T    + K+ P +     VK  +A++SGKGGVGKST  VN
Sbjct: 61  EDCQRAVKKLPGVTDVSVEVTAETPQQKSLPDRNGVPGVKNIIAISSGKGGVGKSTVAVN 120

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGK---VEISDK-KFLKPKENYGIKIMSMA 171
           +A AL   G  V +LDAD+YGP+ P +L +      V  ++K + L+P  N+G+K++SM 
Sbjct: 121 VAVALAQTGAKVGLLDADIYGPNDPTMLGLGDAQIVVRSTEKGEVLEPAFNHGVKLVSMG 180

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
            L+D +  +IWRGPM+   I   L+ V WG+LD+L++DMPPGTGDA LT+ Q +P+SG V
Sbjct: 181 FLIDRDQPVIWRGPMLNGVIRQFLYQVEWGELDYLIVDMPPGTGDAQLTLTQAVPMSGAV 240

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAE 290
           IV+TPQ++AL+D ++ + M+Q+MN+ ++G++ENMSYF+  D   K YD+FG+GG    A 
Sbjct: 241 IVTTPQNVALLDSRKGLRMFQQMNVAVLGIVENMSYFIPPDMPDKHYDIFGSGGGSKTAA 300

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           ++G+P L  +P ++  R+  D G+PIVV + +SA+++  + I+
Sbjct: 301 ELGVPLLGCIPLEISTRIGGDNGVPIVVADPDSASAKALKAIA 343


>gi|213418568|ref|ZP_03351634.1| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. E01-6750]
          Length = 352

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 129/340 (37%), Positives = 198/340 (58%), Gaps = 11/340 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+     
Sbjct: 13  LRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWNSAFEVLKEQCSA 72

Query: 65  IIQNIPTVKNA-------VVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIA 117
            +  I   K         + TL   KN P       VK  +AV+SGKGGVGKS+T VN+A
Sbjct: 73  DLLRITGAKAIDWKLSYNIATLKRVKNQPGING---VKNIIAVSSGKGGVGKSSTAVNLA 129

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDE 176
            AL+ +G  V +LDAD+YGPSIP +L    +   S D   + P  ++G+   S+  LV +
Sbjct: 130 LALEAEGAKVGVLDADIYGPSIPTMLGAEDQRPTSPDGTHMAPIMSHGLATNSIGYLVTD 189

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           + AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+TP
Sbjct: 190 DNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTTP 249

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK     
Sbjct: 250 QDIALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAQKLAEKYHTQL 309

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L  +P  + +R   D G P VV    S  + IY+E++DR+
Sbjct: 310 LGQMPLHISLREDLDRGTPTVVSRPESEFTAIYRELADRV 349


>gi|229588701|ref|YP_002870820.1| hypothetical protein PFLU1162 [Pseudomonas fluorescens SBW25]
 gi|229360567|emb|CAY47424.1| putativ ATP-binding protein [Pseudomonas fluorescens SBW25]
          Length = 364

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 126/280 (45%), Positives = 183/280 (65%), Gaps = 6/280 (2%)

Query: 63  QQIIQNIPTVKNAVV----TLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
           Q  I+ +  V++A V     +  +K   Q     NVK  VAVASGKGGVGKSTT  N+A 
Sbjct: 63  QMAIEGLEGVRSAKVDIQCVIAAHKAQAQIPGLANVKNVVAVASGKGGVGKSTTAANLAL 122

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKIS--GKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           AL  +G  V ILDAD+YGPS   +  I+   + ++ D+K+  P E+ G+++MSMA L D+
Sbjct: 123 ALAREGARVGILDADIYGPSQGVMFGIAEGTRPKVKDQKWFVPIESLGVEVMSMAFLTDD 182

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           N  M+WRGPMV  A++ ++    WG LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TP
Sbjct: 183 NTPMVWRGPMVSGALLQLVTQTAWGDLDYLVIDMPPGTGDIQLTLAQKVPVAGSVIVTTP 242

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QDLAL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A + G+  
Sbjct: 243 QDLALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLATQYGVEL 302

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L S+P  M +R  +D G P V+   +S  + IYQE++  +
Sbjct: 303 LASLPLSMSIREQADGGKPTVMAEPDSQIAMIYQELARHV 342


>gi|156741741|ref|YP_001431870.1| hypothetical protein Rcas_1760 [Roseiflexus castenholzii DSM 13941]
 gi|156233069|gb|ABU57852.1| protein of unknown function DUF59 [Roseiflexus castenholzii DSM
           13941]
          Length = 367

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 135/347 (38%), Positives = 212/347 (61%), Gaps = 18/347 (5%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSI--TVPHT-IAHQLQSLRSNA 62
           +  ++ +L  +  P    ++V  + +  + I  +TV  ++  T P   +  Q+Q     A
Sbjct: 13  EQAVLQALATVQEPELGGDLVSRKMIKNLVIDGDTVRFAVELTTPACPLKDQIQRECEEA 72

Query: 63  QQIIQNIPTVKNAV-VTLTENKNP----PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIA 117
            + I  IP  +N V +  T    P    P+Q     V   VAV++GKGGVGKST  VN+A
Sbjct: 73  LETIAGIP--RNRVSIEFTAQVRPRGGIPEQVAIPGVNHVVAVSAGKGGVGKSTVAVNLA 130

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGK----VEISD-KKFLKPKENYGIKIMSMAS 172
            AL  +G  V +LDADVYGPS+P ++ +  +    V   D +  + P E +GIK+MS+  
Sbjct: 131 VALAREGAQVGLLDADVYGPSVPLMMGVRSQQPEAVSGPDGEPRMLPIEAHGIKMMSIGF 190

Query: 173 LVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIP---LSG 229
           L+D+   +IWRGPMV   +   L+ V+W  LD+L+IDMPPGTGD  LT+AQ +    L+G
Sbjct: 191 LIDDRQPVIWRGPMVSQLLRQFLYQVLWAPLDYLIIDMPPGTGDIALTLAQSLQNAGLTG 250

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEA 289
           VV V+TPQ +A  DV +++ M++K+N+P++G+IENM+YF+A DTGK+YD+FG+GGA   A
Sbjct: 251 VVTVTTPQQVATADVLKSMEMFRKVNVPLLGIIENMAYFIAPDTGKRYDIFGSGGAARLA 310

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            ++GIP L  +P  + +R   D G P V+ N   A +++++E++ ++
Sbjct: 311 GQLGIPLLGQIPLGLSIREGGDHGQPAVLSNEPDAYADVFREVARKL 357


>gi|73540382|ref|YP_294902.1| cobyrinic acid a,c-diamide synthase [Ralstonia eutropha JMP134]
 gi|72117795|gb|AAZ60058.1| Cobyrinic acid a,c-diamide synthase [Ralstonia eutropha JMP134]
          Length = 362

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 125/334 (37%), Positives = 204/334 (61%), Gaps = 4/334 (1%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
            Q+ + L+ +  P    ++V  +    I +    V L + + +    Q + +R      +
Sbjct: 6   EQVTEVLRTVIDPNTGKDLVSTRSARNIRVDGGDVSLEVELGYPGKSQFEPIRKLVVAAV 65

Query: 67  QNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +P V N  V ++     +  Q+   L   VK  +AVASGKGGVGKSTT VN+A AL  
Sbjct: 66  RQLPGVSNVSVNISMKIVAHAVQRGVKLLAGVKNVIAVASGKGGVGKSTTAVNLALALAA 125

Query: 123 KGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIW 182
           +G  V +LDAD+YGPS+P +L I G+ E SD + ++P E +G++  S+  L++++  M+W
Sbjct: 126 EGARVGMLDADIYGPSLPMMLGIDGRPESSDGQTMEPLEGHGLQANSIGFLIEQDNPMVW 185

Query: 183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI 242
           RGPMV SA+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+AL+
Sbjct: 186 RGPMVTSALEQLLRQTNWHDLDYLIVDMPPGTGDIQLTLSQKVPVTGAVIVTTPQDIALL 245

Query: 243 DVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPF 302
           D K+ + M++K+ IPI+G++ENM+ +   + G    +FG GG        G+  L S+P 
Sbjct: 246 DAKKGLKMFEKVGIPILGIVENMAVYCCPNCGHVEHIFGQGGGEKMCADYGVDLLGSLPL 305

Query: 303 DMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           ++ +R  +D G P VV + +S  +E+Y+ I+ ++
Sbjct: 306 NLSIREQADSGRPTVVSDPDSPVAELYRGIARKV 339


>gi|86608252|ref|YP_477014.1| CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein
           [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86556794|gb|ABD01751.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein
           [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 360

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 118/335 (35%), Positives = 211/335 (62%), Gaps = 10/335 (2%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           I+++L+ +  P  + ++VE+  + +I +    V  ++ +        + +    +  I+ 
Sbjct: 11  ILEALRPVQDPELRRSLVELNMIRDIRVEPGRVAFTLVLTTPACPLREFIVEECKAAIRQ 70

Query: 69  IPTVKNAVVTLTEN--KNP--PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKG 124
           +  ++   VT+T    ++P  P +++   V+  +A++SGKGGVGK++  VN+A AL   G
Sbjct: 71  LAPIEAIDVTVTAETPRSPSLPNRQSIPGVRNIIAISSGKGGVGKTSVSVNVAVALAQSG 130

Query: 125 KNVAILDADVYGPSIPKLLKISGKVEISDKKF-----LKPKENYGIKIMSMASLVDENVA 179
             V +LDAD+YGP++P +L +  +  +  K+      + P ENYG+K++SM  LV  +  
Sbjct: 131 ARVGLLDADIYGPNVPLMLGLQDRSLVVQKREDGGEDIFPLENYGVKMVSMGLLVGRDQP 190

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           +IWRGPM+   I   L+ V WG+LD+L++DMPPGTGDA LT+ Q +PL+G VIV+TPQ +
Sbjct: 191 VIWRGPMLNGVIRQFLYQVQWGELDYLIVDMPPGTGDAQLTLVQAVPLAGAVIVTTPQSV 250

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPFLE 298
           AL+D ++ ++M++++ +PI+G++ENMSYF+  D   ++YD+FG+ G    A ++G+P L 
Sbjct: 251 ALLDSRKGLNMFRQLGVPILGIVENMSYFIPPDLPDRQYDIFGSEGGETTARELGVPLLG 310

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
            +P ++ +R   D G PIV+    SA+++  ++I+
Sbjct: 311 RIPLEIALRQGGDAGQPIVISQPESASAQALRQIA 345


>gi|307151641|ref|YP_003887025.1| ATPase-like protein [Cyanothece sp. PCC 7822]
 gi|306981869|gb|ADN13750.1| ATPase-like, ParA/MinD [Cyanothece sp. PCC 7822]
          Length = 353

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 122/337 (36%), Positives = 214/337 (63%), Gaps = 9/337 (2%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           I++ L+ +  P  + ++V++  +  + I   TV  ++ +        + +  + Q+ ++ 
Sbjct: 7   ILEVLRPVQDPELQKSLVDLNMIRNVKIEGETVSFTLVLTTPACPLREFIVEDCQKAVKQ 66

Query: 69  IPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKG 124
           +P V+   V +T    + K+ P +++   +K  +A++SGKGGVGKST  VN+A AL   G
Sbjct: 67  LPGVEKVQVEVTAETPQQKSLPDKQSVGGIKNILAISSGKGGVGKSTISVNVAVALAKAG 126

Query: 125 KNVAILDADVYGPSIPKLLKIS-GKVEI---SDKKFLKPKENYGIKIMSMASLVDENVAM 180
             V +LDAD+YGP+ P +L ++  ++++   ++   L+P  N+G+K++SM  L++ +  +
Sbjct: 127 AKVGLLDADIYGPNTPTMLGLTEAQIQVKQGANGDILEPAFNHGVKMVSMGFLINPDQPV 186

Query: 181 IWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLA 240
           IWRGPM+   I   L+ V WG LD+L++DMPPGTGDA LT+AQ +P++G VIV+TPQ ++
Sbjct: 187 IWRGPMLNGIIRQFLYQVNWGNLDYLVVDMPPGTGDAQLTLAQAVPMAGAVIVTTPQTVS 246

Query: 241 LIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKK-YDLFGNGGARFEAEKIGIPFLES 299
           L D +R + M+Q++ + ++G++ENMSYF+  D  ++ YDLFG+GG    A ++ +P L  
Sbjct: 247 LQDARRGLKMFQQLGVNVLGIVENMSYFIPPDLPERSYDLFGSGGGEKTARELQVPLLGC 306

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           VP ++ +R   D GIPIVV +  SA+++    I+ +I
Sbjct: 307 VPLEISLREGGDNGIPIVVGDPTSASAKALTAIAQQI 343


>gi|261211929|ref|ZP_05926215.1| Mrp protein [Vibrio sp. RC341]
 gi|260838537|gb|EEX65188.1| Mrp protein [Vibrio sp. RC341]
          Length = 365

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 164/245 (66%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV SGKGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L K   K  +
Sbjct: 100 GVKNIIAVTSGKGGVGKSTTAVNLALAIAKSGAKVGLLDADIYGPSVPLMLGKTKAKPVV 159

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P E +GI   S+  LVDE  A IWRGPM   A+  +L+   W  LD+L+IDMP
Sbjct: 160 RDNKWMQPIEAHGIATHSIGYLVDEADAAIWRGPMASKALAQLLNETEWPDLDYLVIDMP 219

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQ+IP++G VIV+TPQDLAL D ++  +M+ K+ +P+IG++ENMSY + S
Sbjct: 220 PGTGDIQLTLAQQIPVTGAVIVTTPQDLALADARKGAAMFAKVEVPVIGLVENMSYHICS 279

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G+K  +FG GGA+  A + G+  L  +P  +++R   D G+P VV    S  ++ Y E
Sbjct: 280 HCGEKEHIFGVGGAQTLAAEFGLSLLAQIPLHIEMREDIDAGVPTVVARPRSEHTQRYLE 339

Query: 332 ISDRI 336
           ++ R+
Sbjct: 340 LAQRV 344


>gi|313206298|ref|YP_004045475.1| ATPase-like, para/mind [Riemerella anatipestifer DSM 15868]
 gi|312445614|gb|ADQ81969.1| ATPase-like, ParA/MinD [Riemerella anatipestifer DSM 15868]
 gi|315023019|gb|EFT36032.1| Septum site-determining protein minD [Riemerella anatipestifer
           RA-YM]
 gi|325336259|gb|ADZ12533.1| ATPases involved in chromosome partitioning [Riemerella
           anatipestifer RA-GD]
          Length = 367

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 129/322 (40%), Positives = 192/322 (59%), Gaps = 19/322 (5%)

Query: 36  IVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLN-- 93
           ++ N VY+ +T      H+ + L +  +Q   +       VV   +  +P      LN  
Sbjct: 25  VMGNDVYIDMTAHSPAMHEKKKLEAAMKQAFAS--EFGEEVVLKLKIVSPEPSEAQLNQI 82

Query: 94  -------VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKIS 146
                  +K  +A+ASGKGGVGKST   N+A +L   G  V +LDAD+YGPS+P +    
Sbjct: 83  KGKEIPGIKNIIAIASGKGGVGKSTVAANLAISLVKMGFKVGLLDADIYGPSVPTMFDTE 142

Query: 147 GK----VEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQ 202
           G+    VE + +  +KP ENYG+K++S+      N A++WRGPM   A+  ML +  WG+
Sbjct: 143 GQKPISVEENGRNLMKPIENYGVKMLSIGYFSGANQAVVWRGPMAAKALNQMLRDAAWGE 202

Query: 203 LDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQ--KMNIPIIG 260
           LDFLLID+PPGTGD HL+I Q++P++G VIVSTPQ +AL DVK+ I+M+Q   +NIP++G
Sbjct: 203 LDFLLIDLPPGTGDIHLSIIQEVPITGAVIVSTPQHIALADVKKGIAMFQMESINIPVLG 262

Query: 261 MIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVH 319
           +IENM+YF   +    KY +FG  GA++ AE +GIP L  +P    +R   D+G P  + 
Sbjct: 263 LIENMAYFTPEELPDNKYYIFGKQGAQYMAEDLGIPVLGEIPLIQSIREAGDVGRPAALQ 322

Query: 320 NMNSATSEIYQEISDRIQQFFV 341
           +  S  +EIY E + ++ +  V
Sbjct: 323 D-GSKIAEIYTETTQKMVESLV 343


>gi|260061613|ref|YP_003194693.1| ATP-binding protein, Mrp/Nbp35 family protein [Robiginitalea
           biformata HTCC2501]
 gi|88785745|gb|EAR16914.1| ATP-binding protein, Mrp/Nbp35 family protein [Robiginitalea
           biformata HTCC2501]
          Length = 382

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 127/348 (36%), Positives = 209/348 (60%), Gaps = 22/348 (6%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           K +I  +L+ +++PGE  N+V    +  I +  + V + IT+ +     LQ+ +     I
Sbjct: 7   KQEIRKALEGITVPGEGENMVASGAVRNIQVFGDEVVVDITIKNP---SLQARKKTEVSI 63

Query: 66  IQNI--PTVKNAVVTLTENKNPPQQRNNLN---------VKKFVAVASGKGGVGKSTTVV 114
           +Q I     + A + +    + P ++   N         +   +AVASGKGGVGKST   
Sbjct: 64  LQTIHREVYEKAKIKVNVTVDAPAKKPAGNTIRGKAIPGIDNIIAVASGKGGVGKSTVTA 123

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGK----VEISDKKFLKPKENYGIKIMSM 170
           N+A  L   G  V +LDAD+YGPSIP +  ++G+    VE++ K  ++P ENYG+K++S+
Sbjct: 124 NLAVTLAQMGFRVGLLDADIYGPSIPIMFDVAGEKPLAVEVAGKSRMRPVENYGVKVLSI 183

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGV 230
               + + A+IWRGPM   A+  M+ +  WG+LDFLL+D+PPGTGD HL+I Q +P++G 
Sbjct: 184 GFFTEPDQAVIWRGPMAAKALNQMIFDAHWGELDFLLVDLPPGTGDIHLSIMQSLPITGA 243

Query: 231 VIVSTPQDLALIDVKRAISMYQK--MNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARF 287
           V+VSTPQ +AL D ++ ++M+++  + +P++G++ENM+YF  ++    +Y +FG  GAR 
Sbjct: 244 VVVSTPQQIALADARKGVAMFRQEAIRVPVLGLVENMAYFTPAELPDNQYYIFGRHGARN 303

Query: 288 EAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
            AE + IPFL  +P    +R  SD+G P  +    + T E ++E++ R
Sbjct: 304 LAEDLDIPFLGEIPLVQGIREASDVGRPAALQE-GTPTREAFEELTRR 350


>gi|33592562|ref|NP_880206.1| putative iron sulfur binding protein [Bordetella pertussis Tohama
           I]
 gi|33596546|ref|NP_884189.1| putative iron sulfur binding protein [Bordetella parapertussis
           12822]
 gi|33566315|emb|CAE37228.1| putative iron sulfur binding protein [Bordetella parapertussis]
 gi|33572208|emb|CAE41756.1| putative iron sulfur binding protein [Bordetella pertussis Tohama
           I]
 gi|332381980|gb|AEE66827.1| putative iron sulfur binding protein [Bordetella pertussis CS]
          Length = 365

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/239 (46%), Positives = 170/239 (71%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NVK  +AVASGKGGVGKSTT VN+A AL  +G  V +LDAD+YGPS  +++ I G+ +  
Sbjct: 95  NVKNVIAVASGKGGVGKSTTAVNLALALAAEGARVGLLDADIYGPSQAQMMGIEGRPQSE 154

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P ENYG+++MS+  LVD + AMIWRGPM   A+  +L    W  LD+L+IDMPP
Sbjct: 155 DGKTMEPLENYGVQVMSIGFLVDADEAMIWRGPMAVQALEQLLRQTNWKNLDYLVIDMPP 214

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD HLT++QK+P++G VIV+TPQD+AL+D ++ + M++K+ +PI+G++ENM+  + S 
Sbjct: 215 GTGDIHLTLSQKVPVTGAVIVTTPQDIALLDARKGVKMFEKVGVPIVGVVENMAVHVCSQ 274

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
            G    +FG GG +  A+  G+ +L ++P D+++R  +D G P VV + +   + +Y++
Sbjct: 275 CGHAEHIFGQGGGQRMAQDYGLAYLGALPLDINIRQQADGGRPSVVADPDGEVAGLYKD 333


>gi|113868898|ref|YP_727387.1| ATPase involved in chromosome partitioning [Ralstonia eutropha H16]
 gi|113527674|emb|CAJ94019.1| ATPase involved in chromosome partitioning [Ralstonia eutropha H16]
          Length = 362

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 124/334 (37%), Positives = 203/334 (60%), Gaps = 4/334 (1%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
            Q+ ++L+ +  P    ++V  +    I +    V L + + +    Q   +R      +
Sbjct: 6   EQVTEALRTVIDPNTGKDLVSTRSARNIRVDGGDVSLEVELGYPAKSQFDPIRKLVVAAV 65

Query: 67  QNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +P V N  V +T     +  Q+   L   VK  +AVASGKGGVGKSTT VN+A AL  
Sbjct: 66  RQVPGVSNVSVAVTMKIVAHAVQRGVKLLPGVKNVIAVASGKGGVGKSTTAVNLALALAA 125

Query: 123 KGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIW 182
           +G  V +LDAD+YGPS+P +L I G+ E +D + ++P E +G++  S+  L++++  M+W
Sbjct: 126 EGARVGMLDADIYGPSLPMMLGIDGRPESADGQTMEPLEGHGLQANSIGFLIEQDNPMVW 185

Query: 183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI 242
           RGPMV SA+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+AL+
Sbjct: 186 RGPMVTSALEQLLRQTNWHDLDYLIVDMPPGTGDVQLTLSQKVPVTGAVIVTTPQDIALL 245

Query: 243 DVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPF 302
           D K+ + M++K+ IPI+G++ENM+ +   + G    +FG+GG        G+  L S+P 
Sbjct: 246 DAKKGLKMFEKVGIPILGIVENMAVYCCPNCGHVEHIFGHGGGEKMCADYGVDLLGSLPL 305

Query: 303 DMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           ++ +R  +D G P VV   +S  + +Y+ I+ ++
Sbjct: 306 NLQIREQADSGRPTVVAEPDSPVAGMYRAIARKV 339


>gi|57504882|ref|ZP_00370857.1| ATP-binding protein (mpr) [Campylobacter coli RM2228]
 gi|305432411|ref|ZP_07401573.1| ATP/GTP-binding protein [Campylobacter coli JV20]
 gi|57019310|gb|EAL56012.1| ATP-binding protein (mpr) [Campylobacter coli RM2228]
 gi|304444450|gb|EFM37101.1| ATP/GTP-binding protein [Campylobacter coli JV20]
          Length = 368

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 134/343 (39%), Positives = 210/343 (61%), Gaps = 10/343 (2%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +K QI++ LK +  PG   +IV    + +I   +  V + + +  +     + LR N  +
Sbjct: 1   MKEQILEKLKSVKYPGFDKDIVSFNFVKDIKTENENVIVELEIVSSNPQVSEELRKNIDE 60

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKSTTVVNIA 117
            + ++  +KN  + +   K P ++ N+ +       VK F+ V+SGKGGVGKSTT VN+A
Sbjct: 61  ALASL-NLKNLQIHIITPKIPEEKSNSRSGKNIAPQVKNFIMVSSGKGGVGKSTTTVNLA 119

Query: 118 CALKNKGKNVAILDADVYGPSIPKLL-KISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
            ++   GK V ILDAD+YGP+IP++L +   + E+  ++ LKP  ++G+ +MSM  L++E
Sbjct: 120 ISMAKMGKRVGILDADIYGPNIPRMLGETKTQPEVVGQR-LKPILSHGVYMMSMGVLIEE 178

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              ++WRG M+  AI  +L +V+W +LD L +DMPPGTGDA +T AQ IP++  V VSTP
Sbjct: 179 GQGLMWRGAMIMKAIEQLLADVIWPELDVLFLDMPPGTGDAQITSAQSIPITAGVCVSTP 238

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++L D KRA+ M+ K++IPI G+IENMS FL  D GK+YD+FG G A   A+      
Sbjct: 239 QTVSLDDSKRALDMFNKLHIPIAGVIENMSGFLCPDNGKEYDIFGKGTAEDMAKAYKSEV 298

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
           L  +P +M VR   D G P+  ++  S +++ Y   +++I QF
Sbjct: 299 LAQIPIEMIVREGGDEGKPVSFYHPESVSAKRYLMAAEKIWQF 341


>gi|50539944|ref|NP_001002442.1| nucleotide-binding protein-like [Danio rerio]
 gi|49902885|gb|AAH76121.1| Nucleotide binding protein-like [Danio rerio]
          Length = 327

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 114/250 (45%), Positives = 173/250 (69%), Gaps = 2/250 (0%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACAL--KNKGKNVAILDADVYGPSIPKLL 143
           P+Q+    VK+ + VASGKGGVGKSTT VN+A  L    + K V +LDADV+GPS+PKL+
Sbjct: 66  PKQKPIAGVKEVIVVASGKGGVGKSTTAVNLALGLMANEQSKLVGLLDADVFGPSVPKLM 125

Query: 144 KISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQL 203
            + G  E+++K  ++P  N+GI  MS+  LV++   ++WRG MV SAI  ++  V WG L
Sbjct: 126 NLKGNPELTEKNLMRPLVNFGIPCMSIGFLVEDVAPIVWRGLMVMSAIEKLIRQVDWGNL 185

Query: 204 DFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIE 263
           D+L+IDMPPGTGD  L+I Q IP++G VIVSTPQD+AL+D +R   M++K+N+P++G+++
Sbjct: 186 DYLVIDMPPGTGDVQLSITQNIPIAGAVIVSTPQDIALMDARRGAEMFRKVNVPVLGLVQ 245

Query: 264 NMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS 323
           NMS F       +  +FG+ GA+  A+ +G+  L  +P  +++R  SD+G P+VV + +S
Sbjct: 246 NMSVFQCPKCNHQTHIFGSDGAKELAQTLGVELLGDIPLHLNIRETSDMGQPVVVSSPDS 305

Query: 324 ATSEIYQEIS 333
             +E Y+ I+
Sbjct: 306 PEAEAYRRIA 315


>gi|154149239|ref|YP_001406254.1| Mrp protein [Campylobacter hominis ATCC BAA-381]
 gi|153805248|gb|ABS52255.1| Mrp protein [Campylobacter hominis ATCC BAA-381]
          Length = 356

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 134/338 (39%), Positives = 208/338 (61%), Gaps = 14/338 (4%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           K++I++ LK +  PG K +IVE   + EI    + + + + +        Q L+    +I
Sbjct: 3   KDKILEILKSVIYPGFKKSIVEYGFVKEID-CKDGIKIVLEIVSANPKISQDLK---DEI 58

Query: 66  IQNIPTVKNAVVTLTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKSTTVVNIAC 118
           +  IP   NA V + + K  P+  N+ +       +K FV ++SGKGGVGKSTT +N+A 
Sbjct: 59  LSKIP---NADVIINKPKIEPEHSNSRSGRNIAPQIKHFVMISSGKGGVGKSTTTLNLAI 115

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENV 178
           ++   GK V +LDAD+YGP+IP+++  +        + LKP  ++G+++MSM  LV+   
Sbjct: 116 SMAKLGKKVGLLDADIYGPNIPRMMGENNVQPTIIGQKLKPILSHGVEMMSMGILVEAGQ 175

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            +IWRG M+  A+  +L +V W  LD L IDMPPGTGDA +TIAQ +P+S  + V+TPQ 
Sbjct: 176 GLIWRGAMIMKAVQQLLQDVAWSDLDVLFIDMPPGTGDAQITIAQSVPVSAGICVTTPQT 235

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +AL D  RA+ M++K++IP+ G+IENMS F+  D GK+YD+FG+GGA   A+K     L 
Sbjct: 236 VALDDSARALDMFEKLHIPLAGLIENMSGFICPDNGKEYDIFGHGGAEILAKKYNCEVLG 295

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +P +M +R   D G PI  +  NS +SE Y +I++++
Sbjct: 296 EIPIEMAIREGGDDGKPISFYAPNSVSSERYAKIAEKL 333


>gi|297804198|ref|XP_002869983.1| hypothetical protein ARALYDRAFT_492911 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297315819|gb|EFH46242.1| hypothetical protein ARALYDRAFT_492911 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 312

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 167/242 (69%), Gaps = 1/242 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK-NVAILDADVYGPSIPKLLKISGKVEI 151
            VK  +AVASGKGGVGKS+T VN+A AL  K +  + +LDADVYGPS+P ++ I+ K ++
Sbjct: 41  GVKDIIAVASGKGGVGKSSTAVNLAVALATKCELKIGLLDADVYGPSVPIMMNINQKPQV 100

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           +    + P ENYG++ MSM  LV+++  ++WRGPMV SA+  M   V WG LD L++DMP
Sbjct: 101 NQDMKMIPVENYGVRCMSMGLLVEKDAPLVWRGPMVMSALAKMTRGVDWGDLDILVVDMP 160

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA +TI+Q + LSG VIVSTPQD+AL D  R ISM+ K+ +PI+G++ENMS F+  
Sbjct: 161 PGTGDAQITISQNLKLSGAVIVSTPQDVALADANRGISMFDKVRVPILGLVENMSCFVCP 220

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
              +   +FG  GAR  A K G+  +  +P +M +R  SD G+P+VV +  S  S+ Y++
Sbjct: 221 HCNEPSFIFGKEGARRTAAKKGLKLIGEIPLEMSIREGSDEGVPVVVSSPGSIVSKAYED 280

Query: 332 IS 333
           ++
Sbjct: 281 LA 282


>gi|206560983|ref|YP_002231748.1| putative ATP-binding protein [Burkholderia cenocepacia J2315]
 gi|198037025|emb|CAR52946.1| putative ATP-binding protein [Burkholderia cenocepacia J2315]
          Length = 363

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 130/335 (38%), Positives = 206/335 (61%), Gaps = 5/335 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I + Q+  +L  +  P         + +  + I  + V L + + +    Q   +R+   
Sbjct: 3   IDRAQVDAALAAVVDPNTGRPYAANKGVRNVAIDGDVVALDVVLGYPARSQHDDVRARVA 62

Query: 64  QIIQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACA 119
             +Q +P V++A V +++    +  Q+   L  NVK  VAVASGKGGVGKSTT VN+A A
Sbjct: 63  AALQAVPGVRDARVAVSQEIVAHTVQRGVKLLPNVKNIVAVASGKGGVGKSTTAVNLALA 122

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMASLVDENV 178
           L  +G +V ILDAD+YGPS+P +L I G + E  D + + P   +G++  S+  L++E+ 
Sbjct: 123 LAAEGASVGILDADIYGPSLPTMLGIHGQRPESPDNQSMNPLVGHGLQANSIGFLIEEDN 182

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            M+WRGPM  SA+  +L    W +LD+L++DMPPGTGD  LT+AQ++P++G VIV+TPQD
Sbjct: 183 PMVWRGPMATSALEQLLRQTNWRELDYLIVDMPPGTGDIQLTLAQRVPVTGAVIVTTPQD 242

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +AL+D K+ + M++K+ IPI+G++ENMS  + S+ G +  +FG GGA   A+  G+  L 
Sbjct: 243 IALLDAKKGLKMFEKVGIPILGIVENMSIHICSNCGHEEHIFGAGGAERMAQDYGVNVLG 302

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           S+P D+ +R  +D G P V    + A +  Y++I+
Sbjct: 303 SLPLDIAIRERADSGTPTVAAEPDGALARRYRDIA 337


>gi|268680325|ref|YP_003304756.1| ATPase-like, ParA/MinD [Sulfurospirillum deleyianum DSM 6946]
 gi|268618356|gb|ACZ12721.1| ATPase-like, ParA/MinD [Sulfurospirillum deleyianum DSM 6946]
          Length = 375

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/342 (37%), Positives = 212/342 (61%), Gaps = 12/342 (3%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           K  + + L  +  PG + +IV    +  I +  + VY+ + +  +       L+++ ++ 
Sbjct: 4   KESVQEQLSGVKYPGFEKDIVTFGFVKAIEVSESNVYVEVEIVSSSKDVGDELKASIEKA 63

Query: 66  IQNIPTVKNAVVTLTENKNPPQQRNNL--------NVKKFVAVASGKGGVGKSTTVVNIA 117
           I+ +   +  VV   +   PP +++N         ++K FV V+SGKGGVGK+TT VN+A
Sbjct: 64  IKALGAGRVDVVV--KQPKPPVEKSNSQSGKNMAPHIKNFVMVSSGKGGVGKTTTTVNLA 121

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGK-VEISDKKFLKPKENYGIKIMSMASLVDE 176
            AL ++GK V +LDAD+YGP++P+++ +  K  E+  +K +KP   YGI++MSM SL++ 
Sbjct: 122 IALASQGKKVGLLDADIYGPNVPRMMGVVDKHPEVVGQK-VKPIVAYGIEMMSMGSLMEG 180

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
             ++IWRG M+  AI  +L +++W  LD L IDMPPGTGDA LT+AQ +P++  + V+TP
Sbjct: 181 GQSLIWRGAMIMKAIEQLLRDILWSDLDVLFIDMPPGTGDAQLTLAQSVPVTAGICVTTP 240

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q +AL D +R++ M+QK++IPI G++ENMS F+  +T K+YD+FG G  +  AEK G   
Sbjct: 241 QQVALDDTERSLDMFQKLHIPIAGIMENMSGFICPETNKEYDIFGKGTTKPLAEKFGTIV 300

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           +  +P +  VR   D G P+   +  S T++ YQE + ++ +
Sbjct: 301 IGEIPIEPAVREGGDAGKPVSFFHPESETAKRYQESAKKLWE 342


>gi|163738704|ref|ZP_02146118.1| imidazoleglycerol-phosphate dehydratase [Phaeobacter gallaeciensis
           BS107]
 gi|161388032|gb|EDQ12387.1| imidazoleglycerol-phosphate dehydratase [Phaeobacter gallaeciensis
           BS107]
          Length = 356

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/332 (38%), Positives = 201/332 (60%), Gaps = 19/332 (5%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHT-IAHQLQSLRSNAQQI 65
           ++I D+L  L +P +   +V    L  + +    V   I  P+  IA Q++ LR  A+  
Sbjct: 6   DEIRDALARLQLP-DGGTLVSRDMLRALMVDGGRVSFVIEAPNPQIAAQMEPLRRAAEAT 64

Query: 66  IQNIPTVKNAVVTLTENKN--------------PPQQRNNL---NVKKFVAVASGKGGVG 108
           +  +P V++    LT + +              P  Q+  +    VK+ +A+ SGKGGVG
Sbjct: 65  VLALPGVESVSAALTAHADAVAKPAPTLKLGGHPKPQQGPMKPSGVKRILAIGSGKGGVG 124

Query: 109 KSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIM 168
           KST   N+A AL  +G+ V +LDAD+YGPS P+++  SG+    D K ++P   +G+ +M
Sbjct: 125 KSTVSANLAVALTRQGRKVGLLDADIYGPSQPRMMGASGRPASPDGKIIEPLHAHGVTLM 184

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           S+  +VDE  A++WRGPM+  A+  ML  V WG+LD L++D+PPGTGD  LT+  K  LS
Sbjct: 185 SIGFMVDEAKAVVWRGPMLMGALQQMLGQVNWGELDVLIVDLPPGTGDVQLTLCTKAELS 244

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFE 288
           G ++VSTPQD+AL+D ++A+ M+  +  P++G+IENMS+F   D G ++ +FG+GG   E
Sbjct: 245 GAIVVSTPQDVALLDARKALDMFNTLKTPVLGLIENMSFFTCPDCGGEHHIFGHGGVAAE 304

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHN 320
           AE++G+P L ++P D+D R+  D G PI   +
Sbjct: 305 AERLGVPLLGALPIDLDTRLAGDSGTPIAAGD 336


>gi|226330821|ref|ZP_03806339.1| hypothetical protein PROPEN_04742 [Proteus penneri ATCC 35198]
 gi|225201616|gb|EEG83970.1| hypothetical protein PROPEN_04742 [Proteus penneri ATCC 35198]
          Length = 377

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/339 (37%), Positives = 201/339 (59%), Gaps = 5/339 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           +IL  ++   L     P  K N++ ++ L +  ++ + +++ + +P       Q+L    
Sbjct: 19  EILNEKVSGVLSTFEHPTLKRNLLSLKALHQCAMIDDVLHIELVMPFVWKKPFQTLIEEK 78

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIAC 118
              ++NI   K     L  N +  ++ N+L     V+  +AV+SGKGGVGKS+T VN+A 
Sbjct: 79  TAELRNITGAKAIEWKLKHNISTLRRANDLPGVNGVRNILAVSSGKGGVGKSSTAVNLAL 138

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G  V ILDAD+YGPSIP +L  + +   S D + + P   YG+   S+  LV ++
Sbjct: 139 ALAQEGAKVGILDADIYGPSIPNMLGTTMERPTSPDGQHMAPIMAYGLASNSIGYLVTDD 198

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A+M ML + +W  LD+L+IDMPPGTGD  LT++Q IP++  V+V+TPQ
Sbjct: 199 NAMVWRGPMASKALMQMLQDTLWPDLDYLVIDMPPGTGDIQLTLSQNIPVTAAVVVTTPQ 258

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D  + I M++K+N+P++G+IENMS  + S+ G    +FG GGA   AEK     L
Sbjct: 259 DIALVDAMKGIVMFKKVNVPVLGIIENMSAHICSNCGHLEPIFGTGGAAKLAEKYHCQLL 318

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             VP  + +R   D G P V+ +     ++IY+EI+  +
Sbjct: 319 GQVPLHISLREDLDRGQPTVMRDPEGEFADIYREIASTV 357


>gi|157423523|gb|AAI53445.1| Nucleotide binding protein-like [Danio rerio]
          Length = 327

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 114/250 (45%), Positives = 173/250 (69%), Gaps = 2/250 (0%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACAL--KNKGKNVAILDADVYGPSIPKLL 143
           P+Q+    VK+ + VASGKGGVGKSTT VN+A  L    + K V +LDADV+GPS+PKL+
Sbjct: 66  PKQKPIAGVKEVIVVASGKGGVGKSTTAVNLALGLMANEQSKLVGLLDADVFGPSVPKLM 125

Query: 144 KISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQL 203
            + G  E+++K  ++P  N+GI  MS+  LV++   ++WRG MV SAI  ++  V WG L
Sbjct: 126 NLKGNPELTEKNLMRPLVNFGIPCMSIGFLVEDVAPIVWRGLMVMSAIEKLVRQVDWGNL 185

Query: 204 DFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIE 263
           D+L+IDMPPGTGD  L+I Q IP++G VIVSTPQD+AL+D +R   M++K+N+P++G+++
Sbjct: 186 DYLVIDMPPGTGDVQLSITQNIPIAGAVIVSTPQDIALMDARRGAEMFRKVNVPVLGLVQ 245

Query: 264 NMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS 323
           NMS F       +  +FG+ GA+  A+ +G+  L  +P  +++R  SD+G P+VV + +S
Sbjct: 246 NMSVFQCPKCNHQTHIFGSDGAKELAQTLGVELLGDIPLRLNIRETSDMGQPVVVSSPDS 305

Query: 324 ATSEIYQEIS 333
             +E Y+ I+
Sbjct: 306 PEAEAYRRIA 315


>gi|271499794|ref|YP_003332819.1| ParA/MinD-like ATPase [Dickeya dadantii Ech586]
 gi|270343349|gb|ACZ76114.1| ATPase-like, ParA/MinD [Dickeya dadantii Ech586]
          Length = 369

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 124/339 (36%), Positives = 204/339 (60%), Gaps = 5/339 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           ++L+  +   L   S P  KNN+  +  L    ++ + +++ +T+P      L  L+ + 
Sbjct: 11  EMLRAMVNGVLSSFSHPTLKNNLTTLNALHHCALLDDVLHIELTMPFVWLSGLADLKDSV 70

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIAC 118
            + +  +   +     LT N    ++ NN      VK  +AV+SGKGGVGKS+T VN+A 
Sbjct: 71  SEELLRLCGAREVEWRLTHNIATLRRVNNQAGVKGVKNIIAVSSGKGGVGKSSTAVNMAL 130

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G NV ILDAD+YGPSIP +L  + +   S D + + P   +G+   S+  LV ++
Sbjct: 131 ALAAEGANVGILDADIYGPSIPTMLGAASERPTSPDGQHMAPIMAHGLATNSIGYLVTDD 190

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A++ +L + +W  LD+L++DMPPGTGD  LT+AQ +P++G V+V+TPQ
Sbjct: 191 NAMVWRGPMASKALLQLLQDTLWPDLDYLVLDMPPGTGDIQLTLAQNVPVTGAVVVTTPQ 250

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D  + I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK     L
Sbjct: 251 DIALVDAMKGIVMFEKVKVPVLGIVENMSVHICSNCGHLEPIFGTGGAQKLAEKYHCALL 310

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P  + +R   D G P VV   +S  +++Y+E++ ++
Sbjct: 311 GQLPLHISLREDLDRGEPTVVSKPDSEFTQLYRELAGQV 349


>gi|257095557|ref|YP_003169198.1| hypothetical protein CAP2UW1_4025 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257048081|gb|ACV37269.1| protein of unknown function DUF59 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 363

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 129/330 (39%), Positives = 195/330 (59%), Gaps = 5/330 (1%)

Query: 12  SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPT 71
           +L+ L  P  + + +  +    I +    V L I + +    Q+  +R      ++ IP 
Sbjct: 11  ALRELIDPNTRKDFLSTRSARNIKVEGVDVALDIELGYPAKTQVDEIRRTVIAKLRTIPG 70

Query: 72  VKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNV 127
           + N    +T        +  L     VK  +AVASGKGGVGKSTT VN+A AL  +G  V
Sbjct: 71  IGNVSANVTVKIVAHTVQRGLKPLPGVKNIIAVASGKGGVGKSTTAVNLALALAQEGAVV 130

Query: 128 AILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPM 186
            +LDAD+YGPS P++L + G K E SD   + P   +G++ MS+  ++D +  M+WRGPM
Sbjct: 131 GLLDADIYGPSQPQMLGLVGQKPESSDGVSMDPLLAHGLQAMSIGFMIDIDSPMVWRGPM 190

Query: 187 VQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKR 246
           V  A+  +L    W  +D+L++DMPPGTGD  LT+AQK+P++G VIV+TPQD+ALID ++
Sbjct: 191 VTQALEQLLKQTNWQDVDYLVVDMPPGTGDTQLTLAQKVPVTGAVIVTTPQDIALIDARK 250

Query: 247 AISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDV 306
            + M++K+ IPIIG++ENMS  + S  G    +FG GG     +     FL ++P ++ +
Sbjct: 251 GLKMFEKVGIPIIGLVENMSIHICSQCGHAEHIFGEGGGEQMCKDYDTEFLGALPLELAI 310

Query: 307 RVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           R L+D G P VV   +S  +EIY+ I+ RI
Sbjct: 311 RELTDAGRPTVVGAPDSPAAEIYRTIARRI 340


>gi|116694905|ref|YP_729116.1| ATPase, nucleotide-binding protein Mrp [Ralstonia eutropha H16]
 gi|113529404|emb|CAJ95751.1| Predicted ATPase, nucleotide-binding protein Mrp [Ralstonia
           eutropha H16]
          Length = 362

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 123/334 (36%), Positives = 203/334 (60%), Gaps = 4/334 (1%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
            Q+ ++L+ +  P    ++V  +    I +    V L + + +    Q   +R      +
Sbjct: 6   EQVTEALRTVIDPNTGKDLVSTRSARNIRVDGGDVSLEVELGYPAKSQFDPIRELVVAAV 65

Query: 67  QNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +P V N  V +T     +  Q+   L   VK  +AVASGKGGVGKSTT VN+A AL  
Sbjct: 66  RQVPGVSNVSVAVTMKIVAHAVQRGVKLLPGVKNVIAVASGKGGVGKSTTAVNLALALAA 125

Query: 123 KGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIW 182
           +G  V +LDAD+YGPS+P +L I G+ E +D + ++P E +G++  S+  L++++  M+W
Sbjct: 126 EGARVGMLDADIYGPSLPMMLGIDGRPESADGQTMEPLEGHGLQANSIGFLIEQDNPMVW 185

Query: 183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI 242
           RGPMV SA+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+AL+
Sbjct: 186 RGPMVTSALEQLLRQTNWHDLDYLIVDMPPGTGDVQLTLSQKVPVTGAVIVTTPQDIALL 245

Query: 243 DVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPF 302
           D ++ + M++K+ IPI+G++ENM+ +   + G    +FG+GG        G+  L S+P 
Sbjct: 246 DARKGLKMFEKVGIPILGIVENMAVYCCPNCGHVEHIFGHGGGEKMCADYGVDLLGSLPL 305

Query: 303 DMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           ++ +R  +D G P VV   +S  + +Y+ I+ ++
Sbjct: 306 NLQIREQADSGRPTVVAEPDSPVAGMYRAIARKV 339


>gi|152980694|ref|YP_001353666.1| Mrp protein [Janthinobacterium sp. Marseille]
 gi|151280771|gb|ABR89181.1| Mrp protein [Janthinobacterium sp. Marseille]
          Length = 362

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 126/330 (38%), Positives = 201/330 (60%), Gaps = 4/330 (1%)

Query: 11  DSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIP 70
           ++L  +  P    ++V  +    I I  N V   + + +    Q+  +R  +   ++ I 
Sbjct: 10  EALTAVIDPNTGKDLVSSRSAKNIQINGNNVIFDVELGYPAKSQIDGIRKASIAAVRTIE 69

Query: 71  TVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKN 126
            + +    +      +  Q+   L  NVK  +AVASGKGGVGKSTT VN+A AL  +G  
Sbjct: 70  GMGSVTANVHSKIVAHSAQRGVKLMANVKNIIAVASGKGGVGKSTTSVNLALALAAEGAQ 129

Query: 127 VAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPM 186
           V ILDAD+YGPS P ++ ISG+ E  D K ++P ENYG+++ S+  ++D +  M+WRGP+
Sbjct: 130 VGILDADIYGPSQPMMMGISGRPETMDGKTMEPMENYGLQVSSIGFMIDPDEPMVWRGPI 189

Query: 187 VQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKR 246
           V  A+  +L    W  LD+L++DMPPGTGD  LT++QK+P++G VIV+TPQD+AL+D ++
Sbjct: 190 VTQALSQLLEQTNWRDLDYLIVDMPPGTGDIQLTMSQKVPVTGAVIVTTPQDIALLDARK 249

Query: 247 AISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDV 306
            + M++K+ IPI+G++ENMS  + S+ G    +FG GG      + G+ FL ++P  M +
Sbjct: 250 GLKMFEKVGIPILGIVENMSTHICSNCGHAEAIFGEGGGEKMCGEYGVDFLGALPLTMSI 309

Query: 307 RVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           R  +D G P VV + +   + IY++I+ +I
Sbjct: 310 RQQADSGKPTVVADPDGPIAVIYKQIARKI 339


>gi|42522680|ref|NP_968060.1| mrp protein [Bdellovibrio bacteriovorus HD100]
 gi|39573876|emb|CAE79053.1| mrp protein [Bdellovibrio bacteriovorus HD100]
          Length = 266

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 121/260 (46%), Positives = 181/260 (69%), Gaps = 3/260 (1%)

Query: 84  NPPQQRNNL-NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKL 142
           NP +++  +  VK  +AV+SGKGGVGKST   N+A AL  KG  V +LDAD+YGPSIP++
Sbjct: 5   NPFEKQTAIPGVKHIIAVSSGKGGVGKSTVATNLAMALGRKGGKVGLLDADIYGPSIPRM 64

Query: 143 L-KISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVW 200
           L  ++ K +I+ D   L+P   YGIK+MS+  LV+E  A++WRGPM+  A+   L +V W
Sbjct: 65  LGSLAQKPQINPDTNQLEPVVRYGIKLMSIGFLVEEGAAVVWRGPMLFKAMDQFLRDVNW 124

Query: 201 GQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIG 260
           G+LD+L++D+PPGTGD  LT+AQK+P+SG V+VSTPQ++AL+DVK+A+ M+ ++N+P++G
Sbjct: 125 GELDYLVVDLPPGTGDIQLTLAQKVPVSGAVMVSTPQNVALVDVKKAVDMFARVNVPLLG 184

Query: 261 MIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHN 320
           M+ENM+Y +    G+K  LF  G     A+  GI  L  +PF+  V +  + GIPIV  N
Sbjct: 185 MVENMAYMINPANGEKMQLFPKGEIDSYAQSKGINKLGEIPFNPSVGLACEAGIPIVEAN 244

Query: 321 MNSATSEIYQEISDRIQQFF 340
            N A ++ + +I+D I++  
Sbjct: 245 SNGAEAQAFMKIADEIRELL 264


>gi|145219269|ref|YP_001129978.1| hypothetical protein Cvib_0454 [Prosthecochloris vibrioformis DSM
           265]
 gi|145205433|gb|ABP36476.1| protein of unknown function DUF59 [Chlorobium phaeovibrioides DSM
           265]
          Length = 379

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 120/253 (47%), Positives = 171/253 (67%), Gaps = 3/253 (1%)

Query: 87  QQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKIS 146
           ++R    VK  +AVASGKGGVGKST  VN+A +L   G +V ++DAD+YGPSIP +  + 
Sbjct: 113 EERPLKEVKNIIAVASGKGGVGKSTVAVNLAVSLAATGASVGLVDADLYGPSIPTMFGLH 172

Query: 147 GKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFL 206
            +     +K L+P E YG+K+MS+  LV+ + A+IWRGPM  SAI   +  V WG+LD+L
Sbjct: 173 SEQPKVVEKMLQPLEKYGVKLMSIGFLVETDTALIWRGPMASSAIKQFITEVAWGELDYL 232

Query: 207 LIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMS 266
           + D+PPGTGD  LT+AQ IPL+G VIV+TPQD+AL DV +A++M+ K+N+PI+G+IENMS
Sbjct: 233 IFDLPPGTGDIQLTLAQTIPLTGAVIVTTPQDVALADVSKAVNMFAKVNVPILGVIENMS 292

Query: 267 YFLASDTGKKYDLFGN-GGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSAT 325
           ++   D  + Y LFG  GG RF A+  G+ FL SVP +  V    D G P V+   +S+ 
Sbjct: 293 WYELPDGSRDY-LFGQKGGERF-AKARGLAFLGSVPINRSVGEGGDSGTPAVIGTPDSSA 350

Query: 326 SEIYQEISDRIQQ 338
           +E ++  S  + +
Sbjct: 351 AEAFKSASKEVAR 363


>gi|167835832|ref|ZP_02462715.1| putative ATP-binding protein [Burkholderia thailandensis MSMB43]
          Length = 362

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 169/241 (70%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NVK  VAVASGKGGVGKSTT VN+A AL  +G +V ILDAD+YGPS+P +L I  + E  
Sbjct: 96  NVKNIVAVASGKGGVGKSTTAVNLALALAAEGASVGILDADIYGPSLPTMLGIHERPESP 155

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K + P   +G++  S+  LV E+  M+WRGPM  SA+  +L    W  LD+L++DMPP
Sbjct: 156 DNKSMNPLVGHGLQANSIGFLVGEDNPMVWRGPMATSALEQLLRQTNWRDLDYLIVDMPP 215

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQ++P++G VIV+TPQD+AL+D K+ + M++K+NIPI+G++ENMS  + S+
Sbjct: 216 GTGDIQLTLAQRVPVTGAVIVTTPQDIALLDAKKGLKMFEKVNIPILGIVENMSIHVCSN 275

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG GGA   A++ G+  L S+P D+ +R  +D G P VV + N A +E Y+ I
Sbjct: 276 CGHEEHVFGAGGAERMAQEYGVAVLGSLPLDIRIREQADSGAPSVVADPNGALAERYRAI 335

Query: 333 S 333
           +
Sbjct: 336 A 336


>gi|149410427|ref|XP_001512624.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
          Length = 425

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 118/253 (46%), Positives = 170/253 (67%), Gaps = 2/253 (0%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK--NKGKNVAILDADVYGPSIPKLL 143
           P+Q+    VK+ + VASGKGGVGKSTT VN+A AL   N  K V +LDADVYGPSIP+++
Sbjct: 165 PKQKPIEGVKQVLVVASGKGGVGKSTTAVNLALALTANNSSKTVGLLDADVYGPSIPRMM 224

Query: 144 KISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQL 203
            + G  E+++   ++P  NYGI  MSM  LV+E   +IWRG MV SA+  ++  V WG L
Sbjct: 225 NLKGNPELTESNLMRPLLNYGIACMSMGFLVEETAPVIWRGLMVMSAVEKLMRQVDWGHL 284

Query: 204 DFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIE 263
           D+L+IDMPPGTGD  L+I+Q IP+SG VIVSTPQD+AL+D ++   M++K+++P++G+++
Sbjct: 285 DYLVIDMPPGTGDVQLSISQNIPISGAVIVSTPQDIALMDAQKGAEMFRKVHVPVLGLVQ 344

Query: 264 NMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS 323
           NMS F       K  +FG  GAR  A+ +G+  L  +P  + +R  SD G PIV+   +S
Sbjct: 345 NMSVFQCPKCKHKTHIFGADGARKLAKNLGLDVLGDIPLHLSIRETSDSGQPIVLSQPHS 404

Query: 324 ATSEIYQEISDRI 336
             ++ Y  I+  +
Sbjct: 405 DEAKAYLRIASEV 417


>gi|168236319|ref|ZP_02661377.1| mrp protein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194735155|ref|YP_002115243.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|194710657|gb|ACF89878.1| mrp protein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197290637|gb|EDY29992.1| mrp protein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
          Length = 369

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 199/341 (58%), Gaps = 13/341 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+     
Sbjct: 13  LRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWNSAFEVLKEQCSA 72

Query: 65  IIQNIPTVKNA-------VVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVVNI 116
            +  I   K         + TL   KN P     +N VK  +AV+SGKGGVGKS+T VN+
Sbjct: 73  DLLRITGAKAIDWKLSYNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAVNL 128

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVD 175
           A AL  +G  V +LDAD+YGPSIP +L    +   S D   + P  ++G+   S+  LV 
Sbjct: 129 ALALAVEGAKVGVLDADIYGPSIPTMLGAEDQRPTSPDGTHMAPIMSHGLATNSIGYLVT 188

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
           ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+T
Sbjct: 189 DDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTT 248

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK    
Sbjct: 249 PQDIALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAQKLAEKYHTQ 308

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            L  +P  + +R   D G P VV    S  + IY+E++DR+
Sbjct: 309 LLGQMPLHISLREDLDRGTPTVVSRPESEFTAIYRELADRV 349


>gi|134094630|ref|YP_001099705.1| ATP-binding domain-containing protein [Herminiimonas
           arsenicoxydans]
 gi|133738533|emb|CAL61578.1| Protein Mrp homolog [Herminiimonas arsenicoxydans]
          Length = 362

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 114/244 (46%), Positives = 171/244 (70%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NVK  +AVASGKGGVGKSTT VN+A AL  +G  V ILDAD+YGPS P ++ ISG+ E +
Sbjct: 96  NVKNIIAVASGKGGVGKSTTSVNLALALAAEGAQVGILDADIYGPSQPMMMGISGRPESA 155

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P ENYG+++ S+  ++D +  M+WRGP+V  A+  +L    W  LD+L++DMPP
Sbjct: 156 DGKTMEPMENYGLQVSSIGFMIDPDEPMVWRGPIVTQALTQLLEQTNWRDLDYLIVDMPP 215

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++QK+P++G VIV+TPQD+AL+D ++ + M++K+ IPI+G++ENMS  + S+
Sbjct: 216 GTGDIQLTMSQKVPVTGAVIVTTPQDIALLDARKGLKMFEKVGIPILGIVENMSTHICSN 275

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    +FG GG      + G+ FL ++P  M +R  +D G P VV + +   + IY++I
Sbjct: 276 CGHAEAIFGAGGGEKMCGEYGVDFLGALPLTMSIRQQADSGKPTVVADPDGPIAVIYKQI 335

Query: 333 SDRI 336
           + +I
Sbjct: 336 ARKI 339


>gi|152992119|ref|YP_001357840.1| ATP-binding protein Mrp [Sulfurovum sp. NBC37-1]
 gi|151423980|dbj|BAF71483.1| ATP-binding protein Mrp [Sulfurovum sp. NBC37-1]
          Length = 370

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 127/344 (36%), Positives = 212/344 (61%), Gaps = 10/344 (2%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + +  ++++LK ++ PG   +IV    + +I I   T+ L+I +  +       LR +A 
Sbjct: 1   MTEENVLEALKNVTYPGFTKDIVTFGFVKDILINDKTIGLTIDITSSADEVKAQLRDDAT 60

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKSTTVVNI 116
           + +Q +   +N  + +   + P Q  N+++       VK FV V+SGKGGVGKSTT VN+
Sbjct: 61  KELQKL-GFENININIKAPEAPKQMSNSVSGKNIAPHVKSFVMVSSGKGGVGKSTTSVNL 119

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMASLVD 175
           A A+  +GK V +LDAD+YGP+IP+++ +   K EI   K L P + YG+++MSM SL++
Sbjct: 120 AIAMALQGKKVGLLDADIYGPNIPRMMGVDDQKPEIQGNKVL-PMKAYGVEVMSMGSLME 178

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
              ++IWRG M+  AI   L +++W +LD L+IDMPPGTGDA LT+AQ +P++  + V+T
Sbjct: 179 PGQSLIWRGSMIMKAIEQFLRDILWSELDVLVIDMPPGTGDAQLTLAQSVPVTAGITVTT 238

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQ+++L D +R++ M+QK++IP  G+IENMS F+  +   + D+FG G     A++    
Sbjct: 239 PQEVSLDDSRRSLDMFQKLHIPTAGIIENMSGFICPECHTESDIFGMGTTEPVAKEYDTH 298

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
            +  +P + ++RV  D G+P+  H  +S T++ YQ  +  +  F
Sbjct: 299 VIARIPIEPEIRVGGDTGMPVTYHKPDSETAKRYQAAATDLLAF 342


>gi|261822289|ref|YP_003260395.1| ATPase [Pectobacterium wasabiae WPP163]
 gi|261606302|gb|ACX88788.1| ATPase-like, ParA/MinD [Pectobacterium wasabiae WPP163]
          Length = 369

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 202/339 (59%), Gaps = 5/339 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +   L     P  KNN+  +  L    ++ N ++L +T+P      L +L+   
Sbjct: 11  EALRAMVTGVLSTFQHPTLKNNLTTLNALRHCALLDNVLHLELTMPFVWLSGLAALKETV 70

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIAC 118
              +  +   K     LT +    ++ N+      VK  +AV+SGKGGVGKS+T VN+A 
Sbjct: 71  SDELLRLSGAKAVEWRLTHDVATLRRVNDQAGVKGVKNIIAVSSGKGGVGKSSTAVNMAL 130

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G NV ILDAD+YGPSIP +L  + +   S D + + P   +G+   S+  LV ++
Sbjct: 131 ALAAEGANVGILDADIYGPSIPTMLGSASERPTSPDGQHMAPIIAHGLATNSIGYLVTDD 190

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A++ +L + +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+TPQ
Sbjct: 191 NAMVWRGPMASKALLQLLQDTLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTTPQ 250

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D  + I+M++K+++P++G++ENMS  + S+ G    +FG GGA+  AEK     L
Sbjct: 251 DIALMDAMKGIAMFEKVSVPVLGIVENMSVHICSNCGHLEPIFGTGGAQRLAEKYHCSLL 310

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P  + +R   D G P VV   +S  + +Y+E++ ++
Sbjct: 311 GQLPLHISLREDLDRGEPTVVSQPDSEFTYLYRELAGQV 349


>gi|329898090|ref|ZP_08272299.1| Mrp protein [gamma proteobacterium IMCC3088]
 gi|328920962|gb|EGG28387.1| Mrp protein [gamma proteobacterium IMCC3088]
          Length = 268

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 162/246 (65%), Gaps = 2/246 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKIS--GKVE 150
            +   +AVASGKGGVGKSTT VN+A AL+  GK V +LDAD+YGPS   +L ++   K E
Sbjct: 3   QIGAIIAVASGKGGVGKSTTAVNLALALQAMGKRVGLLDADIYGPSQAMMLGVAEGTKPE 62

Query: 151 ISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDM 210
              ++FL P E YG+K MSM  LV E   M+WRGPM   A+  ML   +WG LD L++DM
Sbjct: 63  TQGRQFLYPVEAYGLKTMSMGYLVTEKTPMVWRGPMAGGALTQMLDQTLWGDLDILIVDM 122

Query: 211 PPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLA 270
           PPGTGD  LT++QK  L+G VIV+TPQD+AL+D K+ I M+ K+++PI+G+IENM+  + 
Sbjct: 123 PPGTGDIQLTLSQKAALAGAVIVTTPQDIALLDAKKGIEMFGKVHVPILGLIENMAIHVC 182

Query: 271 SDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQ 330
           S  G +  +FG  GA   AE  G+  L S+P  + +R  SD G PIVV   +SA  E+Y+
Sbjct: 183 SHCGHQEAIFGADGAAQVAEDYGVEVLGSLPLALSIRESSDAGKPIVVAAPDSAEGELYK 242

Query: 331 EISDRI 336
             +  +
Sbjct: 243 NCAKNL 248


>gi|149378168|ref|ZP_01895885.1| ATPase involved in chromosome partitioning [Marinobacter algicola
           DG893]
 gi|149357530|gb|EDM46035.1| ATPase involved in chromosome partitioning [Marinobacter algicola
           DG893]
          Length = 366

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 168/246 (68%), Gaps = 2/246 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI--SGKVE 150
            VK  +AVASGKGGVGKSTT VN+A AL  +G  V ILDAD+YGPSI  +L +    + +
Sbjct: 98  GVKNIIAVASGKGGVGKSTTAVNLALALHAEGARVGILDADIYGPSIGMMLGVPEGKRPD 157

Query: 151 ISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDM 210
             + K+  P E +G++  SMA +V +   M+WRGPMV  A+M +L   +W +LD+L++DM
Sbjct: 158 TKENKYFVPMEAHGLQANSMAFVVTDKTPMVWRGPMVSGAVMQLLQQTLWNELDYLILDM 217

Query: 211 PPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLA 270
           PPGTGD  LTIAQK+P++G VIV+TPQD+AL+D K+ I M++K++I ++G++ENMS  + 
Sbjct: 218 PPGTGDIQLTIAQKVPVNGAVIVTTPQDIALLDGKKGIEMFRKVDISVLGVVENMSVHIC 277

Query: 271 SDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQ 330
           S+ G +  LFG+GG    AE+ G   L  +P  M +R  +D GIP VV   +S  +  Y+
Sbjct: 278 SNCGHEEPLFGHGGGERIAEEYGTTLLGQLPLHMTIREQTDGGIPSVVAEPDSEVARRYK 337

Query: 331 EISDRI 336
           +I+ R+
Sbjct: 338 DIARRV 343


>gi|224051401|ref|XP_002199717.1| PREDICTED: similar to nucleotide binding protein-like [Taeniopygia
           guttata]
          Length = 360

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 116/253 (45%), Positives = 170/253 (67%), Gaps = 2/253 (0%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK--NKGKNVAILDADVYGPSIPKLL 143
           P+Q+    VK+ V VASGKGGVGKSTT VNIA AL   +  K V +LDAD+YGPSIPK++
Sbjct: 99  PKQKPIEGVKQVVVVASGKGGVGKSTTAVNIALALAANDSAKEVGLLDADIYGPSIPKMM 158

Query: 144 KISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQL 203
            + G  E++ K  ++P +NYGI  MSM  L++E   ++WRG MV SA+  +L  V WGQL
Sbjct: 159 NLKGNPELTPKNLMRPLKNYGIACMSMGFLIEETAPVVWRGLMVMSAVEKLLRQVDWGQL 218

Query: 204 DFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIE 263
           D+L+IDMPPGTGD  L+++Q IP++G VIVSTPQD+AL+D  +   M++K+++P++G+++
Sbjct: 219 DYLVIDMPPGTGDVQLSVSQNIPIAGAVIVSTPQDVALLDAHKGAEMFRKVHVPVLGLVQ 278

Query: 264 NMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS 323
           NMS F       +  +FG  G R  A+ +G+  L  VP  +++R   D G P+V+    S
Sbjct: 279 NMSVFQCPKCKHETHIFGTDGVRDLAKTLGLDILGDVPLHINIRETCDSGQPVVISQPQS 338

Query: 324 ATSEIYQEISDRI 336
             ++ Y +I+  I
Sbjct: 339 DAAKAYLKIAMEI 351



 Score = 36.6 bits (83), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/27 (66%), Positives = 21/27 (77%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTT 112
           P+Q+    VK+ V VASGKGGVGKSTT
Sbjct: 24  PKQKPIEGVKQVVVVASGKGGVGKSTT 50


>gi|212712129|ref|ZP_03320257.1| hypothetical protein PROVALCAL_03211 [Providencia alcalifaciens DSM
           30120]
 gi|212685176|gb|EEB44704.1| hypothetical protein PROVALCAL_03211 [Providencia alcalifaciens DSM
           30120]
          Length = 382

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 127/343 (37%), Positives = 200/343 (58%), Gaps = 5/343 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           ++L  Q+   L   + P  K N++ ++ L    ++ N +++ + +P       Q+L S  
Sbjct: 24  ELLTEQVSTVLASFTHPTLKRNLISIKALHRCALLDNVLHVELVMPFVWKGPFQTLISEK 83

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIAC 118
              ++ +         L  +    ++ N+L     V+  +AV+SGKGGVGKS+T VN+A 
Sbjct: 84  TAELKQLTGAHAVEWKLRHDITTLKRANDLPGINGVRNILAVSSGKGGVGKSSTSVNLAL 143

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G  V ILDAD+YGPSIP +L  + +   S D + + P   YG+   S+  LV ++
Sbjct: 144 ALAQEGAKVGILDADIYGPSIPNMLGTTLERPTSPDGQHMAPIMAYGLATNSIGYLVTDD 203

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A+M ML + +W  LD+L+IDMPPGTGD  LT++Q IP++G V+V+TPQ
Sbjct: 204 NAMVWRGPMASKALMQMLQDTLWPDLDYLVIDMPPGTGDIQLTLSQNIPVTGAVVVTTPQ 263

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D  + I M++K+N+P++G++ENMS  + S+ G    +FG GGA   AEK     L
Sbjct: 264 DIALVDAMKGIVMFKKVNVPVLGVVENMSAHICSNCGHVEPIFGTGGAEKLAEKYNTKLL 323

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
             VP  + +R   D G P V+ +     ++IY+EI+  I    
Sbjct: 324 GQVPLHISLREDLDRGQPTVMRDPEGEFADIYREIASNISALM 366


>gi|148656235|ref|YP_001276440.1| hypothetical protein RoseRS_2109 [Roseiflexus sp. RS-1]
 gi|148568345|gb|ABQ90490.1| protein of unknown function DUF59 [Roseiflexus sp. RS-1]
          Length = 367

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 130/350 (37%), Positives = 212/350 (60%), Gaps = 16/350 (4%)

Query: 2   NQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSI--TVPHT-IAHQLQSL 58
           + + + +++ +L  +  P    ++V  + +  + I  +TV  ++  T P   +  Q+Q  
Sbjct: 9   DALSEQRVLQALSTVQEPELGGDLVSRRMIKNLVIDGDTVRFAVELTTPACPLKDQIQRE 68

Query: 59  RSNAQQIIQNIPTVKNAVVTLTENKNP----PQQRNNLNVKKFVAVASGKGGVGKSTTVV 114
              A + I  IP  +   +  T    P    P+      V   +AV++GKGGVGKST  V
Sbjct: 69  CEEALEKIAGIPR-ERVSIEFTAQVRPRGGIPEHVAIPGVSHVIAVSAGKGGVGKSTVAV 127

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGK----VEISD-KKFLKPKENYGIKIMS 169
           N+A AL  +G  V +LDADVYGPS+P ++ +  +    V   D +  + P E +GIK+MS
Sbjct: 128 NLAVALAREGAQVGLLDADVYGPSVPLMMGVRSQQPEAVSGPDGEPRMLPVEAHGIKMMS 187

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIP--- 226
           +  L+D+   +IWRGPMV   +   L+ V+W  LD+L+IDMPPGTGD  LT+AQ +    
Sbjct: 188 IGFLIDDRQPVIWRGPMVSQLLRQFLYQVLWAPLDYLIIDMPPGTGDIALTLAQSLQNAG 247

Query: 227 LSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGAR 286
           L+GVV V+TPQ +A  DV +++ M++K+N+P++G+IENM+YF+A DTGK+YD+FG+GGA 
Sbjct: 248 LTGVVTVTTPQQVATADVLKSMEMFRKVNVPLLGIIENMAYFVAPDTGKRYDIFGSGGAA 307

Query: 287 FEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             A ++G+P L  +P  + +R   D G P V+ ++  A ++++ EI+ ++
Sbjct: 308 RLAAQLGVPLLGQIPIGLSIREGGDHGQPAVLSDLPDAYADVFCEIARKL 357


>gi|77460727|ref|YP_350234.1| ParA family protein [Pseudomonas fluorescens Pf0-1]
 gi|77384730|gb|ABA76243.1| putativ ATP-binding protein [Pseudomonas fluorescens Pf0-1]
          Length = 364

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 124/280 (44%), Positives = 181/280 (64%), Gaps = 6/280 (2%)

Query: 63  QQIIQNIPTVKNAVV----TLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
           Q  I+N+  V  A V     +  +K   Q     NVK  VAVASGKGGVGKSTT  N+A 
Sbjct: 63  QLAIENLDGVVTARVEVNSVIAAHKAQAQIPGLANVKNVVAVASGKGGVGKSTTAANLAL 122

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           AL  +G  V ILDAD+YGPS   +  I    + ++ D+K+  P + +G+++MSMA L D+
Sbjct: 123 ALAREGAKVGILDADIYGPSQGIMFGIPEGTRPQVKDQKWFVPLQAHGVEVMSMAFLTDD 182

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           N  M+WRGPMV  A++ ++    WG LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TP
Sbjct: 183 NTPMVWRGPMVSGALLQLVTQTAWGDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTP 242

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QDLAL+D ++ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A + G+  
Sbjct: 243 QDLALLDARKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLATQFGVEL 302

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L S+P  M +R  +D G P V+   +S  + +YQE++  +
Sbjct: 303 LASLPLSMLIREQADGGKPTVISEPDSQIAMVYQELARHV 342


>gi|118594692|ref|ZP_01552039.1| ATP-binding protein involved in chromosome partitioning
           [Methylophilales bacterium HTCC2181]
 gi|118440470|gb|EAV47097.1| ATP-binding protein involved in chromosome partitioning
           [Methylophilales bacterium HTCC2181]
          Length = 361

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 115/241 (47%), Positives = 168/241 (69%), Gaps = 1/241 (0%)

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS- 152
           VK  +A+ASGKGGVGKSTT VN++ AL ++G  V ILDAD+YGPS PK+L IS +   S 
Sbjct: 95  VKNIIAIASGKGGVGKSTTAVNLSLALLSEGARVGILDADIYGPSQPKMLGISQEKPTSK 154

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P   +GI++MS+  LVD+   M+WRGPMV S +  +L    W  LD+L+ID+PP
Sbjct: 155 DGKSMEPLIAHGIQVMSIGFLVDQETPMVWRGPMVTSTLEQLLKETKWDDLDYLIIDLPP 214

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQKIP++G +IV+TPQD+AL+D ++ + M++K+N+PI+G++ENMS  + S+
Sbjct: 215 GTGDIQLTLAQKIPVTGAIIVTTPQDIALLDARKGLKMFEKVNVPIVGIVENMSTHICSN 274

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG GG    ++   +  L S+P D+ +R   D GIP VV   N   ++IY +I
Sbjct: 275 CGHEEHIFGEGGGLQMSKDYDVDLLGSLPLDITIREQLDNGIPTVVSGKNDKITKIYSDI 334

Query: 333 S 333
           +
Sbjct: 335 A 335


>gi|146412450|ref|XP_001482196.1| hypothetical protein PGUG_05216 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146392960|gb|EDK41118.1| hypothetical protein PGUG_05216 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 313

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 119/257 (46%), Positives = 172/257 (66%)

Query: 80  TENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSI 139
           T ++  P +R    VKK V V+S KGGVGKST   N+A +L+  GK V +LDAD++GPSI
Sbjct: 53  TMSQGLPIKRTIPGVKKIVLVSSAKGGVGKSTVTANLALSLQKLGKKVGVLDADLFGPSI 112

Query: 140 PKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVV 199
           P+L K+ G+  +S +  L P  NYGI+ MSM  L+     ++WRG MV  A+  +L  V 
Sbjct: 113 PRLFKLEGEPRLSSEGKLLPLSNYGIETMSMGYLIKPENPVVWRGLMVMKALQQLLFEVQ 172

Query: 200 WGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPII 259
           W  LD+L+IDMPPGTGD  LTI+Q++ ++G VIV+TPQD+ALID  + I+MY+K+NIP++
Sbjct: 173 WSGLDYLVIDMPPGTGDTQLTISQQLKVTGAVIVTTPQDIALIDAVKGIAMYEKVNIPVL 232

Query: 260 GMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVH 319
           G+++NMSY+L  +   +  +FGN GA  EAEK  I  L S+P + D+ + SD G P+V  
Sbjct: 233 GLVQNMSYYLCPNCNHESHIFGNDGAIREAEKRNIDVLGSIPLNEDICLQSDRGKPVVAS 292

Query: 320 NMNSATSEIYQEISDRI 336
           +  +  SE Y  I+ ++
Sbjct: 293 HPETPLSEPYISIAQKL 309


>gi|255536380|ref|YP_003096751.1| Septum site-determining protein minD [Flavobacteriaceae bacterium
           3519-10]
 gi|255342576|gb|ACU08689.1| Septum site-determining protein minD [Flavobacteriaceae bacterium
           3519-10]
          Length = 367

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 169/256 (66%), Gaps = 8/256 (3%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG----K 148
            ++  +AVASGKGGVGKST   NIA  L   G  V ILDAD+YGPS+P +    G     
Sbjct: 89  GIQNIIAVASGKGGVGKSTVASNIAVTLAKMGFKVGILDADIYGPSVPTMFDTVGGKPVS 148

Query: 149 VEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLI 208
           VEI  K  +KP ENYG+K++S+      N A++WRGPM   A+  M+ +  WG+LDFLLI
Sbjct: 149 VEIDGKNLMKPIENYGVKMLSIGYFSGANQAVVWRGPMASKALNQMIRDAAWGELDFLLI 208

Query: 209 DMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQ--KMNIPIIGMIENMS 266
           D+PPGTGD HL+I Q++P++G VIVSTPQ +AL DV++ I+M+Q   +NIP++G+IENMS
Sbjct: 209 DLPPGTGDIHLSIIQEVPVTGAVIVSTPQHIALADVRKGIAMFQMESINIPVLGLIENMS 268

Query: 267 YFLASDTGK-KYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSAT 325
           YF   +  + KY +FGN GA++ AE +GIP L  +P    +R   D+G P  + +  S  
Sbjct: 269 YFTPEELPENKYYIFGNQGAQYLAEDLGIPVLGEIPLVQSIREAGDVGRPAALQD-GSVI 327

Query: 326 SEIYQEISDRIQQFFV 341
           ++IY+ ++  + +  V
Sbjct: 328 ADIYRTVTQNMIESLV 343


>gi|149371975|ref|ZP_01891294.1| hypothetical protein SCB49_08798 [unidentified eubacterium SCB49]
 gi|149355115|gb|EDM43676.1| hypothetical protein SCB49_08798 [unidentified eubacterium SCB49]
          Length = 379

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 129/350 (36%), Positives = 207/350 (59%), Gaps = 18/350 (5%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           +I KN ++++LK +++ GE +N+V+   ++ + I  + V + +T+     H       + 
Sbjct: 2   KIEKNTVLEALKTITVAGEGSNMVDSGAVTNVMIFADEVIVDLTISTPALHIKNRAEKDI 61

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNLN---------VKKFVAVASGKGGVGKSTTV 113
           ++ I+N     +A V +      P +  N N         +K  +AVASGKGGVGKST  
Sbjct: 62  KETIKN-KVSSDAKVQVNIKVEAPAKPENPNLIKGKAIPGIKNIIAVASGKGGVGKSTVT 120

Query: 114 VNIACALKNKGKNVAILDADVYGPSIPKLLKISGK----VEISDKKFLKPKENYGIKIMS 169
            N+A +L   G  V ILDAD+YGPSIP +  +  +    V +  K  +KP ENYGIK++S
Sbjct: 121 SNLAISLAKMGFKVGILDADIYGPSIPLMFDVFNERPLSVNVDGKSKMKPVENYGIKVLS 180

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           +      N A+IWRGPM   A+  ++ +  WG+LDF+L+D+PPGTGD HL+I Q +P++G
Sbjct: 181 IGFFTKPNQAVIWRGPMAAKALNQLIFDADWGELDFMLLDLPPGTGDIHLSIMQSLPITG 240

Query: 230 VVIVSTPQDLALIDVKRAISMYQK--MNIPIIGMIENMSYFLASD-TGKKYDLFGNGGAR 286
            VIVSTPQ +AL D ++ ++M+++  +++P++G+IENMSYF   +    KY +FGNGG +
Sbjct: 241 SVIVSTPQTVALADARKGVAMFRQDSIDVPVLGLIENMSYFTPEELPDNKYYIFGNGGGK 300

Query: 287 FEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             AE + +PFL  +P    +R   D+G P  +    +  SE +  I+  +
Sbjct: 301 NLAEDLDMPFLGEIPLVQSIREAGDVGHPAALQE-GTPISEAFTAITRNV 349


>gi|311694184|gb|ADP97057.1| iron sulfur binding protein [marine bacterium HP15]
          Length = 379

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 125/305 (40%), Positives = 196/305 (64%), Gaps = 12/305 (3%)

Query: 41  VYLSITVPH---TIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL----N 93
           V L + +P+    IA  L+ L  NA   ++++  V+N  V + +  +  + + +L     
Sbjct: 55  VTLMVELPYPSKGIAGALKQLVGNA---LEDVDGVENVDVHVGQKIHSYKVQKDLPSVPG 111

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI--SGKVEI 151
           VK  +AVASGKGGVGKSTT VN+A AL+ +G  V ILDAD+YGPSI  +L +    + + 
Sbjct: 112 VKNIIAVASGKGGVGKSTTAVNLALALQAEGARVGILDADIYGPSIGMMLGVPEGKRPDT 171

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            + K+  P + +G++  SMA +V E   M+WRGPMV  A+M +L   +W +LD+L++DMP
Sbjct: 172 RENKYFVPMDAHGLQANSMAFVVTEKTPMVWRGPMVSGAVMQLLQQTLWNELDYLIVDMP 231

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQK+P++G VIV+TPQD+AL+D K+ I M++K++IP++G++ENMS  + S
Sbjct: 232 PGTGDIQLTLAQKVPVTGAVIVTTPQDIALLDGKKGIEMFRKVDIPVLGVVENMSVHICS 291

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
           + G +  LFG+GG    A++     L  +P  M +R  +D G P V+   +S  +  Y++
Sbjct: 292 NCGHEEPLFGHGGGERIAQEYDTTLLGQLPLHMTIREQTDGGTPSVIAEPDSEVARRYRD 351

Query: 332 ISDRI 336
           I+ R+
Sbjct: 352 IARRV 356


>gi|253990366|ref|YP_003041722.1| ATPase [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253781816|emb|CAQ84979.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 370

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 122/338 (36%), Positives = 204/338 (60%), Gaps = 5/338 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           +LK+Q+   L   +    +++++ ++ L    ++   +++ + +P       ++L+    
Sbjct: 13  LLKSQVTKILAAFTHLTLEHDLITLKALHRCTMLDGVLHIELVMPFVWQRGFETLKQATT 72

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIACA 119
           Q +Q     K+ V  L  + +  ++ N+L     V+  +AV+SGKGGVGKS+T VN+A A
Sbjct: 73  QKLQAATGAKSVVWKLIHDISTLRRANDLPGINGVRNILAVSSGKGGVGKSSTAVNLALA 132

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENV 178
           L  +G  V ILDAD+YGPS+P +L  + +   S D + + P   +G+   S+  LV ++ 
Sbjct: 133 LAQEGAKVGILDADIYGPSVPSMLGTTKERPTSPDGQHMAPIMTHGLATNSIGYLVTDDN 192

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
           AM+WRGPM   A+M ML + +W  LD+L+IDMPPGTGD  LT++Q IP++G ++++TPQD
Sbjct: 193 AMVWRGPMASKALMQMLQDTLWPDLDYLVIDMPPGTGDIQLTLSQNIPVTGAIVITTPQD 252

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +ALID  + I M+QK+ +P++G++ENMS  + S+ G    +FG GGA   A K     L 
Sbjct: 253 IALIDAMKGIVMFQKVKVPVLGIVENMSAHICSNCGHLEPIFGTGGAEKLAAKYNCKLLG 312

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +P  + +R   D G P V+ + +S  ++IY+EI+  I
Sbjct: 313 QIPLHISLREDLDRGQPTVISDPDSEFTDIYREIAANI 350


>gi|237808287|ref|YP_002892727.1| Mrp protein [Tolumonas auensis DSM 9187]
 gi|237500548|gb|ACQ93141.1| Mrp protein [Tolumonas auensis DSM 9187]
          Length = 357

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 164/245 (66%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            V+  +AV+SGKGGVGKSTT VN+A AL  +G  V +LDAD+YGPSIP LL K     EI
Sbjct: 93  GVRNIIAVSSGKGGVGKSTTAVNLALALHQEGAKVGLLDADIYGPSIPVLLGKAGAHPEI 152

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D+K ++P + + I   S+  LV E  A +WRGPM   A+  +L++  WG+LD+L++D+P
Sbjct: 153 IDEKHMRPVKAHSIVCNSIGFLVPETEAAVWRGPMASKALSQILYDTRWGELDYLVVDLP 212

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LTIAQ++P +  ++++TPQDLALID ++ ISM++K+NIP++G+IENMSY + S
Sbjct: 213 PGTGDIQLTIAQQVPTTAAIVITTPQDLALIDARKGISMFEKVNIPVLGVIENMSYHICS 272

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G K  +FG GG    AE+ GI  L  +P  + +R  SD G PIV        +  Y+ 
Sbjct: 273 KCGHKEKIFGEGGGIKVAEQYGIELLGQIPLHIQIREKSDDGTPIVAAEPTGKLAGTYKR 332

Query: 332 ISDRI 336
           I+ +I
Sbjct: 333 IARKI 337


>gi|115352533|ref|YP_774372.1| cobyrinic acid a,c-diamide synthase [Burkholderia ambifaria AMMD]
 gi|115282521|gb|ABI88038.1| Cobyrinic acid a,c-diamide synthase [Burkholderia ambifaria AMMD]
          Length = 363

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 207/335 (61%), Gaps = 5/335 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I + Q+  +L  +  P         + +  + I  + V + + + +    Q   +R+   
Sbjct: 3   IDRAQVDAALAAVVDPNTDRPYAAHKGVRNVAIDGDAVAVDVVLGYPARSQHDDVRARIA 62

Query: 64  QIIQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACA 119
             ++ +P V++A V +++    +  Q+   L  NVK  VAVASGKGGVGKSTT VN+A A
Sbjct: 63  AALKAVPGVRDARVAVSQEIVAHTVQRGVKLLPNVKNIVAVASGKGGVGKSTTAVNLALA 122

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMASLVDENV 178
           L  +G +V ILDAD+YGPS+P +L I G + E  D + + P   +G++  S+  L++E+ 
Sbjct: 123 LAAEGASVGILDADIYGPSLPTMLGIHGQRPESPDNQSMNPLIGHGLQANSIGFLIEEDN 182

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            M+WRGPM  SA+  +L    W +LD+L++DMPPGTGD  LT+AQ++P++G VIV+TPQD
Sbjct: 183 PMVWRGPMATSALEQLLRQTNWRELDYLIVDMPPGTGDIQLTLAQRVPVTGAVIVTTPQD 242

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +AL+D K+ + M++K+ IPI+G++ENMS  + S+ G +  +FG GGA   A++ G+  L 
Sbjct: 243 IALLDAKKGLKMFEKVGIPILGIVENMSIHICSNCGHEEHIFGAGGAERMAQEYGVNVLG 302

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           S+P D+ +R  +D G P V    + A +  Y++I+
Sbjct: 303 SLPLDIAIRERADSGTPTVAAEPDGALARRYRDIA 337


>gi|163752280|ref|ZP_02159479.1| ATP-binding protein, Mrp/Nbp35 family [Shewanella benthica KT99]
 gi|161327823|gb|EDP99004.1| ATP-binding protein, Mrp/Nbp35 family [Shewanella benthica KT99]
          Length = 371

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 171/245 (69%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG-KVEI 151
           NVK+ +AVASGKGGVGKSTT VN+A AL  +G  V ILDAD+YGPSIP +L +S  K E 
Sbjct: 106 NVKQVIAVASGKGGVGKSTTAVNLALALVAEGAKVGILDADIYGPSIPLMLGVSDFKPES 165

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K +   + +GI   S+  ++ ++ A +WRGPM   A+  +L++  W +LD+L+IDMP
Sbjct: 166 PDGKMMTVAKAHGIVAQSIGFMLGQDEAAVWRGPMAAGALAQLLNDTQWPELDYLIIDMP 225

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT++QK+P+SG +IV+TPQD+AL D K+ I+M+QK+NIP++G++ENMS+ + S
Sbjct: 226 PGTGDIQLTLSQKVPVSGAIIVTTPQDIALADAKKGINMFQKVNIPVLGIVENMSFHVCS 285

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
           + G K   FG+ G    AE+  +P L  +P  +++R   D G+P VV + +   S IY+E
Sbjct: 286 ECGHKEHPFGSHGGSKLAERYHVPLLGELPLKLNIREDVDKGVPTVVADPDCDVSAIYRE 345

Query: 332 ISDRI 336
           I+ ++
Sbjct: 346 IARKV 350


>gi|134296617|ref|YP_001120352.1| cobyrinic acid a,c-diamide synthase [Burkholderia vietnamiensis G4]
 gi|134139774|gb|ABO55517.1| Cobyrinic acid a,c-diamide synthase [Burkholderia vietnamiensis G4]
          Length = 363

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 124/285 (43%), Positives = 189/285 (66%), Gaps = 5/285 (1%)

Query: 54  QLQSLRSNAQQIIQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGK 109
           Q   +R+     +Q +P V++A V +++    +  Q+   L  NVK  VAVASGKGGVGK
Sbjct: 53  QHDDVRAGVAAALQAVPGVRDARVAVSQEIVAHTVQRGVKLLPNVKNIVAVASGKGGVGK 112

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIM 168
           STT VN+A AL  +G +V ILDAD+YGPS+P +L I G + E  D + + P   +G++  
Sbjct: 113 STTAVNLALALAAEGASVGILDADIYGPSLPTMLGIHGQRPESPDNQSMNPLVGHGLQAN 172

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           S+  L+DE+  M+WRGPM  SA+  +L    W +LD+L++DMPPGTGD  LT+AQ++P++
Sbjct: 173 SIGFLIDEDNPMVWRGPMATSALEQLLRQTNWRELDYLIVDMPPGTGDIQLTLAQRVPVT 232

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFE 288
           G VIV+TPQD+AL+D K+ + M++K+ IPI+G++ENMS  + S+ G +  +FG GGA   
Sbjct: 233 GAVIVTTPQDIALLDAKKGLKMFEKVGIPILGIVENMSIHVCSNCGHEEHIFGAGGAERM 292

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           A+   +  L S+P D+ +R  +D G P VV + + A +  Y++I+
Sbjct: 293 AKDYDVDVLGSLPLDIAIRERADSGTPTVVADPDGALARRYRDIA 337


>gi|119486201|ref|ZP_01620261.1| hypothetical protein L8106_17697 [Lyngbya sp. PCC 8106]
 gi|119456692|gb|EAW37821.1| hypothetical protein L8106_17697 [Lyngbya sp. PCC 8106]
          Length = 356

 Score =  245 bits (625), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 129/344 (37%), Positives = 214/344 (62%), Gaps = 9/344 (2%)

Query: 2   NQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSN 61
           N +  N +++ L+ +  P  + ++VE+  +  + I    V  ++ +        + +  +
Sbjct: 3   NSLDVNSVLEILRPVQDPELQKSLVELNMIRNVKINEGEVSFTLVLTTPACPLREFIVED 62

Query: 62  AQQIIQNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIA 117
            Q+ ++ +P V+   V +T    + K+ P ++    VK  +A++SGKGGVGKST  VN+A
Sbjct: 63  CQKALKQLPGVERVTVDVTAETPQQKSIPDRQGIEGVKNILAISSGKGGVGKSTVAVNVA 122

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDK----KFLKPKENYGIKIMSMASL 173
            AL   G  V ++DAD+YGP+ P ++ +S    I  +    + L+P  NYG+K++SMA L
Sbjct: 123 VALAQMGAKVGLIDADIYGPNDPTMMGLSDYQVIVHQGPQGEVLEPAFNYGVKLVSMAFL 182

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           +D +  +IWRGPM+   I   L+ V WG+LD+L++DMPPGTGDA LT+ Q +P+SGVVIV
Sbjct: 183 IDRDQPVIWRGPMLNGIIRQFLYQVQWGELDYLIVDMPPGTGDAQLTLVQAVPMSGVVIV 242

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKI 292
           +TPQ ++L+D ++ + M+Q++ + I+G++ENMSYF+  D   KKYD+FG+GG    A+++
Sbjct: 243 TTPQTVSLLDSRKGLRMFQQLGVSILGIVENMSYFIPPDLPDKKYDIFGSGGGEKTAKEL 302

Query: 293 GIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           G+  L  +P +M VR   D G+PIV+ +  SA +     I+ RI
Sbjct: 303 GVSLLGGIPLEMPVREGCDNGVPIVIAHPESAAAVELMAIAQRI 346


>gi|222111970|ref|YP_002554234.1| hypothetical protein Dtpsy_2800 [Acidovorax ebreus TPSY]
 gi|221731414|gb|ACM34234.1| protein of unknown function DUF59 [Acidovorax ebreus TPSY]
          Length = 363

 Score =  245 bits (625), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 170/241 (70%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            VK  +AVASGKGGVGKSTT  N+A AL  +G  V +LDAD+YGPS P +L IS + E  
Sbjct: 96  QVKNIIAVASGKGGVGKSTTAANLALALAAEGARVGVLDADIYGPSQPMMLGISRRPESE 155

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P ENYG+++MS+  LVD++ AMIWRGPM   A+  +L    W  LD+L+IDMPP
Sbjct: 156 DGKTMEPLENYGVQVMSIGFLVDQDEAMIWRGPMATQALEQLLRQTNWKDLDYLIIDMPP 215

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++Q++P++G VIV+TPQD+AL+D K+ I M++K+ +PI+G++ENM+  + S+
Sbjct: 216 GTGDIQLTLSQRVPMTGAVIVTTPQDIALLDAKKGIKMFEKVGVPILGIVENMAVHVCSN 275

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    +FG  G +  A   G+ +L ++P DM +R+ +D G P VV + +   ++IY+++
Sbjct: 276 CGHVEHIFGADGGKKMAADYGMDYLGALPLDMHIRLQADSGKPTVVADPDGEVAQIYKKV 335

Query: 333 S 333
           +
Sbjct: 336 A 336


>gi|167561953|ref|ZP_02354869.1| putative ATP-binding protein [Burkholderia oklahomensis EO147]
          Length = 288

 Score =  245 bits (625), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 117/241 (48%), Positives = 168/241 (69%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NVK  VAVASGKGGVGKSTT VN+A AL  +G +V ILDAD+YGPS+P +L I  + E  
Sbjct: 22  NVKNIVAVASGKGGVGKSTTAVNLALALAAEGASVGILDADIYGPSLPTMLGIHDRPESP 81

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K + P   +G++  S+  LV E+  M+WRGPM  SA+  +L    W +LD+L++DMPP
Sbjct: 82  DNKSMNPLVGHGLQANSIGFLVGEDNPMVWRGPMATSALEQLLRQTNWRELDYLIVDMPP 141

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQ++P++G VIV+TPQD+AL+D K+ + M++K+NIPI+G++ENMS  + S+
Sbjct: 142 GTGDIQLTLAQRVPVTGAVIVTTPQDIALLDAKKGLKMFEKVNIPILGIVENMSIHVCSN 201

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG GGA   A++ G+  L S+P D+ +R  +D G P V  + N   +E Y+ I
Sbjct: 202 CGHEEHIFGAGGAERMAKEYGVTVLGSLPLDIRIREQADGGAPTVAADPNGKLAERYRAI 261

Query: 333 S 333
           +
Sbjct: 262 A 262


>gi|119357806|ref|YP_912450.1| hypothetical protein Cpha266_2014 [Chlorobium phaeobacteroides DSM
           266]
 gi|119355155|gb|ABL66026.1| protein of unknown function DUF59 [Chlorobium phaeobacteroides DSM
           266]
          Length = 357

 Score =  244 bits (624), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 209/345 (60%), Gaps = 12/345 (3%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVH-NTVYLSITVPHTIAHQLQSLRSNA 62
           I + Q++ +LK ++ P  K ++V +  + +I I   N +  ++ +          +R + 
Sbjct: 2   IQEEQVLAALKTVAEPDLKKDLVTLGMIKDIHIDEANNIACTVVLTTPACPMKNQIRQSC 61

Query: 63  QQIIQ-NIP-------TVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVV 114
              I+ ++P       T+ + V +  ++     +R    VK  +AVASGKGGVGKST  V
Sbjct: 62  IDAIKTSLPEAGTIEITMSSKVTSSCDHHECDHERPLKEVKNIIAVASGKGGVGKSTVAV 121

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKI-SGKVEISDKKFLKPKENYGIKIMSMASL 173
           N+A +L  +G  V ++DAD+YGPSIP +  I   K EI  KK + P E YGIK+MS+  L
Sbjct: 122 NLAISLAREGAKVGLIDADLYGPSIPTMFGIYDAKPEIISKKLI-PLEKYGIKLMSIGFL 180

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V+ + A+IWRGPM  SAI   +++V W +LD+L+ D+PPGTGD  LT+ Q IP++G VIV
Sbjct: 181 VETDTALIWRGPMASSAIKQFINDVEWPELDYLIFDLPPGTGDIQLTLVQTIPVTGAVIV 240

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+AL DV +A++M++KM +PI+G+IENMS++   D  K Y +FG  G    A+   
Sbjct: 241 TTPQDVALADVSKAVNMFRKMQVPILGLIENMSHYELPDGTKDY-IFGMHGGENFAKAQA 299

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           I FL S+P D ++R   D G P+V+    S +++ + + +  + +
Sbjct: 300 IAFLGSIPIDREIREGGDKGKPVVLSQPRSVSAQAFSQATKEVAR 344


>gi|167569202|ref|ZP_02362076.1| putative ATP-binding protein [Burkholderia oklahomensis C6786]
          Length = 362

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 117/241 (48%), Positives = 168/241 (69%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NVK  VAVASGKGGVGKSTT VN+A AL  +G +V ILDAD+YGPS+P +L I  + E  
Sbjct: 96  NVKNIVAVASGKGGVGKSTTAVNLALALAAEGASVGILDADIYGPSLPTMLGIHDRPESP 155

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K + P   +G++  S+  LV E+  M+WRGPM  SA+  +L    W +LD+L++DMPP
Sbjct: 156 DNKSMNPLVGHGLQANSIGFLVGEDNPMVWRGPMATSALEQLLRQTNWRELDYLIVDMPP 215

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQ++P++G VIV+TPQD+AL+D K+ + M++K+NIPI+G++ENMS  + S+
Sbjct: 216 GTGDIQLTLAQRVPVTGAVIVTTPQDIALLDAKKGLKMFEKVNIPILGIVENMSIHVCSN 275

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG GGA   A++ G+  L S+P D+ +R  +D G P V  + N   +E Y+ I
Sbjct: 276 CGHEEHIFGAGGAERMAKEYGVTVLGSLPLDIRIREQADGGAPTVAADPNGKLAERYRAI 335

Query: 333 S 333
           +
Sbjct: 336 A 336


>gi|163858988|ref|YP_001633286.1| putative iron sulfur binding protein [Bordetella petrii DSM 12804]
 gi|163262716|emb|CAP45019.1| putative iron sulfur binding protein [Bordetella petrii]
          Length = 362

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 118/300 (39%), Positives = 190/300 (63%), Gaps = 4/300 (1%)

Query: 41  VYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKK 96
           V   + + +    Q+ +LRS      + +P V N  V L     P   +  +    N+K 
Sbjct: 39  VAFDVELGYPAKSQIPALRSALVAAARGVPGVGNVSVNLRTVIVPHTAQRGVALLPNIKN 98

Query: 97  FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKF 156
            +AVASGKGGVGKSTT VN+A AL  +G  V +LDAD+YGPS   ++ I  + +  D K 
Sbjct: 99  IIAVASGKGGVGKSTTAVNLALALAAEGARVGLLDADIYGPSQSLMMGIDARPQSDDGKT 158

Query: 157 LKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGD 216
           ++P ENYG+++MS+  LVD + AMIWRGPM   A+  +L    W  LD+L++DMPPGTGD
Sbjct: 159 MEPLENYGVQVMSIGFLVDPDEAMIWRGPMAVQALEQLLRQTNWKDLDYLVVDMPPGTGD 218

Query: 217 AHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKK 276
            HL+++QK+P++G VIV+TPQD+AL+D ++ + M++K+ +PI+G++ENM+  + S  G  
Sbjct: 219 IHLSLSQKVPVTGAVIVTTPQDIALLDARKGVKMFEKVGVPILGVVENMAVHVCSQCGHA 278

Query: 277 YDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +FG GG +  A    + +L ++P D+++R+ +D G P VV + +   + +Y+ ++ ++
Sbjct: 279 EHIFGAGGGKKMAADFNLAYLGALPLDINIRLQADSGQPSVVADPDGEVAGLYKAVARQV 338


>gi|330811330|ref|YP_004355792.1| hypothetical protein PSEBR_a4379 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379438|gb|AEA70788.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 364

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 183/280 (65%), Gaps = 6/280 (2%)

Query: 63  QQIIQNIPTVKNAVVTLTE----NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
           Q  I+ +  V  A V +T     +K   Q     NVK  +AVASGKGGVGKSTT  N+A 
Sbjct: 63  QMAIEALDGVSAAKVDITSVIAAHKAQAQVPGLANVKNVIAVASGKGGVGKSTTAANLAL 122

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKIS--GKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           AL  +G  V ILDAD+YGPS   +  ++   + ++ D+K+  P +++G+++MSMA L D+
Sbjct: 123 ALAREGAKVGILDADIYGPSQGIMFGVAEGTRPQVKDQKWFVPIQSHGVEVMSMAFLTDD 182

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           N  M+WRGPMV  A++ ++    WG LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TP
Sbjct: 183 NTPMVWRGPMVSGALLQLVTQTAWGDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTP 242

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QDLAL+D ++ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A + G+  
Sbjct: 243 QDLALLDARKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLATQYGVEL 302

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L S+P  M +R  +D G P V+   +S  + +YQE++  +
Sbjct: 303 LASLPLSMLIREQADGGKPTVIAEPDSQIAMVYQELARHV 342


>gi|328869486|gb|EGG17864.1| Mrp/NBP35 family protein [Dictyostelium fasciculatum]
          Length = 353

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 122/261 (46%), Positives = 177/261 (67%), Gaps = 5/261 (1%)

Query: 82  NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKN-KGKNVAILDADVYGPSIP 140
           NK+P Q+ +  N+K  +AV+S KGGVGKST  VN+A AL    G +V ILDADV+GPS+P
Sbjct: 82  NKDPNQKISLPNIKYIIAVSSAKGGVGKSTLSVNLALALNAMPGISVGILDADVFGPSLP 141

Query: 141 KLLKISGK---VEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHN 197
            ++ +  +   +E + K+ + P +NYGIK MSM  LV+E+ AMIWRGPMV  A+  +L +
Sbjct: 142 IMMNLRNQQPAIEETTKRMI-PLQNYGIKCMSMGFLVEEDDAMIWRGPMVMGALEKLLGS 200

Query: 198 VVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIP 257
             WG LD L++D+PPGTGDA LT+ Q++PLSG VI+STPQD+AL DV R + M+ K+NIP
Sbjct: 201 TAWGNLDVLVVDLPPGTGDAILTMCQRVPLSGAVIISTPQDVALADVIRGVKMFNKVNIP 260

Query: 258 IIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIV 317
           I+G++ENMS+F   +     ++FG  GA   A  +G+  L  VP ++D+R  +D G PI 
Sbjct: 261 ILGVVENMSHFECPNCNHSSNIFGKEGAVKTARDLGLELLGEVPINIDIRECADKGTPIT 320

Query: 318 VHNMNSATSEIYQEISDRIQQ 338
           +    S  + IY+ I+ ++ +
Sbjct: 321 ISQPESKQATIYKSIAKKMLE 341


>gi|16331499|ref|NP_442227.1| ATPase [Synechocystis sp. PCC 6803]
 gi|1709101|sp|P53383|MRP_SYNY3 RecName: Full=Protein mrp homolog
 gi|1001155|dbj|BAA10297.1| put. ATPase [Synechocystis sp. PCC 6803]
          Length = 353

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 215/339 (63%), Gaps = 9/339 (2%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
           + ++  L+ +  P  + ++VE+  + ++ I   TV  ++ +        + +  + ++ +
Sbjct: 5   DAVLTVLRPVQDPELQKSLVELNMIRDVAIAGGTVSFTLVLTTPACPLREFIVEDCEKAV 64

Query: 67  QNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +P V+   V +T    + K+ P +++   VK  +A++SGKGGVGKST  VN+A AL  
Sbjct: 65  KTLPGVEKVEVKVTAETPQQKSLPDRQSVGQVKNIIAISSGKGGVGKSTVAVNVAVALAQ 124

Query: 123 KGKNVAILDADVYGPSIPKLLKISGK-VEISDK---KFLKPKENYGIKIMSMASLVDENV 178
            G  V +LDAD+YGP+ P +L +SG  V++ +    + L+P  N+GIK++SM  L+D + 
Sbjct: 125 TGAAVGLLDADIYGPNAPTMLGLSGAAVQVQNSPQGEVLEPVFNHGIKMVSMGFLIDPDQ 184

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            +IWRGPM+   I   L+ V WG LD+L++DMPPGTGDA LT+ Q +P++G VIV+TPQ 
Sbjct: 185 PVIWRGPMLNGIIRQFLYQVNWGALDYLIVDMPPGTGDAQLTLTQSVPMAGAVIVTTPQT 244

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPFL 297
           ++L+D +R + M+Q+M + ++G++ENMSYF+  D   ++YDLFG+GG    ++++ +P L
Sbjct: 245 VSLLDARRGLKMFQQMGVNVLGIVENMSYFIPPDLPDRQYDLFGSGGGEKASKELNVPLL 304

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             VP ++ +R   D G+PIVV    SA+++    I+ +I
Sbjct: 305 GCVPLEIGLREGGDKGVPIVVSQPESASAKALTAIAKQI 343


>gi|172061390|ref|YP_001809042.1| cobyrinic acid ac-diamide synthase [Burkholderia ambifaria MC40-6]
 gi|171993907|gb|ACB64826.1| Cobyrinic acid ac-diamide synthase [Burkholderia ambifaria MC40-6]
          Length = 363

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 206/335 (61%), Gaps = 5/335 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I + Q+  +L  +  P         + +  + I  + V + + + +    Q   +R+   
Sbjct: 3   IDRAQVDAALAAVVDPNTDRPYAAHKGVRNVAIDGDAVAVDVVLGYPARSQHDDVRARIA 62

Query: 64  QIIQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACA 119
             ++ +P V++A V +++    +  Q+   L  NVK  VAVASGKGGVGKSTT VN+A A
Sbjct: 63  AALKAVPGVRDARVAVSQEIVAHTVQRGVKLLPNVKNIVAVASGKGGVGKSTTAVNLALA 122

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMASLVDENV 178
           L  +G +V ILDAD+YGPS+P +L I G + E  D + + P   +G++  S+  L++E+ 
Sbjct: 123 LAAEGASVGILDADIYGPSLPTMLGIHGQRPESPDNQSMNPLIGHGLQANSIGFLIEEDN 182

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            M+WRGPM  SA+  +L    W +LD+L++DMPPGTGD  LT+AQ++P++G VIV+TPQD
Sbjct: 183 PMVWRGPMATSALEQLLRQTNWRELDYLIVDMPPGTGDIQLTLAQRVPVTGAVIVTTPQD 242

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +AL+D K+ + M++K+ IPI+G++ENMS  + S+ G +  +FG GGA   A+  G+  L 
Sbjct: 243 IALLDAKKGLKMFEKVGIPILGIVENMSIHICSNCGHEEHIFGAGGAERMAQDYGVNVLG 302

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           S+P D+ +R  +D G P V    + A +  Y++I+
Sbjct: 303 SLPLDIAIRERADSGTPTVAAEPDGALARRYRDIA 337


>gi|295688751|ref|YP_003592444.1| ParA/MinD ATPase-like protein [Caulobacter segnis ATCC 21756]
 gi|295430654|gb|ADG09826.1| ATPase-like, ParA/MinD [Caulobacter segnis ATCC 21756]
          Length = 369

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 160/238 (67%), Gaps = 5/238 (2%)

Query: 85  PPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK 144
           PP+     +V+  +AVASGKGGVGKST   N+A A    G  V +LDADVYGPS PK++ 
Sbjct: 110 PPEAEKPAHVRHVIAVASGKGGVGKSTVSTNLAVAFAQMGLRVGLLDADVYGPSAPKMMG 169

Query: 145 ISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQ-- 202
           + G     ++K L+P E +G+K+MS+  +VDE  AMIWRGPM  SA+  M+H+V WG   
Sbjct: 170 VDGDPLFENEK-LQPLEAHGVKLMSIGFIVDEGKAMIWRGPMASSAVRQMIHDVAWGSEA 228

Query: 203 --LDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIG 260
             LD L++D+PPGTGD  LT+ QK+ + GVV+V+TPQ++ALID +RA  M++K   PI+G
Sbjct: 229 QPLDVLVVDLPPGTGDIQLTLVQKLRIDGVVLVTTPQEIALIDARRAAVMFEKTATPILG 288

Query: 261 MIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVV 318
           +IENM++F    TG    +FG GG   EA ++ +P L  VP +M VR+  D G+P V+
Sbjct: 289 LIENMAFFADPSTGAPIPIFGEGGGVAEAARLQVPLLGRVPIEMGVRIGGDEGVPAVI 346


>gi|254477372|ref|ZP_05090758.1| Mrp/NBP35 family protein [Ruegeria sp. R11]
 gi|214031615|gb|EEB72450.1| Mrp/NBP35 family protein [Ruegeria sp. R11]
          Length = 365

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 134/347 (38%), Positives = 205/347 (59%), Gaps = 21/347 (6%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHT-IAHQLQSLRSNAQQ 64
           K++I  +L+ L +P +   +V    L  + I  + V   I  P   IA Q++ LR  A+ 
Sbjct: 14  KDEIRAALERLQLP-DGGTLVSRDMLRALTIDGSRVSFVIEAPSPQIATQMEPLRRAAEA 72

Query: 65  IIQNIPTVKNAVVTLTENKNPPQ--------------QRNNL---NVKKFVAVASGKGGV 107
            +  +  V+   V LT + + P               Q   L    VK+ +AV SGKGGV
Sbjct: 73  TVLALDGVEAVSVALTAHADGPSKPAPSLKVGGHPKPQAEPLKPSGVKRILAVGSGKGGV 132

Query: 108 GKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKI 167
           GKST   N+A AL  +G+ V +LDAD+YGPS P+++  SG+    D K ++P   +G+ +
Sbjct: 133 GKSTVSANLAVALARQGRKVGLLDADIYGPSQPRMMGASGRPASPDGKIIEPLHAHGVTL 192

Query: 168 MSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPL 227
           MS+  +VDE  A++WRGPM+  A+  ML  V WG LD L++D+PPGTGD  LT+  K  L
Sbjct: 193 MSIGFMVDEAKAVVWRGPMLMGALQQMLGQVNWGNLDVLIVDLPPGTGDVQLTLCTKAEL 252

Query: 228 SGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARF 287
           SG ++VSTPQD+ALID ++A+ M+  +  P++G+IENMS+F   D G ++ +FG+GG   
Sbjct: 253 SGAIVVSTPQDVALIDARKALDMFATLKTPVLGLIENMSFFACPDCGGEHHIFGHGGVAA 312

Query: 288 EAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISD 334
           EAE++G+P L S+P D+D R+  D G P+       A ++ Y  +++
Sbjct: 313 EAERLGVPLLGSLPIDLDTRLAGDAGTPVAAG--EGAMAQAYARMAE 357


>gi|303253591|ref|ZP_07339729.1| putative ATPase [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|307247996|ref|ZP_07530025.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|302647511|gb|EFL77729.1| putative ATPase [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|306855394|gb|EFM87568.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
          Length = 365

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 10/345 (2%)

Query: 1   MNQILKNQIVD---SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS 57
           MNQ+ + Q+ +    L+  + P  + +++ +    +  +    + L  T+P       ++
Sbjct: 1   MNQLNEQQLSEIKFVLQNFTHPTLQKDLIALNAFKKAELGAGILRLEFTMPFAWNSGFEA 60

Query: 58  LRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLN-----VKKFVAVASGKGGVGKSTT 112
           L++  +  ++ I T  N V  L   +    +R N +     VK  +AV SGKGGVGKSTT
Sbjct: 61  LKAETEAKLKQI-TAANEVKWLLNYQIATLKRANSHPAVNGVKNIIAVTSGKGGVGKSTT 119

Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMA 171
            VN+A ALK +G  V ILDAD+YGPSIP +L    +   S D K + P E YGI+  S+ 
Sbjct: 120 SVNLALALKAQGAKVGILDADIYGPSIPHMLGAQDQRPTSPDNKHITPIEVYGIQSNSIG 179

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
            L+ ++ A IWRGPM  SA+  +L+   W +LD+L+IDMPPGTGD  LT++Q+IP++G V
Sbjct: 180 YLMADDNATIWRGPMASSALSQLLNETWWTELDYLVIDMPPGTGDIQLTLSQQIPVTGAV 239

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEK 291
           +V+TPQD+AL+D  + ISM+QK+++P++G+IENMS  +  + G   D+FG GGA   A+K
Sbjct: 240 VVTTPQDIALLDAIKGISMFQKVSVPVLGVIENMSVHICQNCGHHEDIFGTGGANKVAKK 299

Query: 292 IGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            G   L  +P  + +R   D G P VV      TS+ Y E++ ++
Sbjct: 300 YGTQVLGQMPLHIRLRQDLDAGTPTVVAAPEHETSQAYIELAAKV 344


>gi|311108809|ref|YP_003981662.1| CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein 2
           [Achromobacter xylosoxidans A8]
 gi|310763498|gb|ADP18947.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein 2
           [Achromobacter xylosoxidans A8]
          Length = 362

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 168/244 (68%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NV+  +AVASGKGGVGKSTT VN+A AL  +G  V +LDAD+YGPS+P +L ISG+ E  
Sbjct: 95  NVRNIIAVASGKGGVGKSTTAVNLALALAAEGAKVGVLDADIYGPSVPTMLGISGRPESL 154

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P   +G++  S+  L+D +   IWRGPMV  A+  +L    W  LD+L++DMPP
Sbjct: 155 DNKSMEPLTGHGLQANSIGFLIDADSPAIWRGPMVTQALEQLLRQTNWRDLDYLIVDMPP 214

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQK+P+ G VIV+TPQD+AL+D ++ + M+QK+++PI+G++ENM+  + S 
Sbjct: 215 GTGDVALTLAQKVPVVGAVIVTTPQDVALLDARKGLRMFQKVDVPILGVVENMAIHICSQ 274

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    +FG GG +  AE+   P+L S+P  + +RV +D G P VV +  S  + +Y+ I
Sbjct: 275 CGHAEHIFGEGGGQRMAEQYQTPWLGSLPLTLAIRVQTDAGSPTVVSDPGSEAAALYRGI 334

Query: 333 SDRI 336
           + ++
Sbjct: 335 ARKL 338


>gi|300776480|ref|ZP_07086338.1| mrp/Nbp35 family ATP-binding protein [Chryseobacterium gleum ATCC
           35910]
 gi|300501990|gb|EFK33130.1| mrp/Nbp35 family ATP-binding protein [Chryseobacterium gleum ATCC
           35910]
          Length = 368

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 168/256 (65%), Gaps = 8/256 (3%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGK---- 148
            ++  +A+ASGKGGVGKST   N+A  L   G  V +LDAD+YGPS+P +    G+    
Sbjct: 89  GIQNIIAIASGKGGVGKSTVSANMAVTLAKMGFKVGLLDADIYGPSVPTMFDTEGEKPIS 148

Query: 149 VEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLI 208
           VE++ K  +KP ENYG+K++S+      N A++WRGPM   A+  M+ +  WG+LDFLLI
Sbjct: 149 VEVNGKNLMKPIENYGVKMLSIGYFSGANQAVVWRGPMASKALNQMIRDAAWGELDFLLI 208

Query: 209 DMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQ--KMNIPIIGMIENMS 266
           D+PPGTGD HL+I Q++P++G VIVSTPQ +AL DV++ I+M+Q   +NIP++G+IENM+
Sbjct: 209 DLPPGTGDIHLSIIQEVPVTGAVIVSTPQHVALADVRKGIAMFQMESINIPVLGLIENMA 268

Query: 267 YFLASD-TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSAT 325
           YF   +    KY +FGN GA++ AE +GIP L  +P    +R   D+G P  +    S  
Sbjct: 269 YFTPEELPDNKYYIFGNQGAQYLAEDLGIPVLGEIPLIQSIREAGDVGRPAALQE-GSKI 327

Query: 326 SEIYQEISDRIQQFFV 341
            EIY E + ++ +  V
Sbjct: 328 EEIYTETARKMVESLV 343


>gi|221199342|ref|ZP_03572386.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           multivorans CGD2M]
 gi|221205756|ref|ZP_03578771.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           multivorans CGD2]
 gi|221211557|ref|ZP_03584536.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           multivorans CGD1]
 gi|221168918|gb|EEE01386.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           multivorans CGD1]
 gi|221174594|gb|EEE07026.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           multivorans CGD2]
 gi|221180627|gb|EEE13030.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           multivorans CGD2M]
          Length = 377

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 205/335 (61%), Gaps = 5/335 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I + Q+  +L  +  P         + +  + I  + V + + + +    Q   +R+   
Sbjct: 17  IDRAQVDAALAAVVDPNTGRPYAANKGVRNVAIDGDAVTVDVVLGYPARSQYDDVRARIA 76

Query: 64  QIIQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACA 119
             +  +P V++A V +++    +  Q+   L  NVK  VAVASGKGGVGKSTT VN+A A
Sbjct: 77  AALTAVPGVRDARVAVSQEIVAHTVQRGVKLLPNVKNIVAVASGKGGVGKSTTAVNLALA 136

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMASLVDENV 178
           L  +G +V ILDAD+YGPS+P +L I G + E  D + + P   +G++  S+  L++E+ 
Sbjct: 137 LAAEGASVGILDADIYGPSLPTMLGIHGQRPESPDNQSMNPLVGHGLQANSIGFLIEEDN 196

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            M+WRGPM  SA+  +L    W +LD+L++DMPPGTGD  LT+AQ++P++G VIV+TPQD
Sbjct: 197 PMVWRGPMATSALEQLLRQTNWRELDYLIVDMPPGTGDIQLTLAQRVPVTGAVIVTTPQD 256

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +AL+D K+ + M++K+ IPI+G++ENMS  + S+ G +  +FG GGA   A+  G+  L 
Sbjct: 257 IALLDAKKGLKMFEKVGIPILGIVENMSIHICSNCGHEEHIFGAGGAERMAKDYGVTVLG 316

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           S+P D+ +R  +D G P V    + A +  Y++I+
Sbjct: 317 SLPLDIAIRERADSGTPTVAAEPDGALARRYRDIA 351


>gi|254424970|ref|ZP_05038688.1| conserved domain protein [Synechococcus sp. PCC 7335]
 gi|196192459|gb|EDX87423.1| conserved domain protein [Synechococcus sp. PCC 7335]
          Length = 365

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 125/340 (36%), Positives = 202/340 (59%), Gaps = 17/340 (5%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           K   V  LK ++ P  ++NIVE+  +  + +V + VYL + V     HQL SL+   Q  
Sbjct: 29  KQAAVYCLKQVNEPTLRSNIVELGMVRNLRVVDSYVYLRLYVG---VHQL-SLKEQVQTA 84

Query: 66  IQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGK 125
           +  +   K A V +              V+  +A++SGKGGVGKSTT VN+A ALK  G 
Sbjct: 85  LGALKWCKKAYVEICTIPG---------VRTTLAISSGKGGVGKSTTAVNLAAALKRTGA 135

Query: 126 NVAILDADVYGPSIPKLLKISGK----VEISDKKFLKPKENYGIKIMSMASLVDENVAMI 181
           +V +LDAD+YGP++P++L ++      +E    +  +P E +GIK+MS+  L      + 
Sbjct: 136 SVGLLDADIYGPNVPQMLGLAHSAVEVIETDAGERFQPLEAHGIKVMSVGLLAAPEHPLA 195

Query: 182 WRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLAL 241
           WRGP++   I   +  V WG+LD+LLID+PPGTGDA +TI Q+ P+ GVV+V+TPQ +A+
Sbjct: 196 WRGPVLHKIITQFIQEVAWGELDYLLIDLPPGTGDAQITIIQESPICGVVMVTTPQQVAV 255

Query: 242 IDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVP 301
            DV+R+I M++++ +P++G++ENMSY +    G +  +FG+GG    A+++ +P L  VP
Sbjct: 256 SDVRRSIHMFRQVGVPVLGLVENMSYLICECCGNRTSIFGSGGGEQMAQELAVPLLGEVP 315

Query: 302 FDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV 341
            D  +   SD G P+ + +  +  S +++ I+  +   F 
Sbjct: 316 IDSKICHGSDTGQPLPLRDETAQLSIVFEAIAQGLNNTFC 355


>gi|165976425|ref|YP_001652018.1| putative ATPase [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|165876526|gb|ABY69574.1| MRP-like protein, ATP-binding protein [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
          Length = 365

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 205/345 (59%), Gaps = 10/345 (2%)

Query: 1   MNQILKNQIVD---SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS 57
           MNQ+ + Q+ +    L+  + P  + +++ +    +  +    + L  T+P       ++
Sbjct: 1   MNQLNEQQLSEIKFVLQNFTHPTLQKDLIALNAFKKAELGAGILRLEFTMPFAWNSGFEA 60

Query: 58  LRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLN-----VKKFVAVASGKGGVGKSTT 112
           L++  +  ++ I T  N V  L   +    +R N +     VK  +AV SGKGGVGKSTT
Sbjct: 61  LKAETEAKLKQI-TAANEVKWLLNYQIATLKRANSHPAVNGVKNIIAVTSGKGGVGKSTT 119

Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMA 171
            VN+A ALK +G  V ILDAD+YGPSIP +L    +   S D K + P E YG++  S+ 
Sbjct: 120 SVNLALALKAEGAKVGILDADIYGPSIPHMLGAQDQRPTSPDNKHITPIEVYGLQSNSIG 179

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
            L+ ++ A IWRGPM  SA+  +L+   W +LD+L+IDMPPGTGD  LT++Q+IP++G V
Sbjct: 180 YLMADDNATIWRGPMASSALSQLLNETWWAELDYLVIDMPPGTGDIQLTLSQQIPVTGAV 239

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEK 291
           +V+TPQD+AL+D  + ISM+QK+++P++G+IENMS  +  + G   D+FG GGA   A+K
Sbjct: 240 VVTTPQDIALLDAVKGISMFQKVSVPVLGIIENMSVHICQNCGHHEDIFGTGGAEKVAKK 299

Query: 292 IGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            G   L  +P  + +R   D G P VV      TS  Y E++ ++
Sbjct: 300 YGTKVLGQMPLHIRLRQDLDAGTPTVVAAPEHETSRAYIELAAKV 344


>gi|254236430|ref|ZP_04929753.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126168361|gb|EAZ53872.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
          Length = 383

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 129/342 (37%), Positives = 203/342 (59%), Gaps = 6/342 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+ I +  +  +L+    P    + V    L E+ I  + V + + + +        L  
Sbjct: 1   MSAITRQTVEATLRQYQDPYLNQDPVSAGCLREVEIQGDRVRVRLELGYAAGLFRNGLAQ 60

Query: 61  NAQQIIQNIPTVKNAVV----TLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNI 116
             Q  ++ +  V  A V     +  +K  PQ     NVK  VAVASGKGGVGKSTT  N+
Sbjct: 61  TLQMALEALDGVARAEVRVDCVIQPHKAQPQVEVMGNVKNIVAVASGKGGVGKSTTAANL 120

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLV 174
           A AL  +G  V ILDAD+YGPS   +  +    + ++ ++K+ +P E +G+++MSMA L 
Sbjct: 121 ALALAREGARVGILDADIYGPSQGIMFGLPEGTRPKVREQKWFEPLEAHGVQVMSMAFLT 180

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
           D++  ++WRGPMV  A++ ++    W  LD+L++DMPPGTGD  LT+AQK+P++G VIV+
Sbjct: 181 DDSTPVVWRGPMVSGALIQLITQTAWDNLDYLVVDMPPGTGDIQLTLAQKVPVAGAVIVT 240

Query: 235 TPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGI 294
           TPQDLAL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A + G+
Sbjct: 241 TPQDLALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLAAQFGV 300

Query: 295 PFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             L S+P  + +R  +D G P V+ +  S  + +YQEI+  +
Sbjct: 301 ELLASMPLSIAIRTQADSGRPTVIADPESQLAMLYQEIARHV 342


>gi|50120349|ref|YP_049516.1| putative ATPase [Pectobacterium atrosepticum SCRI1043]
 gi|49610875|emb|CAG74320.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 369

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 124/339 (36%), Positives = 201/339 (59%), Gaps = 5/339 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +   L     P  KNN+  +  L    ++ N +++ +T+P      L  L+   
Sbjct: 11  EALRAMVTGVLSTFQHPTLKNNLTTLNALRHCALLDNVLHIELTMPFVWLSGLAVLKETV 70

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIAC 118
              +  +   K     LT +    ++ N+      VK  +AV+SGKGGVGKS+T VN+A 
Sbjct: 71  SDELLRLSGAKAVEWRLTHDVATLRRVNDQAGVKGVKNIIAVSSGKGGVGKSSTAVNMAL 130

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G NV ILDAD+YGPSIP +L  + +   S D + + P   +G+   S+  LV ++
Sbjct: 131 ALAAEGANVGILDADIYGPSIPTMLGSASERPTSPDGQHMAPIIAHGLATNSIGYLVTDD 190

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A++ +L + +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+TPQ
Sbjct: 191 NAMVWRGPMASKALLQLLQDTLWPDLDYLVLDMPPGTGDIQLTLAQSIPVTGAVVVTTPQ 250

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D  + I+M++K+++P++G++ENMS  + S+ G    +FG GGA+  AEK     L
Sbjct: 251 DIALMDAMKGIAMFEKVSVPVLGIVENMSVHICSNCGHLEPIFGTGGAQKLAEKYHCSLL 310

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P  + +R   D G P VV   +S  + +Y+E++ ++
Sbjct: 311 GQLPLHISLREDLDRGEPTVVSQPDSEFTSLYRELAGQV 349


>gi|238895685|ref|YP_002920420.1| putative ATPase [Klebsiella pneumoniae NTUH-K2044]
 gi|330013409|ref|ZP_08307632.1| putative protein mrp [Klebsiella sp. MS 92-3]
 gi|238548002|dbj|BAH64353.1| putative ATP-binding protein [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|328533524|gb|EGF60249.1| putative protein mrp [Klebsiella sp. MS 92-3]
          Length = 369

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 129/340 (37%), Positives = 200/340 (58%), Gaps = 11/340 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+  +  +L     P  K+N+  ++ L  +  + +TV++ + +P   +   ++L+     
Sbjct: 13  LRAMVAGTLANFQHPTLKHNLTALKALHHVAWLDDTVHIELQMPFVWSSAFEALKEQCSA 72

Query: 65  IIQNIPTVK-------NAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIA 117
            +  I   K       +++ TL   KN P       VK  +A++SGKGGVGKS+T VN+A
Sbjct: 73  ELLRITGAKAIDWKLTHSIATLKRVKNQPGVNG---VKNIIAISSGKGGVGKSSTAVNLA 129

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDE 176
            AL  +G  V ILDAD+YGPSIP +L        S D   + P   YG+   S+  LV +
Sbjct: 130 LALAAEGAKVGILDADIYGPSIPTMLGAEDSRPTSPDGTHMAPIMKYGLATNSIGYLVTD 189

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           + AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+TP
Sbjct: 190 DNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTTP 249

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK     
Sbjct: 250 QDIALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAQKLAEKYHTQL 309

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L  +P  + +R   D G P VV   +S  ++IY++++ R+
Sbjct: 310 LGQLPLHITLREDLDNGTPTVVARPDSEFTDIYRQLAGRV 349


>gi|307130141|ref|YP_003882157.1| antiporter inner membrane protein [Dickeya dadantii 3937]
 gi|306527670|gb|ADM97600.1| antiporter inner membrane protein [Dickeya dadantii 3937]
          Length = 369

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 122/339 (35%), Positives = 204/339 (60%), Gaps = 5/339 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           ++L+  +   L   + P  KNN+  +  L    ++ + +++ +T+P      L  L+ + 
Sbjct: 11  EMLRAMVNGVLSSFTHPTLKNNLTTLNALHHCALLDDVLHIELTMPFVWLSGLTDLKDSV 70

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIAC 118
            + +  +   +     LT N    ++ NN      VK  +AV+SGKGGVGKS+T VN+A 
Sbjct: 71  SEELLRLCGAREVEWRLTHNVATLRRVNNQVGVKGVKNIIAVSSGKGGVGKSSTAVNMAL 130

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G +V ILDAD+YGPSIP +L  + +   S D + + P   +G+   S+  LV ++
Sbjct: 131 ALAAEGASVGILDADIYGPSIPTMLGAANERPTSPDGQHMAPIMAHGLATNSIGYLVTDD 190

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A++ +L + +W  LD+L++DMPPGTGD  LT+AQ +P++G V+V+TPQ
Sbjct: 191 NAMVWRGPMASKALLQLLQDTLWPDLDYLVLDMPPGTGDIQLTLAQNVPVTGAVVVTTPQ 250

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D  + I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK     L
Sbjct: 251 DIALVDAMKGIVMFEKVKVPVLGIVENMSVHICSNCGHLEPIFGTGGAQKLAEKYHCALL 310

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P  + +R   D G P VV   +S  +++Y+E++ ++
Sbjct: 311 GQLPLHISLREDLDRGEPTVVSQPDSEFTQLYRELAGQV 349


>gi|120612471|ref|YP_972149.1| hypothetical protein Aave_3830 [Acidovorax citrulli AAC00-1]
 gi|120590935|gb|ABM34375.1| protein of unknown function DUF59 [Acidovorax citrulli AAC00-1]
          Length = 363

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 110/241 (45%), Positives = 170/241 (70%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            V+  +AVASGKGGVGKSTT  N+A AL ++G  V +LDAD+YGPS P +L I+ + E +
Sbjct: 96  QVRNIIAVASGKGGVGKSTTAANLALALASEGARVGVLDADIYGPSQPMMLGIADRPESA 155

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P  N+G+++MS+  LV+ + AMIWRGPM   A+  +L    W  LD+L++DMPP
Sbjct: 156 DGKTMEPLRNHGVQVMSIGFLVEPDQAMIWRGPMATQALEQLLRQTNWQDLDYLIVDMPP 215

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++Q++PL+G VIV+TPQD+AL+D ++ I M++K+ +PI+G++ENM+  + S 
Sbjct: 216 GTGDIQLTLSQRVPLTGAVIVTTPQDIALLDARKGIKMFEKVGVPILGVVENMAAHVCSQ 275

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    +FG GG R  AE+ G+ +L ++P D+ +R+ +D G P VV   +   ++IY+ +
Sbjct: 276 CGHVEHIFGEGGGRRMAEENGMTYLGALPLDLQIRLQADSGAPTVVAEPDGEVADIYRRV 335

Query: 333 S 333
           +
Sbjct: 336 A 336


>gi|2497977|sp|P72190|YCAB_PSEFR RecName: Full=Uncharacterized ATP-binding protein in capB 3'region
 gi|1513082|gb|AAC45998.1| ATPase [Pseudomonas fragi]
          Length = 287

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 181/277 (65%), Gaps = 6/277 (2%)

Query: 63  QQIIQNIPTVKNAVV----TLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
           Q  I N+  V +A V     +  +K   Q     NVK  VAVASGKGGVGKSTT  N+A 
Sbjct: 3   QMAISNLDGVSSAKVEINCVIAPHKAQAQIPGLANVKNIVAVASGKGGVGKSTTAANLAL 62

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKIS--GKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           AL  +G  V ILDAD+YGPS   +  I+   + +I D+K+  P E +G+++MSMA L D+
Sbjct: 63  ALAREGARVGILDADIYGPSQGVMFGIAEGTRPKIRDQKWFVPIEAHGVEVMSMAFLTDD 122

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           N  M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TP
Sbjct: 123 NTPMVWRGPMVSGALLQLVTQTAWNDLDYLVIDMPPGTGDIQLTLAQKVPVAGSVIVTTP 182

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QDLAL+D ++ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A + G+  
Sbjct: 183 QDLALLDARKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLATQYGVEV 242

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           L S+P  M++R  +D G P  + + NS  + IYQE++
Sbjct: 243 LASLPLAMEIREQADNGKPTAIADPNSPIALIYQELA 279


>gi|254504786|ref|ZP_05116937.1| hypothetical protein SADFL11_4825 [Labrenzia alexandrii DFL-11]
 gi|222440857|gb|EEE47536.1| hypothetical protein SADFL11_4825 [Labrenzia alexandrii DFL-11]
          Length = 379

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 204/368 (55%), Gaps = 37/368 (10%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           +  ++++LK +  P    ++     +  + +   TV   + +  T   +++ LR +A Q 
Sbjct: 5   RETVIETLKAVVDPVTGEDLPATGMIRGLKVADRTVRFVLQIDQTRVDEMERLREDAVQR 64

Query: 66  IQNIPTVKNAVVTLTENKNP-----------------------------------PQQRN 90
           ++ +P   +A V LT + +                                    PQ  +
Sbjct: 65  LEALPDCTSAQVILTSHSDQSTAHALAAPAAPVPQAGPGELKPIKPIPAAPGTSGPQ--H 122

Query: 91  NLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVE 150
              +KK +A+ASGKGGVGKST   N+ACAL  +G  V +LDADVYGPS P++L I G+  
Sbjct: 123 VAGIKKIIAIASGKGGVGKSTVASNLACALAAQGLKVGLLDADVYGPSQPEMLGIKGRPS 182

Query: 151 ISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDM 210
             D + + P  N+G+ +MS+  +   + A++WRGPM+  A+  M+  V WG LD L++D+
Sbjct: 183 SPDGQTILPLRNHGVTLMSIGLMTSGDKAVVWRGPMLMGALQQMMTQVQWGALDVLIVDL 242

Query: 211 PPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLA 270
           PPGTGD  +T++QK  + G VIVSTPQD+AL+D ++ I M+Q+M +PI+GM+ENMS  + 
Sbjct: 243 PPGTGDVQMTLSQKFIVDGAVIVSTPQDIALLDARKGIDMFQEMKVPILGMVENMSTHIC 302

Query: 271 SDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQ 330
           S  G +  +FG+GG   EA  + +P L  +P  +++R  +D   P V+   ++  +  ++
Sbjct: 303 SKCGNEEHIFGHGGVAKEAASLRVPVLAEIPLHLNIRTAADGDTPAVIKAPDAPETAAFK 362

Query: 331 EISDRIQQ 338
           +++  + +
Sbjct: 363 KLATAVTE 370


>gi|227113134|ref|ZP_03826790.1| putative ATPase [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 369

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 124/339 (36%), Positives = 201/339 (59%), Gaps = 5/339 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +   L     P  KNN+  +  L    ++ N +++ +T+P      L  L+   
Sbjct: 11  EALRAMVTGVLSTFQHPTLKNNLTTLNALRHCALLDNVLHIDLTMPFVWLSGLAVLKETV 70

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIAC 118
              +  +   K     LT +    ++ N+      VK  +AV+SGKGGVGKS+T VN+A 
Sbjct: 71  SDELLRLSGAKAVEWRLTHDIATLRRVNDQAGVKGVKNIIAVSSGKGGVGKSSTAVNMAL 130

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G NV ILDAD+YGPSIP +L  + +   S D + + P   +G+   S+  LV ++
Sbjct: 131 ALAAEGANVGILDADIYGPSIPTMLGSASERPTSPDGQHMAPIIAHGLATNSIGYLVTDD 190

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A++ +L + +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+TPQ
Sbjct: 191 NAMVWRGPMASKALLQLLQDTLWPDLDYLVLDMPPGTGDIQLTLAQSIPVTGAVVVTTPQ 250

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D  + I+M++K+++P++G++ENMS  + S+ G    +FG GGA+  AEK     L
Sbjct: 251 DIALMDAMKGIAMFEKVSVPVLGIVENMSVHICSNCGHLEPIFGTGGAQKLAEKYHCSLL 310

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P  + +R   D G P VV   +S  + +Y+E++ ++
Sbjct: 311 GQLPLHISLREDLDRGEPTVVSQPDSEFTSLYRELAGQV 349


>gi|161524038|ref|YP_001579050.1| cobyrinic acid a,c-diamide synthase [Burkholderia multivorans ATCC
           17616]
 gi|189351201|ref|YP_001946829.1| putative cobyrinic acid a,c-diamide synthase [Burkholderia
           multivorans ATCC 17616]
 gi|160341467|gb|ABX14553.1| Cobyrinic acid ac-diamide synthase [Burkholderia multivorans ATCC
           17616]
 gi|189335223|dbj|BAG44293.1| putative cobyrinic acid a,c-diamide synthase [Burkholderia
           multivorans ATCC 17616]
          Length = 363

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 205/335 (61%), Gaps = 5/335 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I + Q+  +L  +  P         + +  + I  + V + + + +    Q   +R+   
Sbjct: 3   IDRAQVDAALAAVVDPNTGRPYAANKGVRNVAIDGDAVAVDVVLGYPARSQYDDVRARIA 62

Query: 64  QIIQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACA 119
             +  +P V++A V +++    +  Q+   L  NVK  VAVASGKGGVGKSTT VN+A A
Sbjct: 63  AALTAVPGVRDARVNVSQEIVAHTVQRGVKLLPNVKNIVAVASGKGGVGKSTTAVNLALA 122

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMASLVDENV 178
           L  +G +V ILDAD+YGPS+P +L I G + E  D + + P   +G++  S+  L++E+ 
Sbjct: 123 LAAEGASVGILDADIYGPSLPTMLGIHGQRPESPDNQSMNPLVGHGLQANSIGFLIEEDN 182

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            M+WRGPM  SA+  +L    W +LD+L++DMPPGTGD  LT+AQ++P++G VIV+TPQD
Sbjct: 183 PMVWRGPMATSALEQLLRQTNWRELDYLIVDMPPGTGDIQLTLAQRVPVTGAVIVTTPQD 242

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +AL+D K+ + M++K+ IPI+G++ENMS  + S+ G +  +FG GGA   A+  G+  L 
Sbjct: 243 IALLDAKKGLKMFEKVGIPILGIVENMSIHICSNCGHEEHIFGAGGAERMAKDYGVTVLG 302

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           S+P D+ +R  +D G P V    + A +  Y++I+
Sbjct: 303 SLPLDIAIRERADSGTPTVAAEPDGALARRYRDIA 337


>gi|326318524|ref|YP_004236196.1| ATPase-like, ParA/MinD [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323375360|gb|ADX47629.1| ATPase-like, ParA/MinD [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 363

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/251 (45%), Positives = 171/251 (68%), Gaps = 6/251 (2%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI 145
           PQ RN       +AVASGKGGVGKSTT  N+A AL ++G  V +LDAD+YGPS P +L I
Sbjct: 95  PQARN------IIAVASGKGGVGKSTTAANLALALASEGARVGVLDADIYGPSQPMMLGI 148

Query: 146 SGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDF 205
           + + E +D K ++P  N+G+++MS+  LV+ + AMIWRGPM   A+  +L    W  LD+
Sbjct: 149 ADRPESADGKTMEPLRNHGVQVMSIGFLVEPDQAMIWRGPMATQALEQLLRQTNWQDLDY 208

Query: 206 LLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENM 265
           L++DMPPGTGD  LT++Q++PL+G VIV+TPQD+AL+D ++ I M++K+ +PI+G++ENM
Sbjct: 209 LVVDMPPGTGDIQLTLSQRVPLTGAVIVTTPQDIALLDARKGIRMFEKVGVPILGVVENM 268

Query: 266 SYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSAT 325
           +  + S  G    +FG GG R  AE+ G+ +L ++P D+ +R+ +D G P VV       
Sbjct: 269 AVHVCSQCGHVEHIFGEGGGRRMAEENGMAYLGALPLDLQIRLQADSGTPTVVAEPAGEV 328

Query: 326 SEIYQEISDRI 336
           + IY+ ++  +
Sbjct: 329 ANIYRRVAREV 339


>gi|197104345|ref|YP_002129722.1| GTP-binding protein, Mrp/Nbp345 family [Phenylobacterium zucineum
           HLK1]
 gi|196477765|gb|ACG77293.1| GTP-binding protein, Mrp/Nbp345 family [Phenylobacterium zucineum
           HLK1]
          Length = 366

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 126/359 (35%), Positives = 203/359 (56%), Gaps = 29/359 (8%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           +  ++++L  ++ P     +     +  + I  +     + VP         +R  A++ 
Sbjct: 9   RTVVLEALDRVADPRSGQGLAAAGLVRGLVIRGSRAAFMLEVPAQDIPLYGPVRDAAERA 68

Query: 66  IQNIPTVKNAVVTLTENKNPPQ-----------------------QRNNLNVKKFVAVAS 102
           +  +P V+ A V LT   + PQ                        +   +V+K +AVAS
Sbjct: 69  LAAVPGVETAQVVLTAEADAPQPVAVPRRARVSEDPQARLQPMPEAQRPAHVRKVIAVAS 128

Query: 103 GKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKEN 162
           GKGGVGKST  VN+A A    G    +LDADVYGPS P +L   G+     +K L P E 
Sbjct: 129 GKGGVGKSTVSVNLAAAFAKIGLRAGLLDADVYGPSAPHMLGAEGEPTFDAEKRLNPLEA 188

Query: 163 YGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQ----LDFLLIDMPPGTGDAH 218
           +G+K+MS+  +V+E  A IWRGPM  SA +  L N  WG     LD L++D+PPGTGD  
Sbjct: 189 WGVKVMSIGFIVEEGQAAIWRGPMASSA-LRSLMNANWGTAAEPLDVLVVDLPPGTGDIQ 247

Query: 219 LTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYD 278
           LT+ Q++ L GVV+VSTPQ++ALID +RA +M++K+  PI+G++ENM++F  S TG++  
Sbjct: 248 LTLVQRLKLDGVVVVSTPQEIALIDARRAAAMFEKVGAPILGVVENMAWF-ESPTGERVP 306

Query: 279 LFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337
           +FG GGA  EA ++G+P L  +P ++ +R   D G P+V  + ++  +  + +++++++
Sbjct: 307 IFGQGGAAEEARRLGVPLLAEIPIEVALREACDAGRPLVATSPDTPAAWAFLQMAEKLR 365


>gi|237751316|ref|ZP_04581796.1| conserved hypothetical protein [Helicobacter bilis ATCC 43879]
 gi|229372682|gb|EEO23073.1| conserved hypothetical protein [Helicobacter bilis ATCC 43879]
          Length = 356

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 131/344 (38%), Positives = 203/344 (59%), Gaps = 9/344 (2%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +K  + D+LK +  P  + +IV    +S+I I +N  YL I +P +    ++ ++    +
Sbjct: 1   MKKMVEDALKQVIYPNFEKDIVTFGFVSKIEINNNVCYLKINIPSSNEEVIKKVKEEILE 60

Query: 65  IIQNIPTVKNAVVTLTEN---KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACA 119
             +++P     +  +T N       Q   NL  ++K FV V+SGKGGVGKSTT VN+A +
Sbjct: 61  KTKSLPLANIDIEIVTPNIQKAQTEQAPKNLAPSIKHFVMVSSGKGGVGKSTTSVNLAIS 120

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISG---KVEISDKKFLKPKENYGIKIMSMASLVDE 176
           L   GK V +LDAD+YGP++P++  + G   K     KK L P E YG+K++S+ S+  +
Sbjct: 121 LAKSGKKVGLLDADIYGPNVPRMFGLDGVEPKTSQDGKKLL-PLEQYGVKMISIESIYGK 179

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
             + IWRGP+V   I  +L +V WG+LD +++DMPPGTGDA LT+AQ +P+   + V+TP
Sbjct: 180 GQSFIWRGPVVMRIITQLLQDVEWGELDIMVVDMPPGTGDAQLTLAQSVPVGAGINVTTP 239

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q +A+ D  RA+ M+ K NIPI G+IENMS F+  D  K Y++FG G +   A++     
Sbjct: 240 QMVAIDDGFRALDMFAKCNIPIFGIIENMSGFICPDCNKTYEIFGKGNSDMLAQEFHTEV 299

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
           +  +P +  +   SD G PI     +S TS+ Y E + R+ +F 
Sbjct: 300 VAKIPLEPSIVAASDSGKPISFFEPDSRTSKSYMECALRLIEFL 343


>gi|15598677|ref|NP_252171.1| hypothetical protein PA3481 [Pseudomonas aeruginosa PAO1]
 gi|116054449|ref|YP_789666.1| hypothetical protein PA14_19065 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218890271|ref|YP_002439135.1| hypothetical protein PLES_15311 [Pseudomonas aeruginosa LESB58]
 gi|254242166|ref|ZP_04935488.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296388001|ref|ZP_06877476.1| hypothetical protein PaerPAb_07594 [Pseudomonas aeruginosa PAb1]
 gi|313108843|ref|ZP_07794828.1| hypothetical protein PA39016_001540028 [Pseudomonas aeruginosa
           39016]
 gi|9949626|gb|AAG06869.1|AE004769_2 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115589670|gb|ABJ15685.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126195544|gb|EAZ59607.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218770494|emb|CAW26259.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
 gi|310881330|gb|EFQ39924.1| hypothetical protein PA39016_001540028 [Pseudomonas aeruginosa
           39016]
          Length = 364

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 129/342 (37%), Positives = 203/342 (59%), Gaps = 6/342 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+ I +  +  +L+    P    + V    L E+ I  + V + + + +        L  
Sbjct: 1   MSAITRQTVEATLRQYQDPYLNQDPVSAGCLREVEIQGDRVRVRLELGYAAGLFRNGLAQ 60

Query: 61  NAQQIIQNIPTVKNAVV----TLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNI 116
             Q  ++ +  V  A V     +  +K  PQ     NVK  VAVASGKGGVGKSTT  N+
Sbjct: 61  TLQMALEALDGVARAEVRVDCVIQPHKAQPQVEVMGNVKNIVAVASGKGGVGKSTTAANL 120

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLV 174
           A AL  +G  V ILDAD+YGPS   +  +    + ++ ++K+ +P E +G+++MSMA L 
Sbjct: 121 ALALAREGARVGILDADIYGPSQGIMFGLPEGTRPKVREQKWFEPLEAHGVQVMSMAFLT 180

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
           D++  ++WRGPMV  A++ ++    W  LD+L++DMPPGTGD  LT+AQK+P++G VIV+
Sbjct: 181 DDSTPVVWRGPMVSGALIQLITQTAWDNLDYLVVDMPPGTGDIQLTLAQKVPVAGAVIVT 240

Query: 235 TPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGI 294
           TPQDLAL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A + G+
Sbjct: 241 TPQDLALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLAAQFGV 300

Query: 295 PFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             L S+P  + +R  +D G P V+ +  S  + +YQEI+  +
Sbjct: 301 ELLASMPLSIAIRTQADSGRPTVIADPESQLAMLYQEIARHV 342


>gi|237752393|ref|ZP_04582873.1| conserved hypothetical protein [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375882|gb|EEO25973.1| conserved hypothetical protein [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 371

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 139/349 (39%), Positives = 204/349 (58%), Gaps = 15/349 (4%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           MNQ    Q+++ LK +  P  + +IV    + E     ++V + + +P   +     LR 
Sbjct: 1   MNQ---EQLINCLKEVIYPNFEKDIVTFGFVKETLTEGDSVAIRVEIPSASSEVADKLRE 57

Query: 61  ------NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL--NVKKFVAVASGKGGVGKSTT 112
                 NAQ + +    +K         K  PQ   NL   +K F+ V+SGKGGVGKSTT
Sbjct: 58  AITQKLNAQGVTKINLDIKQPKPQAQTQK--PQGTKNLAPQIKNFIMVSSGKGGVGKSTT 115

Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKIS-GKVEISDK-KFLKPKENYGIKIMSM 170
            VN+A AL  +GK VA+LDAD+YGP++P++L +   K E+  K K L P + YGI+++SM
Sbjct: 116 SVNLAIALAQQGKKVALLDADIYGPNVPRMLGLEKDKPEVDQKLKKLIPLQAYGIEMISM 175

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGV 230
             L DE  ++IWRGPM+  AI  ML +V+WG+LD ++IDMPPGTGDA LT+AQ +P++  
Sbjct: 176 GVLYDEGQSLIWRGPMIIRAIEQMLSDVLWGELDVMVIDMPPGTGDAQLTLAQSVPVTAG 235

Query: 231 VIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAE 290
           V VSTPQ +AL D  RA+ M+ K+ IP+ G++ENMS F+    G++YD+FG G     A 
Sbjct: 236 VAVSTPQKVALDDGARALDMFAKLKIPLAGIVENMSGFICPGCGEEYDIFGKGTTSEVAN 295

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
                 L  +P +  VR   D G PIV  +  S +++ Y + +  +  F
Sbjct: 296 AFNTQVLAQIPIEPIVREGGDSGKPIVYFHPESKSAKEYLKAAKLLWDF 344


>gi|221124668|ref|XP_002156464.1| PREDICTED: similar to nucleotide binding protein-like [Hydra
           magnipapillata]
          Length = 342

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 168/250 (67%), Gaps = 2/250 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALK--NKGKNVAILDADVYGPSIPKLLKISGKVE 150
            V+  + VASGKGGVGKSTT VN+A A+    +  NV ILDAD+YGPSIPK++ +SG+  
Sbjct: 91  GVRYIILVASGKGGVGKSTTAVNLAAAISVVKQTANVGILDADIYGPSIPKMMGLSGEPT 150

Query: 151 ISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDM 210
           +S +  + P  N+GIK MS+  LVD+  A++WRGPMV SAI  +   V W  LD+L+IDM
Sbjct: 151 LSRENLMIPLNNFGIKCMSIGFLVDDKSAIVWRGPMVMSAIHKLTREVNWSPLDYLIIDM 210

Query: 211 PPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLA 270
           PPGTGD  L+I+Q++ ++G ++V+TPQD+AL+D +R   M++K+NIP++G ++NMS F+ 
Sbjct: 211 PPGTGDTQLSISQEVHVNGAIVVTTPQDIALLDARRGAEMFRKVNIPVLGFVQNMSVFVC 270

Query: 271 SDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQ 330
            +      +FG+ G +  A ++G+  L  VP  + VR   D GIPIV     S  S +Y+
Sbjct: 271 PNCSSTTHIFGDNGTQKLASEMGVDILGDVPLHLSVRESCDQGIPIVFSRPESPESRVYK 330

Query: 331 EISDRIQQFF 340
           EI+ +I   F
Sbjct: 331 EIALKIVAEF 340


>gi|121595770|ref|YP_987666.1| hypothetical protein Ajs_3476 [Acidovorax sp. JS42]
 gi|120607850|gb|ABM43590.1| protein of unknown function DUF59 [Acidovorax sp. JS42]
          Length = 363

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 169/241 (70%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            VK  +AVASGKGGVGKSTT  N+A AL  +G  V +LDAD+YGPS P +L IS + E  
Sbjct: 96  QVKNIIAVASGKGGVGKSTTAANLALALAAEGARVGVLDADIYGPSQPMMLGISRRPESE 155

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P ENYG+++MS+  LVD++ AMIWRGPM   A+  +L    W  LD+L+IDMPP
Sbjct: 156 DGKTMEPLENYGVQVMSIGFLVDQDEAMIWRGPMATQALEQLLRQTNWKDLDYLIIDMPP 215

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++Q++P++G VIV+TPQD+AL+D K+ I M++K+ +PI+G++ENM+  + S+
Sbjct: 216 GTGDIQLTLSQRVPMTGAVIVTTPQDIALLDAKKGIKMFEKVGVPILGIVENMAVHVCSN 275

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    +FG  G +  A   G+ +L ++P DM +R+ +D G P VV + +   + IY+++
Sbjct: 276 CGHVEHIFGADGGKKMAADYGMDYLGALPLDMHIRLQADSGKPTVVADPDGEVAAIYKKV 335

Query: 333 S 333
           +
Sbjct: 336 A 336


>gi|253687681|ref|YP_003016871.1| putative ATPase [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251754259|gb|ACT12335.1| putative ATPase [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 369

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 124/339 (36%), Positives = 201/339 (59%), Gaps = 5/339 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +   L     P  KNN+  +  L    ++ N +++ +T+P      L  L+   
Sbjct: 11  EALRAMVTGVLSTFQHPTLKNNLTTLNALRHCALLDNVLHIELTMPFVWLSGLAVLKETV 70

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIAC 118
              +  +   K     LT +    ++ N+      VK  +AV+SGKGGVGKS+T VN+A 
Sbjct: 71  SDELLRLSGAKAVEWRLTHDIATLRRVNDQAGVKGVKNIIAVSSGKGGVGKSSTAVNMAL 130

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G NV ILDAD+YGPSIP +L  + +   S D + + P   +G+   S+  LV ++
Sbjct: 131 ALAAEGANVGILDADIYGPSIPTMLGSASERPTSPDGQHMAPIIAHGLATNSIGYLVTDD 190

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A++ +L + +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+TPQ
Sbjct: 191 NAMVWRGPMASKALLQLLQDTLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTTPQ 250

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D  + I+M++K+++P++G++ENMS  + S+ G    +FG GGA+  AEK     L
Sbjct: 251 DIALMDAMKGIAMFEKVSVPVLGIVENMSVHICSNCGHLEPIFGTGGAQKLAEKYHCSLL 310

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P  + +R   D G P VV   +S  + +Y+E++ ++
Sbjct: 311 GQLPLHISLREDLDRGEPTVVSQPDSEFTSLYRELAGQV 349


>gi|149188166|ref|ZP_01866461.1| Mrp protein [Vibrio shilonii AK1]
 gi|148838154|gb|EDL55096.1| Mrp protein [Vibrio shilonii AK1]
          Length = 358

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 164/245 (66%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV S KGGVGKSTT VN+A A+   G  V ILDADVYGPSIP +  +I+   E+
Sbjct: 93  GVKNVIAVTSAKGGVGKSTTAVNLALAISKLGAKVGILDADVYGPSIPMMFGQINAHPEV 152

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P   +GI   S+  L+  + A IWRGPM   A+  +L+   W +LD+L+IDMP
Sbjct: 153 RDGKWMQPIAAHGIYTQSIGYLISSDDAAIWRGPMASKALAQLLNETEWPELDYLVIDMP 212

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT++Q+IP++G +IV+TPQDLAL D  +  +M++K+++P++G++ENMSY + S
Sbjct: 213 PGTGDIQLTLSQQIPVTGALIVTTPQDLALADAIKGAAMFEKVSVPVVGIVENMSYHICS 272

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G K  +FG GGA + A K G+  L  VP  +D+R   D G P VV N     ++IY +
Sbjct: 273 QCGSKEHIFGAGGAEWMASKFGLNLLGQVPLHIDIRESIDNGAPTVVSNPEGEHAQIYTQ 332

Query: 332 ISDRI 336
           +++R+
Sbjct: 333 LAERV 337


>gi|332530679|ref|ZP_08406610.1| hypothetical protein HGR_12087 [Hylemonella gracilis ATCC 19624]
 gi|332039847|gb|EGI76242.1| hypothetical protein HGR_12087 [Hylemonella gracilis ATCC 19624]
          Length = 367

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 175/245 (71%), Gaps = 2/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            V+  VAVASGKGGVGKSTT  N+A AL  +G  V +LDAD+YGPS   ++ +SG+ E +
Sbjct: 100 GVRNIVAVASGKGGVGKSTTAANLALALAAEGARVGLLDADIYGPSQTMMMGVSGRPEST 159

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K + P +N+G+++MS+  LVD + AM+WRGPM   A+  ML    W  LD+L++DMPP
Sbjct: 160 DGKTMNPMQNHGVQVMSIGLLVDPDQAMVWRGPMATQALEQMLRQTNWNDLDYLIVDMPP 219

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++Q++P++G VIV+TPQD+AL+D K+ +SM++K+ +PI+G++ENM+  + S+
Sbjct: 220 GTGDIQLTLSQRVPVTGAVIVTTPQDIALLDAKKGVSMFEKVGVPILGLVENMAVHICSN 279

Query: 273 TGKKYDLFG-NGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
            G    +FG +GG R  AE+ G+P+L ++P  M +R+ +D G P VV + +S  + IY+ 
Sbjct: 280 CGHIEHIFGVDGGKRMAAEQ-GMPYLGALPLSMQIRIQADSGKPSVVADPDSEVAGIYKN 338

Query: 332 ISDRI 336
           ++ ++
Sbjct: 339 VARQV 343


>gi|300717548|ref|YP_003742351.1| ATPase [Erwinia billingiae Eb661]
 gi|299063384|emb|CAX60504.1| Putative ATPase [Erwinia billingiae Eb661]
          Length = 370

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 121/342 (35%), Positives = 204/342 (59%), Gaps = 11/342 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  ++ +L     P  K+N+  ++ L    ++ NT+++ + +P       ++L+ +A
Sbjct: 12  EALRAMVMGTLTTFEHPTLKHNLTTLKALHHCALMDNTLHIDLVMPFAWHSGFEALKESA 71

Query: 63  QQIIQNIPT-------VKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVN 115
              +  + +       + + + TL   KN P       VK  +AV+SGKGGVGKS+T VN
Sbjct: 72  SAELLRLTSATAISWRLTHDIATLKRVKNHP---GATGVKNIIAVSSGKGGVGKSSTAVN 128

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLV 174
           +A AL  +G  V +LDAD+YGPSIP +L    +   S D   + P   +G+   S+  LV
Sbjct: 129 MALALAAEGAKVGLLDADIYGPSIPDMLGTRDERPTSPDGTHMAPIMAHGLATNSIGYLV 188

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
            ++ AM+WRGPM   A+M +L+  +W  LD+L++DMPPGTGD  LT+AQ +P++G V+V+
Sbjct: 189 TDDNAMVWRGPMASKALMQLLNETMWPDLDYLVLDMPPGTGDIQLTLAQNVPVTGAVVVT 248

Query: 235 TPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGI 294
           TPQD+AL+D ++ I M++K+N+P++G++ENMS  + S+ G    +FG+GGA   AE+   
Sbjct: 249 TPQDIALVDARKGIVMFEKVNVPVLGIVENMSMHICSNCGHHEAIFGSGGAEKLAEQYHT 308

Query: 295 PFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             L  +P  + +R   D G P VV   +S  + +Y++++  +
Sbjct: 309 RLLAQLPLHITLREDLDDGQPTVVRRPDSEFTAMYRQLAGAV 350


>gi|170720313|ref|YP_001748001.1| hypothetical protein PputW619_1127 [Pseudomonas putida W619]
 gi|169758316|gb|ACA71632.1| protein of unknown function DUF59 [Pseudomonas putida W619]
          Length = 364

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 123/280 (43%), Positives = 182/280 (65%), Gaps = 6/280 (2%)

Query: 63  QQIIQNIPTVKNAVVTL----TENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
           Q  I+N+  V +A VT+      +K   Q     NVK  +AVASGKGGVGKSTT  N+A 
Sbjct: 63  QTAIENLDGVSSAQVTIDCMVAAHKAQAQVPAMANVKNVIAVASGKGGVGKSTTAANLAL 122

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKIS--GKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           AL  +G  V ILDAD+YGPS   +  I+   + +I ++K+  P + +G+++MSMA L D+
Sbjct: 123 ALAREGARVGILDADIYGPSQGVMFGIAEGTRPQIREQKWFVPIKAHGVEVMSMAFLTDD 182

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           N  M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TP
Sbjct: 183 NTPMVWRGPMVSGALLQLVTQTAWDDLDYLVIDMPPGTGDIQLTLAQKVPVAGSVIVTTP 242

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QDLAL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A + G+  
Sbjct: 243 QDLALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLAAQYGVEL 302

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L S+P  M +R  +D G P  +    S  + +YQE++ ++
Sbjct: 303 LASLPLSMLIREQADSGKPTAIAEPESQIAMVYQELARQV 342


>gi|307261484|ref|ZP_07543153.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|306868767|gb|EFN00575.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
          Length = 365

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 206/345 (59%), Gaps = 10/345 (2%)

Query: 1   MNQILKNQIVD---SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS 57
           MNQ+ + Q+ +    L+  + P  + +++ +    +  +    + L  T+P       ++
Sbjct: 1   MNQLNEQQLSEIKFVLQNFTHPTLQKDLIALNAFKKAELGAGILRLEFTMPFAWNSGFEA 60

Query: 58  LRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLN-----VKKFVAVASGKGGVGKSTT 112
           L++  +  ++ I T  N V  L   +    +R N +     VK  +AV SGKGGVGKSTT
Sbjct: 61  LKAETEAKLKQI-TAANEVKWLLNYQIATLKRANSHPAVNGVKNIIAVTSGKGGVGKSTT 119

Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMA 171
            VN+A ALK +G  V ILDAD+YGPSIP +L    +   S D K + P E YG++  S+ 
Sbjct: 120 SVNLALALKAQGAKVGILDADIYGPSIPHMLGAQDQRPTSPDNKHITPIEVYGLQSNSIG 179

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
            L+ ++ A IWRGPM  SA+  +L+   W +LD+L+IDMPPGTGD  LT++Q+IP++G V
Sbjct: 180 YLMADDNATIWRGPMASSALSQLLNETWWTELDYLVIDMPPGTGDIQLTLSQQIPVTGAV 239

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEK 291
           +V+TPQD+AL+D  + ISM+QK+++P++G+IENMS  +  + G   D+FG GGA   A+K
Sbjct: 240 VVTTPQDIALLDAIKGISMFQKVSVPVLGVIENMSVHICQNCGHHEDIFGTGGANKVAKK 299

Query: 292 IGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            G   L  +P  + +R   D G P VV      TS+ Y E++ ++
Sbjct: 300 YGTQVLGQMPLHIRLRQDLDAGTPTVVAAPEHETSQAYIELAAKV 344


>gi|322514012|ref|ZP_08067086.1| Mrp ATPase family protein [Actinobacillus ureae ATCC 25976]
 gi|322120162|gb|EFX92123.1| Mrp ATPase family protein [Actinobacillus ureae ATCC 25976]
          Length = 365

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/347 (38%), Positives = 204/347 (58%), Gaps = 14/347 (4%)

Query: 1   MNQILKNQIVDS---LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS 57
           MNQ+ + Q+ +    L+  + P  + +++ +    +  +    + L  T+P       ++
Sbjct: 1   MNQLNEQQLSEIKFILQNFTHPTLQKDLITLNAFKKAELDAGILRLEFTMPFAWNSGFEA 60

Query: 58  LRSNAQQIIQNIPTVKNA-------VVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKS 110
           L+++ +  ++ +             + TL    N P       VK  +AV SGKGGVGKS
Sbjct: 61  LKADTEAKLKQVTGANEVKWILNYQIATLKRANNHPAVNG---VKNIIAVTSGKGGVGKS 117

Query: 111 TTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMS 169
           TT VN+A ALK +G  V ILDAD+YGPSIP +L    +   S D K + P E YGI+  S
Sbjct: 118 TTSVNLALALKAQGAKVGILDADIYGPSIPHMLGAQDQRPTSPDNKHITPIEVYGIQSNS 177

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           +  L+ E+ A IWRGPM  SA+  +L+   W +LD+L+IDMPPGTGD  LT++Q+IP++G
Sbjct: 178 IGYLMAEDNATIWRGPMASSALSQLLNETWWTELDYLVIDMPPGTGDIQLTLSQQIPVTG 237

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEA 289
            V+V+TPQD+AL+D  + ISM+QK+++P++G+IENMS  +  + G   D+FG GGA   A
Sbjct: 238 AVVVTTPQDIALLDAIKGISMFQKVSVPVLGVIENMSVHICQNCGHHEDIFGTGGADKVA 297

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +K G   L  +P  + +R   D+G P VV      TS+ Y E++ ++
Sbjct: 298 KKYGTQVLGQMPLHIRLRQDLDVGTPTVVAAPEHETSQAYIELAAKV 344


>gi|241765110|ref|ZP_04763100.1| protein of unknown function DUF59 [Acidovorax delafieldii 2AN]
 gi|241365261|gb|EER60096.1| protein of unknown function DUF59 [Acidovorax delafieldii 2AN]
          Length = 363

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/241 (46%), Positives = 171/241 (70%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            VK  +AVASGKGGVGKSTT  N+A AL  +G +V +LDAD+YGPS P +L I+ + E  
Sbjct: 96  QVKNIIAVASGKGGVGKSTTAANLALALAAEGASVGVLDADIYGPSQPMMLGINRRPESD 155

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P ENYG+++MS+  LVD++ AMIWRGPM   A+  +L    W  LD+L+IDMPP
Sbjct: 156 DGKTMEPLENYGVQVMSIGFLVDQDEAMIWRGPMATQALEQLLRQTNWKDLDYLIIDMPP 215

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++Q++P++G VIV+TPQD+AL+D K+ I M++K+ +PI+G++ENM+  + S+
Sbjct: 216 GTGDIQLTLSQRVPMTGAVIVTTPQDIALLDAKKGIKMFEKVGVPILGIVENMAAHVCSN 275

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    +FG  G +  A   G+ +L ++P DM +R+ +D G P VV + +   ++IY+++
Sbjct: 276 CGHVEHIFGADGGKKMAADYGMDYLGALPLDMSIRLQADSGKPTVVADPDGDVAQIYKKV 335

Query: 333 S 333
           +
Sbjct: 336 A 336


>gi|163741585|ref|ZP_02148976.1| Mrp/NBP35 family protein [Phaeobacter gallaeciensis 2.10]
 gi|161385319|gb|EDQ09697.1| Mrp/NBP35 family protein [Phaeobacter gallaeciensis 2.10]
          Length = 356

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/333 (39%), Positives = 199/333 (59%), Gaps = 19/333 (5%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHT-IAHQLQSLRSNAQQ 64
           + +I D+L  L +P +   +V    L  + +    V   I  P+  IA Q++ LR  A+ 
Sbjct: 5   QEEIRDALARLQLP-DGGTLVSRDMLRAVMVDGGRVSFVIEAPNPQIAAQMEPLRRAAEA 63

Query: 65  IIQNIPTVKNAVV--------------TLTENKNPPQQRNNL---NVKKFVAVASGKGGV 107
            +  +P V +                 TL    +P  Q+  L    VK+ +AV SGKGGV
Sbjct: 64  TVLALPGVDSVSAALTAHADAAAKPAPTLKLGGHPKPQQGPLKPSGVKRILAVGSGKGGV 123

Query: 108 GKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKI 167
           GKST   N+A AL  +G+ V +LDAD+YGPS P+++  SG+    D K ++P   +G+ +
Sbjct: 124 GKSTVSANLAVALTRQGRKVGLLDADIYGPSQPRMMGASGRPASPDGKIIEPLHAHGVTL 183

Query: 168 MSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPL 227
           MS+  +VDE  A++WRGPM+  A+  ML  V WG+LD L++D+PPGTGD  LT+  K  L
Sbjct: 184 MSIGFMVDEAKAVVWRGPMLMGALQQMLGQVNWGELDVLIVDLPPGTGDVQLTLCTKAEL 243

Query: 228 SGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARF 287
           SG ++VSTPQD+AL+D ++A+ M+  +  P++G+IENMS+F   D G ++ +FG+GG   
Sbjct: 244 SGAIVVSTPQDVALLDARKALDMFNTLKTPVLGLIENMSFFTCPDCGGEHHIFGHGGVAA 303

Query: 288 EAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHN 320
           EAE++G+P L ++P D+D R+  D G PI   +
Sbjct: 304 EAERLGVPLLGALPIDLDTRLAGDSGTPIAAGD 336


>gi|170733776|ref|YP_001765723.1| cobyrinic acid ac-diamide synthase [Burkholderia cenocepacia MC0-3]
 gi|169817018|gb|ACA91601.1| Cobyrinic acid ac-diamide synthase [Burkholderia cenocepacia MC0-3]
          Length = 363

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 129/335 (38%), Positives = 205/335 (61%), Gaps = 5/335 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I + Q+  +L  +  P         + +  + I  + V L + + +    Q   +R+   
Sbjct: 3   IDRAQVDAALAAVVDPNTGRPYAANKGVRNVAIDGDVVALDVVLGYPARSQHDDVRARVA 62

Query: 64  QIIQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACA 119
             +Q +P V++A V +++    +  Q+   L  NVK  VAVASGKGGVGKSTT VN+A A
Sbjct: 63  TALQAVPGVRDARVAVSQEIVAHTVQRGVKLLPNVKNIVAVASGKGGVGKSTTAVNLALA 122

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMASLVDENV 178
           L  +G +V ILDAD+YGPS+P +L I G + E  D + + P   +G++  S+  L++E+ 
Sbjct: 123 LAAEGASVGILDADIYGPSLPTMLGIHGQRPESPDNQSMNPLVGHGLQANSIGFLIEEDN 182

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            M+WRGPM  SA+  +L    W +LD+L++DMPPGTGD  LT+AQ++P++G VIV+TPQD
Sbjct: 183 PMVWRGPMATSALEQLLRQTNWRELDYLIVDMPPGTGDIQLTLAQRVPVTGAVIVTTPQD 242

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +AL+D K+ + M++K+ IPI+G++ENMS  + S+ G +  +FG GGA   A+   +  L 
Sbjct: 243 IALLDAKKGLKMFEKVGIPILGIVENMSIHICSNCGHEEHIFGAGGAERMAKDYDVNVLG 302

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           S+P D+ +R  +D G P V    + A +  Y++I+
Sbjct: 303 SLPLDIAIRERADSGTPTVAAEPDGALARRYRDIA 337


>gi|227326676|ref|ZP_03830700.1| putative ATPase [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 369

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 124/339 (36%), Positives = 201/339 (59%), Gaps = 5/339 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +   L     P  KNN+  +  L    ++ N +++ +T+P      L  L+   
Sbjct: 11  EALRAMVTGVLSTFQHPTLKNNLTTLNALRHCALLDNVLHIDLTMPFVWLSGLAVLKETV 70

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIAC 118
              +  +   K     LT +    ++ N+      VK  +AV+SGKGGVGKS+T VN+A 
Sbjct: 71  SDELLRLSGAKAIEWRLTHDIATLRRVNDQAGVKGVKNIIAVSSGKGGVGKSSTAVNMAL 130

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G NV ILDAD+YGPSIP +L  + +   S D + + P   +G+   S+  LV ++
Sbjct: 131 ALAAEGANVGILDADIYGPSIPTMLGSASERPTSPDGQHMAPIIAHGLATNSIGYLVTDD 190

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A++ +L + +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+TPQ
Sbjct: 191 NAMVWRGPMASKALLQLLQDTLWPDLDYLVLDMPPGTGDIQLTLAQSIPVTGAVVVTTPQ 250

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D  + I+M++K+++P++G++ENMS  + S+ G    +FG GGA+  AEK     L
Sbjct: 251 DIALMDAMKGIAMFEKVSVPVLGIVENMSVHICSNCGHLEPIFGTGGAQKLAEKYHCSLL 310

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P  + +R   D G P VV   +S  + +Y+E++ ++
Sbjct: 311 GQLPLHISLREDLDRGEPTVVSQPDSEFTSLYRELAGQV 349


>gi|312959252|ref|ZP_07773770.1| ATP-binding protein involved in chromosome partitioning
           [Pseudomonas fluorescens WH6]
 gi|311286512|gb|EFQ65075.1| ATP-binding protein involved in chromosome partitioning
           [Pseudomonas fluorescens WH6]
          Length = 364

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 125/280 (44%), Positives = 182/280 (65%), Gaps = 6/280 (2%)

Query: 63  QQIIQNIPTVKNAVV----TLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
           Q  I+ +  V++A V     +  +K   Q     NVK  VAVASGKGGVGKSTT  N+A 
Sbjct: 63  QMAIEGLDGVRSAKVDIQCVIAPHKAQAQIPGLANVKNVVAVASGKGGVGKSTTAANLAL 122

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKIS--GKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           AL  +G  V ILDAD+YGPS   +  I+   + ++ D+K+  P E+ G+++MSMA L D+
Sbjct: 123 ALAREGARVGILDADIYGPSQGVMFGIAEGTRPKVKDQKWFVPIESLGVEVMSMAFLTDD 182

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           N  M+WRGPMV  A++ ++    WG LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TP
Sbjct: 183 NTPMVWRGPMVSGALLQLVTQTAWGDLDYLVIDMPPGTGDIQLTLAQKVPVAGAVIVTTP 242

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QDLAL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A +  +  
Sbjct: 243 QDLALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLATQYDVEL 302

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L S+P  M +R  +D G P V+   +S  + IYQE++  +
Sbjct: 303 LASLPLSMLIREQADGGKPTVMAEPDSQIAMIYQELARHV 342


>gi|187476983|ref|YP_785007.1| amidase [Bordetella avium 197N]
 gi|115421569|emb|CAJ48079.1| putative amidase [Bordetella avium 197N]
          Length = 364

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 168/244 (68%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NV+  +AVASGKGGVGKSTT VN+A AL  +G +V +LDAD+YGPSIP +L I+G+ E  
Sbjct: 95  NVRNIIAVASGKGGVGKSTTSVNLALALAAEGASVGVLDADIYGPSIPTMLGITGRPESL 154

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P   +GI+  S+  L+D +   IWRGPMV  A+  +L    W  LD+L++DMPP
Sbjct: 155 DNKSMEPLVGHGIQANSIGFLIDADSPAIWRGPMVTQALEQLLRQTNWRDLDYLIVDMPP 214

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQK+P+ G VIV+TPQD+AL+D ++ + M+QK+ +PI+G++ENM+  + S 
Sbjct: 215 GTGDVALTLAQKVPVVGAVIVTTPQDIALLDARKGLRMFQKVEVPILGVVENMAIHVCSQ 274

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    +FG GG +  A +  +P+L S+P  + +R  +D G P VV +  S  + +Y+EI
Sbjct: 275 CGHAEHIFGEGGGQRMAAQYEVPWLGSLPLTLAIREQTDAGAPTVVADPQSEAAGLYREI 334

Query: 333 SDRI 336
           + ++
Sbjct: 335 ARKV 338


>gi|110596892|ref|ZP_01385182.1| conserved hypothetical protein [Chlorobium ferrooxidans DSM 13031]
 gi|110341579|gb|EAT60039.1| conserved hypothetical protein [Chlorobium ferrooxidans DSM 13031]
          Length = 372

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 119/235 (50%), Positives = 163/235 (69%), Gaps = 3/235 (1%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK-ISGKVEI 151
           NVK  +AVASGKGGVGKST  VN+A +L   G  V ++DAD+YGPSIP +   +  K E+
Sbjct: 115 NVKNIIAVASGKGGVGKSTFAVNLAVSLAGTGAKVGLIDADLYGPSIPTMFGLLDAKPEV 174

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            +K  L P E YG+K+MS+  LVD + A++WRGPM  SAI   ++ V W +LD+L+ DMP
Sbjct: 175 VNKN-LVPLEKYGVKLMSIGFLVDTDTAVVWRGPMASSAIKQFINEVDWNELDYLIFDMP 233

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  +T+ Q +PL+G VIV+TPQD+AL DV +A+SM++K+N+PI+G++ENMSY+   
Sbjct: 234 PGTGDIQITLVQTLPLTGAVIVTTPQDVALADVSKAVSMFRKVNVPILGLVENMSYYELP 293

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATS 326
           D  K Y +FG+ G    A   G+ FL S+P D +VR   D G P V+ +  SATS
Sbjct: 294 DGTKDY-IFGHHGGENFARTHGLEFLGSIPIDREVREDGDNGTPYVLGHSGSATS 347


>gi|256819881|ref|YP_003141160.1| Mrp/Nbp35 family ATP-binding protein [Capnocytophaga ochracea DSM
           7271]
 gi|256581464|gb|ACU92599.1| Mrp/Nbp35 family ATP-binding protein [Capnocytophaga ochracea DSM
           7271]
          Length = 373

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 128/348 (36%), Positives = 205/348 (58%), Gaps = 20/348 (5%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITV--------PHTIAHQL 55
           I K  ++++L+ ++ PGE  N+V+   +  I +  + V + + +          T    +
Sbjct: 3   IQKKDVLEALRKITTPGEGKNMVDSGAVQNIVVFGDEVVVDVVINNPSLQAKKRTEVEVM 62

Query: 56  QSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVN 115
           +++     +  + +  VK     +TE K  P       ++  +AVASGKGGVGKST   N
Sbjct: 63  KAIHGEVNEKAKVVVNVKVIAPEVTEIKGKPIP----GIQNIIAVASGKGGVGKSTVTAN 118

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGK----VEISDKKFLKPKENYGIKIMSMA 171
           +A AL   G  V +LDADVYGPSIP +  ++ +    V I DK F++P ENYG+KI+S+ 
Sbjct: 119 LAAALAKMGFKVGVLDADVYGPSIPMMFDVATERPRSVTIEDKSFIQPIENYGVKILSIG 178

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
              + N A+IWRGPM   A+  ++    WG+LDFLLID+PPGTGD HL+I Q +P++G V
Sbjct: 179 FFTNANQAVIWRGPMAAKALNQLIFEAYWGELDFLLIDLPPGTGDIHLSIMQALPITGAV 238

Query: 232 IVSTPQDLALIDVKRAISMY--QKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFE 288
           +VSTPQ +AL D +RA++M+  + +N+P++G++ENM+YF   +    KY +FG  GA+  
Sbjct: 239 VVSTPQPVALADARRAVAMFGQENINVPVLGIVENMAYFTPEELPNNKYYIFGKEGAKHL 298

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           A ++ +PFL  +P    VR   D G PI +   +S  ++ +  ++  +
Sbjct: 299 AGELKVPFLGEIPLVQAVREAGDTGQPIALQE-DSPQAKAFHSLAQEV 345


>gi|326796148|ref|YP_004313968.1| ATPase-like, ParA/MinD [Marinomonas mediterranea MMB-1]
 gi|326546912|gb|ADZ92132.1| ATPase-like, ParA/MinD [Marinomonas mediterranea MMB-1]
          Length = 355

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 133/340 (39%), Positives = 200/340 (58%), Gaps = 14/340 (4%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           +   +I+ +L  LS   ++N  V    +  I    + V + +++ +    +  S++    
Sbjct: 2   LTDQEILSALAQLS---DENTGVPFGDVWNIETSEHAVSIRLSLSYYADREKDSIKKRVM 58

Query: 64  QIIQNIPTVK----NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVVNIAC 118
            +I +  TV     N VV  +   N P     LN VK  +AVASGKGGVGKSTT VN+A 
Sbjct: 59  SVINDGRTVSLEIDNNVVAASVQNNLP----GLNGVKNVIAVASGKGGVGKSTTTVNLAL 114

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVE--ISDKKFLKPKENYGIKIMSMASLVDE 176
           A+  +G  V ILDAD+YGPS   ++  S +    + D KF  P   +GI++MSMA L  +
Sbjct: 115 AMAKEGAKVGILDADIYGPSQGMMMGFSLETRPGVRDDKFFVPPVAHGIQVMSMAFLTTK 174

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              + WRGPMV  A+M +L    W +LD+L IDMPPGTGD  LT++QK+P++G VIV+TP
Sbjct: 175 ETPVAWRGPMVTGALMQILTQTDWEELDYLFIDMPPGTGDIQLTLSQKVPVTGSVIVTTP 234

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QD+AL+D +R I M++K+NI ++G++ENMS  + S  G +  +FG  G +  A++ G+  
Sbjct: 235 QDIALLDARRGIEMFRKVNISVLGVVENMSTHICSSCGHQEAIFGEEGGQTLAQEYGVGV 294

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L  +P  M +R  +D G P VV    S  +EIYQ I+ ++
Sbjct: 295 LGKLPLSMSIRKQADTGAPTVVSEPESDITEIYQSIARKL 334


>gi|262040133|ref|ZP_06013386.1| Mrp/NBP35 ATP-binding protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259042486|gb|EEW43504.1| Mrp/NBP35 ATP-binding protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 369

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 129/340 (37%), Positives = 200/340 (58%), Gaps = 11/340 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+  +  +L     P  K+N+  ++ L  +  + +TV++ + +P   +   ++L+     
Sbjct: 13  LRAMVAGTLANFQHPTLKHNLTALKALHHVAWLDDTVHIELQMPFVWSSAFEALKEQCSA 72

Query: 65  IIQNIPTVK-------NAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIA 117
            +  I   K       +++ TL   KN P       VK  +A++SGKGGVGKS+T VN+A
Sbjct: 73  ELLRITGAKAIDWKLTHSIATLKRVKNQPGVNG---VKNIIAISSGKGGVGKSSTAVNLA 129

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDE 176
            AL  +G  V ILDAD+YGPSIP +L        S D   + P   YG+   S+  LV +
Sbjct: 130 LALAAEGAKVGILDADIYGPSIPTMLGAEDSRPTSPDGTHMAPIMKYGLATNSIGYLVTD 189

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           + AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+TP
Sbjct: 190 DNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTTP 249

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK     
Sbjct: 250 QDIALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAQKLAEKYHTQL 309

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L  +P  + +R   D G P VV   +S  ++IY++++ R+
Sbjct: 310 LGQLPLHITLREDLDNGTPTVVVRPDSEFTDIYRQLAGRV 349


>gi|91786833|ref|YP_547785.1| putative iron sulfur-binding protein [Polaromonas sp. JS666]
 gi|91696058|gb|ABE42887.1| putative iron sulfur binding protein [Polaromonas sp. JS666]
          Length = 363

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 125/332 (37%), Positives = 204/332 (61%), Gaps = 4/332 (1%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           I+++L+ +  P    + V  + L  + I    V   + + +    Q+ ++R       + 
Sbjct: 8   ILNALQSVLDPNTGKDFVSTKALKNLQINDGDVSFDVELGYPAKSQMAAIRKMLIAATKG 67

Query: 69  IPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNKG 124
           +  V N  V +      +  Q+   L  NVK  +AVASGKGGVGKSTT VN+A AL  +G
Sbjct: 68  VAGVNNVSVNIAVKIAAHSVQRGVQLLPNVKNIIAVASGKGGVGKSTTAVNLALALAAEG 127

Query: 125 KNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRG 184
            +V +LDAD+YGPS P ++ I G+ E  D K ++P ENYGI++MS+  LV ++ AMIWRG
Sbjct: 128 ASVGLLDADIYGPSQPMMMGIEGRPESVDGKNMEPMENYGIQVMSIGFLVAQDEAMIWRG 187

Query: 185 PMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDV 244
           PM   A+  +L    W  LD+L++D+PPGTGD  LT++Q++P++G VIV+TPQD+AL+D 
Sbjct: 188 PMATQALEQLLRQTNWKDLDYLIVDLPPGTGDIQLTLSQRVPMTGAVIVTTPQDIALLDA 247

Query: 245 KRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDM 304
           K+ I M++K+ +PI+G++ENM+  + S  G    +FG  G +  A    + +L ++P D+
Sbjct: 248 KKGIKMFEKVGVPILGIVENMAVHVCSQCGHAEHIFGEDGGKRLAADYHMDYLGALPLDI 307

Query: 305 DVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           ++R+ +D G P VV + +   + IY+ ++ ++
Sbjct: 308 NIRLQADNGRPTVVADPDGDVAAIYKAVARKV 339


>gi|261749349|ref|YP_003257034.1| Mrp/Nbp35 family ATP-binding protein [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
 gi|261497441|gb|ACX83891.1| Mrp/Nbp35 family ATP-binding protein [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
          Length = 343

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 125/307 (40%), Positives = 189/307 (61%), Gaps = 11/307 (3%)

Query: 22  KNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTE 81
           K NI+E   + +I I    + + I++ +   H  + L  N QQ I+     K   +   E
Sbjct: 16  KRNIMESGIVKKIDIFQEEIRIYISLSNPTMHMKKKLERNIQQAIKYQNVDKKIRI---E 72

Query: 82  NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPK 141
            K  P ++    +K  +A+ASGKGGVGKST   NIA +L   G +V +LDAD+YGPSIP 
Sbjct: 73  MKLDPSEKKKTEIKNVIAIASGKGGVGKSTIATNIAVSLVKMGFHVGLLDADIYGPSIPL 132

Query: 142 LLKI------SGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHML 195
           +  +      S  ++ +    + P  +YG+KI+S+        A++WRGPM   A+   +
Sbjct: 133 MFNLEENKISSCIIQKNGTSIMNPIISYGVKILSLGFFSKSGQAIVWRGPMATKALRQFI 192

Query: 196 HNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQ--K 253
           H   WG+LDFL++D+PPGTGD HL++ Q+IPL G+VIVSTPQ ++L DV R++ M++   
Sbjct: 193 HETDWGRLDFLIVDLPPGTGDIHLSLVQEIPLKGIVIVSTPQKISLSDVHRSVGMFRLKS 252

Query: 254 MNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLG 313
           +++PI+G+IENMS+F+  D+ +KY LFG  G +  ++K  I FL  +P   D+RV SDLG
Sbjct: 253 IHVPILGIIENMSFFIPKDSKEKYYLFGKNGVKNFSKKKNIFFLGEIPLLQDIRVSSDLG 312

Query: 314 IPIVVHN 320
           IP+V+ N
Sbjct: 313 IPVVLQN 319


>gi|332533548|ref|ZP_08409410.1| putative ATPase of the MinD/MRP superfamily protein
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036950|gb|EGI73409.1| putative ATPase of the MinD/MRP superfamily protein
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 346

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 115/237 (48%), Positives = 166/237 (70%), Gaps = 2/237 (0%)

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS- 152
           +K  V +ASGKGGVGKSTT VN+A ALKN+G  V ILDAD+YGPSIP LL + G   ++ 
Sbjct: 84  IKHIVLIASGKGGVGKSTTAVNLAGALKNEGAKVGILDADIYGPSIPMLLGLVGAEPVTK 143

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K L+P +  GIK  S+  LV  + A +WRGPM   A+  +L+   WG+LD+L++DMPP
Sbjct: 144 DNKQLQPFDANGIKAQSIGFLVPSDDATVWRGPMASGALSQLLNETDWGELDYLIVDMPP 203

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++QK+P SG VIV+TPQDLAL D ++ I+M+ K+N+P++G+IENMS+++ + 
Sbjct: 204 GTGDIQLTMSQKVPASGTVIVTTPQDLALADAQKGIAMFNKVNVPVLGLIENMSHYICTH 263

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
            G+   +FG  GA+  A K G+P L  +P  +D+R  S+ G  ++  + ++A S+ Y
Sbjct: 264 CGEANHVFGKDGAQKLAHKHGVPVLSHIPLAIDIREYSEQG-KLIASDNDAAISKTY 319


>gi|291276922|ref|YP_003516694.1| putative ATP/GTP-binding protein [Helicobacter mustelae 12198]
 gi|290964116|emb|CBG39960.1| putative ATP/GTP-binding protein [Helicobacter mustelae 12198]
          Length = 367

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 126/344 (36%), Positives = 209/344 (60%), Gaps = 9/344 (2%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + +  ++ +LK +  P  + +IV    + +I + ++ + L I +P      +  L     
Sbjct: 2   LTQENVLQTLKTIIYPNFQKDIVTFGFVKDITLHNDALALRIEIPSNSPEVIHRLDREIH 61

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQRNNLNV----KKFVAVASGKGGVGKSTTVVNIACA 119
           + I+NI   K   + +   + P Q+    N+    + FV ++SGKGGVGKSTT VN+A A
Sbjct: 62  EKIRNIGIAK-LQLDIKTPQTPEQKSTTKNIAPQIQHFVMISSGKGGVGKSTTSVNLAIA 120

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGK---VEISDKKFLKPKENYGIKIMSMASLVDE 176
           L  +GK V +LDAD+YGP+IP++L ++ +   V+ S KK L P + YG++++SM  L +E
Sbjct: 121 LAQQGKKVGLLDADIYGPNIPRMLGLNTQKPEVDASGKK-LYPIKAYGVEMISMGILYEE 179

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
             ++IWRGPM+  AI  +L +V+W +LD L+IDMPPGTGDA LT+AQ +P+S  + V+TP
Sbjct: 180 GQSLIWRGPMIMRAIQQLLTDVIWSELDVLVIDMPPGTGDAQLTLAQSVPVSAGITVTTP 239

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++L D  R++ M+QK+++PI G++ENMS F+  + G + D+FG G ++  A+      
Sbjct: 240 QRVSLDDSMRSLDMFQKLDVPIAGIVENMSGFICGNCGVESDIFGKGASKDLADTYKTTL 299

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
           L  +P +  +R   D G PIV     S +++ Y +++D +  F 
Sbjct: 300 LAQIPLEAKIRESGDSGRPIVFFEPESVSAKSYMKMADTLIAFL 343


>gi|324114470|gb|EGC08439.1| ParA/MinD ATPase [Escherichia fergusonii B253]
          Length = 369

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 130/343 (37%), Positives = 201/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 11  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 70

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 71  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 126

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 127 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 186

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 187 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 246

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FGNGGA   AEK  
Sbjct: 247 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGNGGAEKLAEKYH 306

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 307 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 349


>gi|315425957|dbj|BAJ47606.1| ATP-binding protein involved in chromosome partitioning [Candidatus
           Caldiarchaeum subterraneum]
          Length = 357

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 126/334 (37%), Positives = 204/334 (61%), Gaps = 3/334 (0%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           +  ++++L+ +  P  K +IV +  +  + I    V  ++ +        +S+  +A+  
Sbjct: 5   EQTVLNALRQVIDPDLKIDIVTLGMIKNLVIKDGDVSFTLELTTPACPYNKSIEDSARAA 64

Query: 66  IQNIPTVKNAVVTLTEN--KNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNK 123
           +++IP V++  + +T       P      +VK  VAVASGKGGVGK+T  +N+AC+L   
Sbjct: 65  VESIPGVRSVDMRVTARVWSAKPMASTYPDVKNVVAVASGKGGVGKTTVAINLACSLALS 124

Query: 124 GKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENVAMIW 182
           G  V ++DAD+YGP+IPK++KI     +  DKK    K   GIK+MS+   VDE  A+IW
Sbjct: 125 GARVGLVDADIYGPTIPKIVKIVEPPRLRPDKKVEPAKMMLGIKVMSLGLFVDEGTAVIW 184

Query: 183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI 242
           RGP+V SA+  +L    WG+LD+L++D+PPGTGDA LT+AQ +PL+GVVIV+TPQ  A +
Sbjct: 185 RGPLVASAVKQLLTEAQWGELDYLIVDLPPGTGDASLTLAQTMPLTGVVIVTTPQQAASV 244

Query: 243 DVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPF 302
              +A+SM++++ + IIG++ENMSY++  + GK+  LFG       A ++ +  L  +P 
Sbjct: 245 IAAKALSMFRRLGVTIIGIVENMSYYVCPECGKESSLFGQSHTDKMAAELDVEVLGRIPM 304

Query: 303 DMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             DV V  D G+PIV+   +S  ++ + E + +I
Sbjct: 305 SPDVSVNHDQGVPIVLAAPSSPAAKAFDEAAKKI 338


>gi|114563416|ref|YP_750929.1| ATP-binding protein, Mrp/Nbp35 family protein [Shewanella
           frigidimarina NCIMB 400]
 gi|114334709|gb|ABI72091.1| ATP-binding protein, Mrp/Nbp35 family protein [Shewanella
           frigidimarina NCIMB 400]
          Length = 371

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 165/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG-KVEI 151
           NVK+ +AVASGKGGVGKSTT VN+A ALK +G  V ILDAD+YGPSIP +L I   + + 
Sbjct: 106 NVKQVIAVASGKGGVGKSTTAVNLALALKAEGAEVGILDADIYGPSIPLMLGIPNFRPQS 165

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K + P   +GI   S+  ++  + A +WRGPM   A+  +L+   W +LD+L+IDMP
Sbjct: 166 PDGKHMTPALVHGISAQSIGFMLSGDEAAVWRGPMAAGALAQLLNETQWPELDYLIIDMP 225

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT++QK+P+SG VIV+TPQD+AL D K+ I+M+ K+NIP++G+IENMS+ L  
Sbjct: 226 PGTGDIQLTLSQKVPVSGAVIVTTPQDIALADAKKGITMFNKVNIPVLGIIENMSFHLCP 285

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
           + G K   FG  G    AE+  +P L S+P  +++R   D G P V+    S  S IY+E
Sbjct: 286 ECGHKEHPFGTHGGSQIAERYNVPLLGSLPLHINIRESMDNGTPSVMSEPESEVSGIYRE 345

Query: 332 ISDRI 336
           I+ ++
Sbjct: 346 IARKL 350


>gi|89889430|ref|ZP_01200941.1| ATP binding protein Mrp [Flavobacteria bacterium BBFL7]
 gi|89517703|gb|EAS20359.1| ATP binding protein Mrp [Flavobacteria bacterium BBFL7]
          Length = 379

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 126/354 (35%), Positives = 211/354 (59%), Gaps = 24/354 (6%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           +I K Q++ +L+ +S+PG   N+VE   +  + +  + V + +T+ +     LQ+ +   
Sbjct: 2   KIEKQQVMKALETISVPGHGQNMVESGAIKNVLVFGDEVVVDVTIDNP---SLQAKKKTE 58

Query: 63  QQIIQNI--PTVKNAVVTL--------TENKNPPQQRNNL-NVKKFVAVASGKGGVGKST 111
             I+Q I     + A + +        TENK P  +   +  +   +AVASGKGGVGKST
Sbjct: 59  VSILQAIHKEVYEKAQIKVNLKVEAPVTENKTPEIKGKPIPGIDNIIAVASGKGGVGKST 118

Query: 112 TVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGK----VEISDKKFLKPKENYGIKI 167
              N+A +L   G  V +LDAD+YGPS   +  +  +    V +  K  +KP E+YG+KI
Sbjct: 119 VTANLAVSLAKMGFKVGLLDADIYGPSATIMFDVVNEKPLSVNVDGKSKMKPVESYGVKI 178

Query: 168 MSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPL 227
           +S+      + A++WRGPM   A+  M+ +  WG+LDFL++D+PPGTGD HL+I Q +PL
Sbjct: 179 LSIGFFTQPDQAVVWRGPMAAKALNQMIFDAAWGELDFLIVDLPPGTGDIHLSIMQSLPL 238

Query: 228 SGVVIVSTPQDLALIDVKRAISMYQK--MNIPIIGMIENMSYFLASD-TGKKYDLFGNGG 284
           +G V+VSTPQ++AL D ++ ++M+Q+  +N+P++G++ENM+YF   +    KY +FG  G
Sbjct: 239 TGAVVVSTPQNVALADARKGVAMFQQESINVPVLGIVENMAYFTPPELPDHKYHIFGKDG 298

Query: 285 ARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHN---MNSATSEIYQEISDR 335
           A+  AE +G+PFL  +P    +R   D+G P  + +   + +A +EI + + ++
Sbjct: 299 AKHLAEDLGVPFLGELPLQQSIREAGDIGRPAALQDATEIETAFTEITKNVVEQ 352


>gi|282599571|ref|ZP_05971057.2| mrp protein [Providencia rustigianii DSM 4541]
 gi|282568555|gb|EFB74090.1| mrp protein [Providencia rustigianii DSM 4541]
          Length = 387

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 126/343 (36%), Positives = 200/343 (58%), Gaps = 5/343 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           ++L  Q+   L   + P  + N++ ++ L    ++ N +++ + +P       Q+L S  
Sbjct: 29  ELLTEQVSTVLASFTHPTLQRNLISIKALHHCALLDNVLHVELVMPFVWKGPFQTLISEK 88

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIAC 118
              ++ +         L  +    ++ N+L     V+  +AV+SGKGGVGKS+T VN+A 
Sbjct: 89  TAELKQLTGAHAIEWKLRHDITTLKRANDLPGINGVRNILAVSSGKGGVGKSSTSVNLAL 148

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G  V ILDAD+YGPSIP +L  + +   S D + + P   YG+   S+  LV ++
Sbjct: 149 ALAQEGAKVGILDADIYGPSIPNMLGTTLERPTSPDGQHMAPIMAYGLATNSIGYLVTDD 208

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A+M ML + +W  LD+L+IDMPPGTGD  LT++Q IP++G V+V+TPQ
Sbjct: 209 NAMVWRGPMASKALMQMLQDTLWPDLDYLVIDMPPGTGDIQLTLSQNIPVTGAVVVTTPQ 268

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D  + I M++K+N+P++G++ENMS  + S+ G    +FG GGA   AEK     L
Sbjct: 269 DIALVDAMKGIVMFKKVNVPVLGVVENMSAHICSNCGHIEPIFGTGGAEKLAEKYNTKLL 328

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
             VP  + +R   D G P V+ +     ++IY+EI+  I    
Sbjct: 329 GQVPLHISLREDLDRGQPTVMRDPEGEFADIYREIASNISALM 371


>gi|148238796|ref|YP_001224183.1| ATPases involved in chromosome partitioning [Synechococcus sp. WH
           7803]
 gi|147847335|emb|CAK22886.1| ATPases involved in chromosome partitioning [Synechococcus sp. WH
           7803]
          Length = 358

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 124/352 (35%), Positives = 209/352 (59%), Gaps = 22/352 (6%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I   Q   +L  L   G   +++++  L ++ +      + + +P     Q   + ++A+
Sbjct: 2   ISAEQATQALSDLRDAGSDRSLLDLGWLDQVRVSPPRAVIRLNLPGFAQGQRDRIVNDAR 61

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQ-------------RNNL-NVKKFVAVASGKGGVGK 109
             +  +  +++  +   E   PP Q             R  +  VK+ +AV+SGKGGVGK
Sbjct: 62  TRLLRLEGIEDVQI---EVGQPPSQGGIGQAGHGQAAERQAIPGVKQVIAVSSGKGGVGK 118

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV-EIS---DKKFLKPKENYGI 165
           ST  VN+ACA  N+G  V +LDAD+YGP+ P +L ++    E+S   D + ++P E  G+
Sbjct: 119 STVAVNLACAFANQGLRVGLLDADIYGPNAPTMLGVADCTPEVSGSGDNQCMQPIETCGV 178

Query: 166 KIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKI 225
            ++SM  L++EN  +IWRGPM+   I   L+ V WG+ D L++D+PPGTGDA L++AQ +
Sbjct: 179 AMVSMGLLIEENQPVIWRGPMLNGIIRQFLYQVNWGERDVLVVDLPPGTGDAQLSLAQAV 238

Query: 226 PLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDT-GKKYDLFGNGG 284
           P++GVVIV+TPQ +AL D +R ++M+++M IP++G++ENMS F+  D   K+Y LFG+GG
Sbjct: 239 PMAGVVIVTTPQQVALQDARRGLAMFRQMGIPVLGVVENMSAFIPPDQPEKRYALFGSGG 298

Query: 285 ARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +  AE   +P L  +P +M V+   D G+PI     +S +++ +  +++R+
Sbjct: 299 GKTLAEAFDVPLLAEIPMEMPVQAGGDQGLPITRAKPDSISAQQFIALAERL 350


>gi|126735368|ref|ZP_01751114.1| Mrp/NBP35 family protein, putative [Roseobacter sp. CCS2]
 gi|126715923|gb|EBA12788.1| Mrp/NBP35 family protein, putative [Roseobacter sp. CCS2]
          Length = 357

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 130/351 (37%), Positives = 213/351 (60%), Gaps = 22/351 (6%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTI-AHQLQSLRSNA 62
           + +++I+ +L  L++PG  +++V    +  + I   TV   I       A ++  +R  A
Sbjct: 3   VTRDEILGALSRLTLPG-GDDLVSRDMVRALNIEGGTVRFVIEAADPGEASKMDGVRRAA 61

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVK------------------KFVAVASGK 104
           + I++ +P V++A V LT +   P+     ++K                  + +A+ SGK
Sbjct: 62  EDIVRRLPGVESATVVLTAHGPAPKAPEPPSLKIGRHPTPQAGPAKVSGVDRILAIGSGK 121

Query: 105 GGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYG 164
           GGVGKST   N+A AL  +G+ V +LDAD+YGPS P+++ ++ +    D K + P + +G
Sbjct: 122 GGVGKSTVSSNLAVALAREGRRVGLLDADIYGPSQPRMMGVNKRPGSPDGKTIIPLQAHG 181

Query: 165 IKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQK 224
           + +MS+  +++E  A++WRGPM+  A+  ML  V WG+LD L++D+PPGTGD  LT+ QK
Sbjct: 182 VTMMSIGLMMEEGKAVVWRGPMLMGALQQMLGQVQWGELDVLIVDLPPGTGDVQLTLCQK 241

Query: 225 IPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGG 284
             L+G VIVSTPQD+AL+D ++A+ M+  +N P++GMIENMS F+    G +  +FG GG
Sbjct: 242 TELTGAVIVSTPQDVALLDARKALDMFNSLNTPVLGMIENMSTFVCPTCGTESHIFGQGG 301

Query: 285 ARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
              EAEKIG+PFL ++P D++ R+  D G PI     +S  ++ Y+ ++ R
Sbjct: 302 VAAEAEKIGVPFLGALPIDLETRLAGDSGTPIAAG--DSPMADAYRAMARR 350


>gi|107023373|ref|YP_621700.1| cobyrinic acid a,c-diamide synthase [Burkholderia cenocepacia AU
           1054]
 gi|116690455|ref|YP_836078.1| cobyrinic acid a,c-diamide synthase [Burkholderia cenocepacia
           HI2424]
 gi|105893562|gb|ABF76727.1| Cobyrinic acid a,c-diamide synthase [Burkholderia cenocepacia AU
           1054]
 gi|116648544|gb|ABK09185.1| Cobyrinic acid a,c-diamide synthase [Burkholderia cenocepacia
           HI2424]
          Length = 363

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 129/335 (38%), Positives = 204/335 (60%), Gaps = 5/335 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I + Q+  +L  +  P         + +  + I  + V L + + +    Q   +R+   
Sbjct: 3   IDRAQVDAALAAVVDPNTGRPYAANKGVRNVAIDGDVVALDVVLGYPARSQHDDVRARVA 62

Query: 64  QIIQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACA 119
             +Q +P V+ A V +++    +  Q+   L  NVK  VAVASGKGGVGKSTT VN+A A
Sbjct: 63  TALQAVPGVRGARVAVSQEIVAHTVQRGVKLLPNVKNIVAVASGKGGVGKSTTAVNLALA 122

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMASLVDENV 178
           L  +G +V ILDAD+YGPS+P +L I G + E  D + + P   +G++  S+  L++E+ 
Sbjct: 123 LAAEGASVGILDADIYGPSLPTMLGIHGQRPESPDNQSMNPLVGHGLQANSIGFLIEEDN 182

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            M+WRGPM  SA+  +L    W +LD+L++DMPPGTGD  LT+AQ++P++G VIV+TPQD
Sbjct: 183 PMVWRGPMATSALEQLLRQTNWRELDYLIVDMPPGTGDIQLTLAQRVPVTGAVIVTTPQD 242

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +AL+D K+ + M++K+ IPI+G++ENMS  + S+ G +  +FG GGA   A+   +  L 
Sbjct: 243 IALLDAKKGLKMFEKVGIPILGIVENMSIHICSNCGHEEHIFGAGGAERMAKDYDVNVLG 302

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           S+P D+ +R  +D G P V    + A +  Y++I+
Sbjct: 303 SLPLDIAIRERADSGTPTVAAEPDGALARRYRDIA 337


>gi|254413156|ref|ZP_05026928.1| conserved domain protein [Microcoleus chthonoplastes PCC 7420]
 gi|196180320|gb|EDX75312.1| conserved domain protein [Microcoleus chthonoplastes PCC 7420]
          Length = 355

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 127/328 (38%), Positives = 213/328 (64%), Gaps = 9/328 (2%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
           + ++D L+ +  P  + ++VE+  +  + I   TV  ++ +        + +  + Q+ +
Sbjct: 5   HSVLDVLRPVQDPELQKSLVELNMIRNVKIDGGTVSFTLVLTTPACPLREFIVEDCQKAV 64

Query: 67  QNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +P V+  VV +T    + ++ P ++    VK  VA++SGKGGVGKST  VN+A AL  
Sbjct: 65  KQLPDVEEVVVDVTAETPQQQSLPDRQGIDGVKNLVAISSGKGGVGKSTVAVNVAVALAQ 124

Query: 123 KGKNVAILDADVYGPSIPKLLKIS-GKVEISDK---KFLKPKENYGIKIMSMASLVDENV 178
            G  V ++DAD+YGP+   +L ++  KV +      + L+P  N+GIK++SMA L+D + 
Sbjct: 125 TGAKVGLIDADIYGPNTAAMLGLADAKVMVQQGPQGEVLEPAFNHGIKLVSMAFLIDPDQ 184

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
            +IWRGPM+   I   L+ V WG+LD+L++DMPPGTGDA LT+AQ +P++G +IV+TPQ+
Sbjct: 185 PVIWRGPMLNGIIRQFLYQVNWGELDYLIVDMPPGTGDAQLTLAQAVPMAGAIIVTTPQN 244

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPFL 297
           +AL+D +R + M+Q++ +P++G++ENMSYF+  D   ++YDLFG+GG    A+++GIP L
Sbjct: 245 VALLDSRRGLKMFQQLGVPVLGIVENMSYFIPPDLPDRQYDLFGSGGGEKTAQELGIPLL 304

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSAT 325
             +P ++++R   D G+PIVV    SA+
Sbjct: 305 GCIPLEINLRQGGDRGLPIVVAEPESAS 332


>gi|78067235|ref|YP_370004.1| hypothetical protein Bcep18194_A5766 [Burkholderia sp. 383]
 gi|77967980|gb|ABB09360.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 363

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 123/285 (43%), Positives = 188/285 (65%), Gaps = 5/285 (1%)

Query: 54  QLQSLRSNAQQIIQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGK 109
           Q   +R+     +Q +  V++A V +++    +  Q+   L  NVK  VAVASGKGGVGK
Sbjct: 53  QHDDVRARITAALQAVAGVRDARVAVSQEIVAHTVQRGVKLLPNVKNIVAVASGKGGVGK 112

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIM 168
           STT VN+A AL  +G +V ILDAD+YGPS+P +L I G + E  D + + P   +G++  
Sbjct: 113 STTAVNLALALAAEGASVGILDADIYGPSLPTMLGIHGQRPESPDNQSMNPLVGHGLQAN 172

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           S+  L++E+  M+WRGPM  SA+  +L    W +LD+L++DMPPGTGD  LT+AQ++P++
Sbjct: 173 SIGFLIEEDNPMVWRGPMATSALEQLLRQTNWRELDYLIVDMPPGTGDIQLTLAQRVPVT 232

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFE 288
           G VIV+TPQD+AL+D K+ + M++K+ IPI+G++ENMS    S+ G +  +FG GGA   
Sbjct: 233 GAVIVTTPQDIALLDAKKGLKMFEKVGIPILGIVENMSIHTCSNCGHEEHIFGAGGAERM 292

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           A+  G+  L S+P D+ +R  +D G P VV + + A +  Y++I+
Sbjct: 293 AKDYGVTVLGSLPLDIAIRERADSGTPTVVADSDGALARRYRDIA 337


>gi|315225283|ref|ZP_07867100.1| mrp/Nbp35 family ATP-binding protein [Capnocytophaga ochracea
           F0287]
 gi|314944966|gb|EFS96998.1| mrp/Nbp35 family ATP-binding protein [Capnocytophaga ochracea
           F0287]
          Length = 373

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 128/348 (36%), Positives = 205/348 (58%), Gaps = 20/348 (5%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITV--------PHTIAHQL 55
           I K  ++++L+ ++ PGE  N+V+   +  I +  + V + + +          T    +
Sbjct: 3   IQKKDVLEALRKITTPGEGKNMVDSGAVQNIVVFGDEVVVDVVINNPSLQAKKRTEVEVM 62

Query: 56  QSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVN 115
           +++     +  + +  VK     +TE K  P       ++  +AVASGKGGVGKST   N
Sbjct: 63  KAIHGEVNEKAKVVVNVKVIAPEVTEIKGKPIP----GIQNIIAVASGKGGVGKSTVTAN 118

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGK----VEISDKKFLKPKENYGIKIMSMA 171
           +A AL   G  V +LDADVYGPSIP +  ++ +    V I DK F++P ENYG+KI+S+ 
Sbjct: 119 LATALAKMGFKVGVLDADVYGPSIPMMFDVATERPRSVTIEDKSFIQPIENYGVKILSIG 178

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
              + N A+IWRGPM   A+  ++    WG+LDFLLID+PPGTGD HL+I Q +P++G V
Sbjct: 179 FFTNANQAVIWRGPMAAKALNQLIFEAYWGELDFLLIDLPPGTGDIHLSIMQALPITGAV 238

Query: 232 IVSTPQDLALIDVKRAISMY--QKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFE 288
           +VSTPQ +AL D +RA++M+  + +N+P++G++ENM+YF   +    KY +FG  GA+  
Sbjct: 239 VVSTPQPVALADARRAVAMFGQENINVPVLGIVENMAYFTPKELPNNKYYIFGKEGAKHL 298

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           A ++ +PFL  +P    VR   D G PI +   +S  ++ +  ++  +
Sbjct: 299 AGELKVPFLGEIPLVQAVREAGDTGQPIALQE-DSPQAKAFHSLAQEV 345


>gi|82523742|emb|CAI78742.1| Mrp protein [uncultured gamma proteobacterium]
          Length = 271

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 113/251 (45%), Positives = 162/251 (64%), Gaps = 2/251 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI--SGKVE 150
            +K  VA+ASGKGGVGKSTT VN+A ALK  G  V +LDAD+YGPS   +L I    + E
Sbjct: 3   QIKHIVAIASGKGGVGKSTTAVNLALALKASGAVVGLLDADIYGPSQQLMLGIPDGQRPE 62

Query: 151 ISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDM 210
             D ++L P E +G+K MSM  L  E   M+WRGPM   A+  ML   +WG+LD+L+IDM
Sbjct: 63  QQDGQYLLPVEAHGLKTMSMGYLASERTPMVWRGPMAGGALAQMLEQTLWGELDYLVIDM 122

Query: 211 PPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLA 270
           PPGTGD  LT++QK  +SG VIV+TPQD+AL+D ++ I M++K+++P++G+IENM+  + 
Sbjct: 123 PPGTGDIQLTLSQKAKVSGAVIVTTPQDIALLDARKGIEMFRKVDVPVLGIIENMAVHVC 182

Query: 271 SDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQ 330
           S  G    +FG  G    A   G+P + S+P  + +R  +D G P V+   +S  + I+ 
Sbjct: 183 SKCGHHEHIFGQQGGERIARDYGVPLIASLPLSLSIREQTDAGRPTVIAEPDSEVTRIFL 242

Query: 331 EISDRIQQFFV 341
           E ++ +QQ   
Sbjct: 243 EAAEAVQQALA 253


>gi|33866573|ref|NP_898132.1| ATPase [Synechococcus sp. WH 8102]
 gi|33633351|emb|CAE08556.1| MRP protein homolog [Synechococcus sp. WH 8102]
          Length = 358

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 118/335 (35%), Positives = 204/335 (60%), Gaps = 16/335 (4%)

Query: 20  GEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTL 79
           G    + E+  + +I +  + V   + +P     Q + +   A+Q + ++  + +  + L
Sbjct: 18  GSGRAVTELSWIDQIRVEGSRVVFRLALPGFAQGQRERIAGEARQALLSLDGIDDVQIEL 77

Query: 80  TE----------NKNPPQQRNNL-NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVA 128
            +              P +R ++  V++ +AV+SGKGGVGKST  VN+ACAL  +G +V 
Sbjct: 78  GQPPSQGGIGQAGHGQPAERQSIPGVRQVIAVSSGKGGVGKSTVAVNLACALAQQGLSVG 137

Query: 129 ILDADVYGPSIPKLLKISGKV-EI---SDKKFLKPKENYGIKIMSMASLVDENVAMIWRG 184
           +LDAD+YGP+ P +L ++ +  E+    D + + P E+ G+ ++SM  L+DE+  +IWRG
Sbjct: 138 LLDADIYGPNAPTMLGVADRTPEVRGSGDTQRMVPIESCGVAMVSMGLLIDEHQPVIWRG 197

Query: 185 PMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDV 244
           PM+   I   L+   WG+ D L++D+PPGTGDA L++AQ +P++GVVIV+TPQ ++L D 
Sbjct: 198 PMLNGIIRQFLYQADWGERDVLVVDLPPGTGDAQLSLAQAVPMAGVVIVTTPQQVSLQDA 257

Query: 245 KRAISMYQKMNIPIIGMIENMSYFLASDT-GKKYDLFGNGGARFEAEKIGIPFLESVPFD 303
           +R ++M++++ IP++G+ ENMS F+  D   ++Y LFG+GG    A    +P L  +P +
Sbjct: 258 RRGLAMFRQLGIPVLGVAENMSAFIPPDRPEQRYALFGSGGGATLAADYDVPLLAQIPME 317

Query: 304 MDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           M V+   D G PIV+   +SA++  +Q +++R+ Q
Sbjct: 318 MPVQEGGDSGRPIVISRPDSASALEFQGLAERVLQ 352


>gi|315452792|ref|YP_004073062.1| putative ATP/GTP-binding protein [Helicobacter felis ATCC 49179]
 gi|315131844|emb|CBY82472.1| putative ATP/GTP-binding protein [Helicobacter felis ATCC 49179]
          Length = 364

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 137/344 (39%), Positives = 200/344 (58%), Gaps = 7/344 (2%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I + +++ +LK +  P  + +IV    +  + +  N + L + +P + +    SL    +
Sbjct: 2   ITQEEVLQALKSVIYPNFERDIVSFGFVKNVTLHENRLGLLLEIPSSSSEVKASLEQAVR 61

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQ---RNNL--NVKKFVAVASGKGGVGKSTTVVNIAC 118
             +Q I      +   T  K  PQQ     NL  N+K  V V+SGKGGVGKSTT VN+A 
Sbjct: 62  AKMQEIGIGALQLDIKTPPKREPQQATSSKNLAPNIKHVVMVSSGKGGVGKSTTSVNLAI 121

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDK--KFLKPKENYGIKIMSMASLVDE 176
           AL  + + V +LDADVYGP+IP++L + G   +SD   K L P E + +K MSM  L +E
Sbjct: 122 ALAQRQQKVGLLDADVYGPNIPRMLGLVGVDPMSDPSGKKLIPLEAFNVKTMSMGLLYEE 181

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
             ++IWRGPM+  AI  ML +++WGQLD L++DMPPGTGDA LT+AQ +P+S  + V+TP
Sbjct: 182 GQSLIWRGPMLMRAIEQMLTDILWGQLDILIVDMPPGTGDAQLTLAQAVPISAGISVTTP 241

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++L D  R++ M+ K++IPI G+IENMS F+        D+FG        E+     
Sbjct: 242 QLVSLDDATRSLDMFAKLHIPIAGVIENMSGFVCPHCEHTSDIFGKDNLNTLLERYQTQL 301

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
           L  +P +M VR   D G PI V N  S  S  YQ+ SD++ +F 
Sbjct: 302 LARIPLEMQVREGGDKGTPISVLNPKSPVSLAYQQASDQLLEFL 345


>gi|251790452|ref|YP_003005173.1| putative ATPase [Dickeya zeae Ech1591]
 gi|247539073|gb|ACT07694.1| putative ATPase [Dickeya zeae Ech1591]
          Length = 369

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 123/344 (35%), Positives = 206/344 (59%), Gaps = 6/344 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           ++L+  +   L   S P  KNN+  +  L    ++ + +++ +T+P      +  L+ + 
Sbjct: 11  EMLRAVVNGVLSSFSHPTLKNNLTTLNALHHCALMDDVLHIELTMPFVWLSGMADLKDSV 70

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIAC 118
            + +  +   +     LT N    ++ NN      VK  +AV+SGKGGVGKS+T VN+A 
Sbjct: 71  SEELLRLSGAREVEWRLTHNIATLRRVNNQAGVKGVKNIIAVSSGKGGVGKSSTAVNMAL 130

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G +V ILDAD+YGPSIP +L  + +   S D + + P   +G+   S+  LV ++
Sbjct: 131 ALAAEGASVGILDADIYGPSIPTMLGAANERPTSPDGQHMAPIMAHGLATNSIGYLVTDD 190

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A++ +L + +W  LD+L++DMPPGTGD  LT+AQ +P++G V+V+TPQ
Sbjct: 191 NAMVWRGPMASKALLQLLQDTLWPDLDYLVLDMPPGTGDIQLTLAQNVPVTGAVVVTTPQ 250

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D  + + M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK     L
Sbjct: 251 DIALVDAMKGLVMFEKVKVPVLGIVENMSVHICSNCGHLEPIFGTGGAQKLAEKYHCALL 310

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI-QQFF 340
             +P  + +R   D G P VV   +S  +++Y+E++ ++  Q F
Sbjct: 311 GQLPLHISLREDLDRGEPTVVSQPDSEFTQLYRELAGQVAAQLF 354


>gi|223039327|ref|ZP_03609616.1| cytochrome c oxidase, heme b and copper-binding subunit,
           membrane-bound [Campylobacter rectus RM3267]
 gi|222879388|gb|EEF14480.1| cytochrome c oxidase, heme b and copper-binding subunit,
           membrane-bound [Campylobacter rectus RM3267]
          Length = 366

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 128/338 (37%), Positives = 208/338 (61%), Gaps = 4/338 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + K ++++ LK +  PG + +IV    +  + I    + + + +  +       LR++ +
Sbjct: 2   LTKEEVLNRLKGVIYPGFEKDIVSFGFVKNVEI-GEKILIEVEIVSSNPDVANELRTDIK 60

Query: 64  QIIQNIPTVKNAVV-TLTENKNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACAL 120
           +++ +   V N +   + E K+  Q   N+   +K FV V+SGKGGVGKSTT +N+A ++
Sbjct: 61  RVMGSNECVINIIQPKIPEEKSNTQSGKNIAPQIKNFVMVSSGKGGVGKSTTTLNLAISM 120

Query: 121 KNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAM 180
              GK V ILDAD+YGP+IP++L   G         LKP   +G+++MSM  L++E +++
Sbjct: 121 AKLGKKVGILDADIYGPNIPRMLGEVGTQPQVIGNKLKPILTHGVEMMSMGVLMEEGMSL 180

Query: 181 IWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLA 240
           IWRG M+  AI  +L +V W +LD L +DMPPGTGDA LT+AQ +P++  V V+TPQ +A
Sbjct: 181 IWRGSMIMKAIEQLLKDVFWSELDVLFLDMPPGTGDAQLTLAQSVPVTAGVCVTTPQVVA 240

Query: 241 LIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESV 300
           L D KRA+ M++K++IPI G++ENMS F+  ++GK+YD+FG G     A+  G   L  +
Sbjct: 241 LDDSKRALDMFEKLHIPIAGIVENMSGFICPESGKEYDIFGKGTTEEVAKAYGTEVLAQI 300

Query: 301 PFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           P +  VRV  D G P+  +  NS T++ Y++ + R+ +
Sbjct: 301 PIEPAVRVGGDSGKPVSFYEPNSVTAKRYEKAAARLWE 338


>gi|260942415|ref|XP_002615506.1| hypothetical protein CLUG_04388 [Clavispora lusitaniae ATCC 42720]
 gi|238850796|gb|EEQ40260.1| hypothetical protein CLUG_04388 [Clavispora lusitaniae ATCC 42720]
          Length = 287

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 115/244 (47%), Positives = 169/244 (69%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NV K V V+S KGGVGKST  +N A  L   GK+  ILDAD++GPS+PKLL +SG+  ++
Sbjct: 39  NVDKVVLVSSAKGGVGKSTVSINTALGLSQLGKSTGILDADIFGPSVPKLLSLSGEPRLT 98

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           +   L P  NYG+  MSM  LV    A++WRG MV  A+  +L  V W  LD+L++DMPP
Sbjct: 99  ETGKLLPLTNYGLPSMSMGYLVPPENAVVWRGLMVMKALQQLLFEVEWPHLDYLVVDMPP 158

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LTIAQ++ + G VIVSTPQD+ALID  + I+M++K++IP++G+++NMS+F+  +
Sbjct: 159 GTGDTQLTIAQQLKVDGAVIVSTPQDIALIDAVKGIAMFEKVHIPLLGLVQNMSHFVCPN 218

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
              +  +FG+ GAR EAEK G+  L SVP +  + + SD G+P+V+ + ++  ++ Y +I
Sbjct: 219 CHHESHIFGSDGARKEAEKHGLDVLGSVPLNEKICLQSDAGVPVVISDRDTDLAKPYMDI 278

Query: 333 SDRI 336
           + RI
Sbjct: 279 AQRI 282


>gi|118475562|ref|YP_891613.1| Mrp protein [Campylobacter fetus subsp. fetus 82-40]
 gi|261886475|ref|ZP_06010514.1| Mrp protein [Campylobacter fetus subsp. venerealis str. Azul-94]
 gi|118414788|gb|ABK83208.1| Mrp protein [Campylobacter fetus subsp. fetus 82-40]
          Length = 358

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 128/336 (38%), Positives = 200/336 (59%), Gaps = 12/336 (3%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIF--IVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
            QI++ LK +  PG K +IVE   + E+   IV   V     +   +   ++SL  + + 
Sbjct: 4   EQILEELKKVIYPGFKKSIVEFGFVKEVDPDIVVEIVSAKPEIATKVKQDIESLNLDRKI 63

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           IIQ           L E K+  +   N+   +K FV V+SGKGGVGKSTT +N+A +L  
Sbjct: 64  IIQ--------TPKLEEEKSNSRSGKNIAPQIKNFVMVSSGKGGVGKSTTTLNLAISLAK 115

Query: 123 KGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIW 182
           +GK V +LDAD+YGP+IP++L    +      + LKP   +GI++MSM  L++    ++W
Sbjct: 116 QGKKVGLLDADIYGPNIPRMLGCQNEQPSVVGQRLKPILTHGIEMMSMGILIEAGQGLMW 175

Query: 183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI 242
           RG M+  AI  +L+ V+W  LD L +DMPPGTGDA +T+AQ +P++  + VSTPQ +AL 
Sbjct: 176 RGAMIMKAITQLLNEVMWSDLDVLFLDMPPGTGDAQITLAQSVPVTAGICVSTPQTVALD 235

Query: 243 DVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPF 302
           D  R++ M++K++IP+ G++ENMS F+  D GK+YD+FG GG    A +     L  +P 
Sbjct: 236 DSARSLDMFEKLHIPVAGIVENMSGFICPDNGKEYDIFGKGGTSELASQYDTEILAQIPI 295

Query: 303 DMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           +  +RV  D G P+  +  NS  ++ Y+E + ++ +
Sbjct: 296 EPSIRVGGDSGKPVSFYEPNSVCAKRYEEAAAKLWE 331


>gi|149692899|ref|XP_001490070.1| PREDICTED: similar to Nucleotide-binding protein-like [Equus
           caballus]
          Length = 330

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 116/253 (45%), Positives = 166/253 (65%), Gaps = 2/253 (0%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACAL--KNKGKNVAILDADVYGPSIPKLL 143
           P+Q+    VK+ + VASGKGGVGKSTT VN+A AL   +  K V +LD DVYGPS+PK++
Sbjct: 58  PKQKPIEGVKQVIVVASGKGGVGKSTTAVNLALALGANDSSKAVGLLDVDVYGPSVPKMM 117

Query: 144 KISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQL 203
            + G  E+S+   ++P  NYG+  MSM  LV+E   ++WRG MV SAI  +L  V WGQL
Sbjct: 118 NLKGNPELSESNLMRPLLNYGVACMSMGFLVEETAPVVWRGLMVMSAIEKLLRQVDWGQL 177

Query: 204 DFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIE 263
           D+L++DMPPGTGD  L+++Q IP+SG VIVSTPQD+AL+D  +   M++K+++P++G+++
Sbjct: 178 DYLVVDMPPGTGDVQLSVSQNIPISGAVIVSTPQDIALMDAHKGAEMFRKVHVPVLGLVQ 237

Query: 264 NMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS 323
           NMS F       K  +FG  GAR  A  + +  L  VP  +++R  SD G PIV     S
Sbjct: 238 NMSVFQCPKCRHKTHIFGADGARRLARTLDLDVLGDVPLHLNIREASDTGQPIVFSQPES 297

Query: 324 ATSEIYQEISDRI 336
             ++ Y  I+  +
Sbjct: 298 DEAKAYLRIAAEV 310


>gi|222823287|ref|YP_002574860.1| ATP/GTP-binding protein [Campylobacter lari RM2100]
 gi|222538508|gb|ACM63609.1| ATP/GTP-binding protein [Campylobacter lari RM2100]
          Length = 367

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 132/343 (38%), Positives = 210/343 (61%), Gaps = 11/343 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           +K +I + LK +  PG K +IV    + +I       ++ + +    A   Q LR N   
Sbjct: 1   MKEKIEERLKQVIYPGFKKDIVSFGFVKKIESNDQKAHVVVEIVSANAQIAQELRLNIAN 60

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKSTTVVNIA 117
            ++++    N  + + + K P ++ N+ +       +K F+ ++SGKGGVGKSTT +N+A
Sbjct: 61  ALKDLNLELN--LEIIQPKIPEEKSNSRSGKNIAPQIKNFLMISSGKGGVGKSTTTLNLA 118

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKIS-GKVEISDKKFLKPKENYGIKIMSMASLVDE 176
            +L   GK V +LDAD+YGP+IP++L  S  K EI  +K ++P  ++G+ +MSM  L++E
Sbjct: 119 ISLAKMGKRVGLLDADIYGPNIPRMLGESKSKPEIVGQK-IRPILSHGVYMMSMGVLIEE 177

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              ++WRG M+  AI  +L +V+W +LD LL+DMPPGTGDA +T+AQ +P+S  V VSTP
Sbjct: 178 GKGLMWRGSMIMKAIEQLLADVLWPELDVLLLDMPPGTGDAQITLAQSVPVSAGVCVSTP 237

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++L D KRA+ M++K++IP+ G+IENMS FL  D GK+YD+FG G     A+      
Sbjct: 238 QVVSLDDSKRALDMFEKLHIPVAGIIENMSGFLCPDNGKEYDIFGKGTTEEMAKAYKCEV 297

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
           L  +P +M VR   D G P+  +   S +S+ Y + +++I +F
Sbjct: 298 LAQIPIEMSVREGGDSGKPVSFYMPESVSSKRYLQAAEKIWEF 340


>gi|183598266|ref|ZP_02959759.1| hypothetical protein PROSTU_01651 [Providencia stuartii ATCC 25827]
 gi|188020436|gb|EDU58476.1| hypothetical protein PROSTU_01651 [Providencia stuartii ATCC 25827]
          Length = 370

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 125/343 (36%), Positives = 199/343 (58%), Gaps = 5/343 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           ++L  ++   L   + P  K N++ ++ L    ++ N +++ + +P       Q+L S  
Sbjct: 12  ELLTEKVSTVLASFTHPTLKRNLISIKALHHCAMLDNVLHVELVMPFVWKGPFQTLISEK 71

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIAC 118
              ++           L  +    ++ N+L     V+  +AV+SGKGGVGKS+T VN+A 
Sbjct: 72  TAELKQATGAHAVEWKLRHDITTLKRANDLPGINGVRNILAVSSGKGGVGKSSTSVNLAL 131

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G  V ILDAD+YGPSIP +L  + +   S D + + P   YG+   S+  LV ++
Sbjct: 132 ALAQEGAKVGILDADIYGPSIPNMLGTTMERPTSPDGQHMAPIMAYGLATNSIGYLVTDD 191

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A+M ML + +W  LD+L+IDMPPGTGD  LT++Q IP++G V+V+TPQ
Sbjct: 192 NAMVWRGPMASKALMQMLQDTLWPDLDYLVIDMPPGTGDIQLTLSQNIPVTGAVVVTTPQ 251

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D  + I M++K+N+P++G++ENMS  + S+ G    +FG GGA   AEK     L
Sbjct: 252 DIALVDAMKGIVMFKKVNVPVLGIVENMSAHICSNCGHVEPIFGTGGAERLAEKYNTQLL 311

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
             +P  + +R   D G P V+ +     ++IY+EI+  I    
Sbjct: 312 GQIPLHISLREDLDRGQPTVMRDPEGEFADIYREIASNISSLM 354


>gi|81241558|gb|ABB62268.1| putative ATPase [Shigella dysenteriae Sd197]
          Length = 379

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 130/343 (37%), Positives = 200/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + NT+++ + +P       + L+   
Sbjct: 21  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDNTLHVELVMPFVWHSAFEELKEQC 80

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 81  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 136

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 137 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 196

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 197 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 256

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 257 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 316

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 317 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 359


>gi|190150326|ref|YP_001968851.1| Mrp-like protein [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|307263667|ref|ZP_07545276.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 13 str. N273]
 gi|189915457|gb|ACE61709.1| Mrp-like protein [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|306870980|gb|EFN02715.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 13 str. N273]
          Length = 365

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 207/345 (60%), Gaps = 10/345 (2%)

Query: 1   MNQILKNQIVD---SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS 57
           MNQ+ + Q+ +    L+  + P  + +++ +    +  +    + L  T+P       ++
Sbjct: 1   MNQLNEQQLSEIKFVLQNFTHPTLQKDLIALNAFKKAELGAGILRLEFTMPFAWNSGFEA 60

Query: 58  LRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLN-----VKKFVAVASGKGGVGKSTT 112
           L+++ +  ++ I T  N V  +   +    +R N +     VK  +AV SGKGGVGKSTT
Sbjct: 61  LKADTEAKLKQI-TGANEVKWILNYQIATLKRANSHPAVNGVKNIIAVTSGKGGVGKSTT 119

Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMA 171
            VN+A ALK +G  V ILDAD+YGPSIP +L    +   S D K + P E YG++  S+ 
Sbjct: 120 SVNLALALKAQGAKVGILDADIYGPSIPHMLGAQDQRPTSPDNKHITPIEVYGLQSNSIG 179

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
            L+ ++ A IWRGPM  SA+  +L+   W +LD+L+IDMPPGTGD  LT++Q+IP++G V
Sbjct: 180 YLMADDNATIWRGPMASSALSQLLNETWWTELDYLVIDMPPGTGDIQLTLSQQIPVTGAV 239

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEK 291
           +V+TPQD+AL+D  + ISM+QK+++P++G+IENMS  +  + G   D+FG GGA   A+K
Sbjct: 240 VVTTPQDIALLDAVKGISMFQKVSVPVLGIIENMSVHICQNCGHHEDIFGTGGAEKVAKK 299

Query: 292 IGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            G   L  +P  + +R   D G P VV      TS+ Y E++ ++
Sbjct: 300 YGTKVLGQMPLHIRLRQDLDAGTPTVVAAPEHETSQAYIELAAKV 344


>gi|240949545|ref|ZP_04753885.1| putative ATPase [Actinobacillus minor NM305]
 gi|240296118|gb|EER46779.1| putative ATPase [Actinobacillus minor NM305]
          Length = 365

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 134/344 (38%), Positives = 203/344 (59%), Gaps = 8/344 (2%)

Query: 1   MNQILK---NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS 57
           MNQ+ +   N+I   L+  S    K +++ +  L +  +    + L +T+P       ++
Sbjct: 1   MNQLTEQQLNEIKFVLQNFSHLTLKKDLIALNALKKAELGAGILRLELTMPFAWNSGFEA 60

Query: 58  LRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTV 113
           L+   ++ ++ I         L  N    ++ NN      VK  +AV SGKGGVGKSTT 
Sbjct: 61  LKVATEEKLKEITGASGVKWVLNYNIATLKRANNHPAVNGVKNIIAVTSGKGGVGKSTTS 120

Query: 114 VNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMAS 172
           VN+A ALK +G  V ILDAD+YGPSIP +L    +   S D K + P E YGI+  S+  
Sbjct: 121 VNLALALKAQGAKVGILDADIYGPSIPHMLGAKDQRPTSPDNKHITPVEVYGIQSNSIGY 180

Query: 173 LVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVI 232
           L+ E+ A IWRGPM  SA+  +L+   W +LD+L+IDMPPGTGD  LT++Q+IP++G V+
Sbjct: 181 LMSEDSATIWRGPMASSALSQLLNETWWNELDYLVIDMPPGTGDIQLTLSQQIPVTGAVV 240

Query: 233 VSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKI 292
           V+TPQD+AL+D  + ISM+QK+++P++G+IENMS  +  + G   D+FG GGA   A+K 
Sbjct: 241 VTTPQDIALLDAIKGISMFQKVSVPVLGVIENMSVHICQNCGHHEDIFGTGGAEKIAKKY 300

Query: 293 GIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
               L  +P  + +R   D G+P V       TS+ Y E++ ++
Sbjct: 301 STQVLGQLPLHIRLREDLDNGMPTVEAAPEHETSQAYLELAAKV 344


>gi|193069315|ref|ZP_03050271.1| mrp protein [Escherichia coli E110019]
 gi|192957448|gb|EDV87895.1| mrp protein [Escherichia coli E110019]
 gi|320178043|gb|EFW53024.1| putative ATPase [Shigella boydii ATCC 9905]
 gi|332343892|gb|AEE57226.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 369

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 130/343 (37%), Positives = 201/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 11  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 70

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 71  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 126

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 127 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 186

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 187 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 246

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 247 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 306

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           I  L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 307 IQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 349


>gi|83719244|ref|YP_441414.1| ParA family protein [Burkholderia thailandensis E264]
 gi|167580183|ref|ZP_02373057.1| ParA family protein [Burkholderia thailandensis TXDOH]
 gi|167618286|ref|ZP_02386917.1| ParA family protein [Burkholderia thailandensis Bt4]
 gi|257139911|ref|ZP_05588173.1| ParA family protein [Burkholderia thailandensis E264]
 gi|83653069|gb|ABC37132.1| ParA family protein [Burkholderia thailandensis E264]
          Length = 362

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 169/241 (70%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NVK  VAVASGKGGVGKSTT VN+A AL  +G +V ILDAD+YGPS+P +L I  + E  
Sbjct: 96  NVKNIVAVASGKGGVGKSTTAVNLALALAAEGASVGILDADIYGPSLPTMLGIHERPESP 155

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K + P   +G++  S+  LV E+  M+WRGPM  SA+  +L    W  LD+L++DMPP
Sbjct: 156 DNKSMNPLVGHGLQANSIGFLVGEDNPMVWRGPMATSALEQLLRQTNWRDLDYLIVDMPP 215

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQ++P++G VIV+TPQD+AL+D K+ + M++K++IPI+G++ENMS  + S+
Sbjct: 216 GTGDIQLTLAQRVPVTGAVIVTTPQDIALLDAKKGLKMFEKVSIPILGIVENMSIHVCSN 275

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG GGA   A++ G+  L S+P D+ +R  +D G+P VV + +   +E Y+ I
Sbjct: 276 CGHEEHVFGAGGAERMAQEYGVAVLGSLPLDIRIREQADSGVPTVVADPSGKLAERYRAI 335

Query: 333 S 333
           +
Sbjct: 336 A 336


>gi|255322929|ref|ZP_05364069.1| cytochrome c oxidase, heme b and copper-binding subunit,
           membrane-bound [Campylobacter showae RM3277]
 gi|255300041|gb|EET79318.1| cytochrome c oxidase, heme b and copper-binding subunit,
           membrane-bound [Campylobacter showae RM3277]
          Length = 366

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 129/337 (38%), Positives = 211/337 (62%), Gaps = 6/337 (1%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           K  +++ LK +  PG + +IV    +  + I    + + + +  +       LR++ +++
Sbjct: 4   KEDVLNRLKGVIYPGFEKDIVSFGFVKNVEI-GEKILIEVEIVSSNPDVANELRTDIKRV 62

Query: 66  IQNIPTVKNAVV-TLTENKNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +   V N +   + E K+  Q   N+   +K FV V+SGKGGVGKSTT +N+A ++  
Sbjct: 63  MGSNECVINIIQPKIPEEKSNSQSGKNIAPQIKNFVMVSSGKGGVGKSTTTLNLAISMAK 122

Query: 123 KGKNVAILDADVYGPSIPKLL-KISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMI 181
            GK V ILDAD+YGP+IP++L ++  + ++   K LKP   +G+++MSM  L++E +++I
Sbjct: 123 LGKKVGILDADIYGPNIPRMLGEVGTQPQVVGNK-LKPILTHGVEMMSMGVLMEEGMSLI 181

Query: 182 WRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLAL 241
           WRG M+  AI  +L +V W +LD L +DMPPGTGDA LT+AQ +P++  V V+TPQ +AL
Sbjct: 182 WRGSMIMKAIEQLLKDVFWSELDVLFLDMPPGTGDAQLTLAQSVPVTAGVCVTTPQVVAL 241

Query: 242 IDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVP 301
            D KRA+ M++K++IPI G+IENMS F+  ++GK+YD+FG G     A+  G   L  +P
Sbjct: 242 DDSKRALDMFEKLHIPIAGVIENMSGFICPESGKEYDIFGKGTTEEVAKAYGTEVLAEIP 301

Query: 302 FDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
            +  VRV  D G P+  +  NS T++ Y++ + R+ +
Sbjct: 302 IEPAVRVGGDSGKPVSFYEPNSVTAKRYEKAAARLWE 338


>gi|85706853|ref|ZP_01037944.1| Putative Mrp (Multidrug resistance-associated proteins) family
           protein [Roseovarius sp. 217]
 gi|85668646|gb|EAQ23516.1| Putative Mrp (Multidrug resistance-associated proteins) family
           protein [Roseovarius sp. 217]
          Length = 351

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 122/325 (37%), Positives = 199/325 (61%), Gaps = 14/325 (4%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPH-TIAHQLQSLRSNAQ 63
           ++ ++   L  L +P +  +++    +  + +    V   I  P   +A  ++ +R+ A+
Sbjct: 4   IRAELEARLDRLELP-DGGSLMSRDMVRALVVEAGEVRFVIEAPTPEMARNMEPVRAAAE 62

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQR-------NNLNVK-----KFVAVASGKGGVGKST 111
           +   ++P V  A V LT    PP  +        N +++       +AVASGKGGVGKST
Sbjct: 63  RAALSLPGVSRATVVLTAQAAPPALKLGQHPKGGNASIRPEGIATLLAVASGKGGVGKST 122

Query: 112 TVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMA 171
              N+A AL  +G+ V +LDAD++GPS P+++ ++G+ +  D   + P E +G+K+MS+ 
Sbjct: 123 VASNLAVALARQGRRVGLLDADIHGPSQPRMMGLTGRPQSPDGTRIIPLEAHGVKVMSIG 182

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
            ++D   A+IWRGPM+  A+  ML  V WG LD L++D+PPGTGD  LT++Q+    G +
Sbjct: 183 LMLDPAKAVIWRGPMLMGALQQMLAQVDWGDLDVLIVDLPPGTGDVQLTLSQRARPDGAI 242

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEK 291
           IVSTPQD+AL+D ++A+ M++ + +PI+GMIENMS+F   D G +  +FG+GG R EAE 
Sbjct: 243 IVSTPQDVALLDARKAMDMFRTLEVPILGMIENMSFFTCPDCGHEAHVFGHGGVRSEAEG 302

Query: 292 IGIPFLESVPFDMDVRVLSDLGIPI 316
           +G+P L ++P D++ R   D G P+
Sbjct: 303 LGLPLLAALPIDLETRSAGDAGCPV 327


>gi|303251067|ref|ZP_07337253.1| putative ATPase [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|307252636|ref|ZP_07534529.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|302650077|gb|EFL80247.1| putative ATPase [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306859881|gb|EFM91901.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
          Length = 365

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 207/345 (60%), Gaps = 10/345 (2%)

Query: 1   MNQILKNQIVD---SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS 57
           MNQ+ + Q+ +    L+  + P  + +++ +    +  +    + L  T+P       ++
Sbjct: 1   MNQLNEQQLSEIKFVLQNFTHPTLQKDLIALNAFKKAELGAGILRLEFTMPFAWNSGFEA 60

Query: 58  LRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLN-----VKKFVAVASGKGGVGKSTT 112
           L+++ +  ++ I T  N V  +   +    +R N +     VK  +AV SGKGGVGKSTT
Sbjct: 61  LKADTEAKLKQI-TGANEVKWILNYQIATLKRANSHPAVNGVKNIIAVTSGKGGVGKSTT 119

Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMA 171
            VN+A ALK +G  V ILDAD+YGPSIP +L    +   S D K + P E YGI+  S+ 
Sbjct: 120 SVNLALALKAQGAKVGILDADIYGPSIPHMLGAQDQRPTSPDNKHITPIEVYGIQSNSIG 179

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
            L+ ++ A IWRGPM  SA+  +L+   W +LD+L+IDMPPGTGD  LT++Q+IP++G V
Sbjct: 180 YLMADDNATIWRGPMASSALSQLLNETWWTELDYLVIDMPPGTGDIQLTLSQQIPVTGAV 239

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEK 291
           +V+TPQD+AL+D  + ISM+QK+++P++G+IENMS  +  + G   D+FG GGA   A+K
Sbjct: 240 VVTTPQDIALLDAIKGISMFQKVSVPVLGVIENMSVHICQNCGHHEDIFGTGGANKVAKK 299

Query: 292 IGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            G   L  +P  + +R   D G P VV      TS+ Y E++ ++
Sbjct: 300 YGTQVLGQMPLHIRLRQDLDAGTPTVVAAPEHETSQAYIELAAKV 344


>gi|293607692|ref|ZP_06690023.1| Mrp ATPase family protein [Achromobacter piechaudii ATCC 43553]
 gi|292813830|gb|EFF72980.1| Mrp ATPase family protein [Achromobacter piechaudii ATCC 43553]
          Length = 362

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 112/244 (45%), Positives = 166/244 (68%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NV+  +AVASGKGGVGKSTT VN+A AL  +G  V +LDAD+YGPS+P +L ISG+ E  
Sbjct: 95  NVRNIIAVASGKGGVGKSTTAVNLALALAAEGAKVGVLDADIYGPSVPTMLGISGRPESL 154

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P   +G++  S+  L+D +   IWRGPMV  A+  +L    W  LD+L++DMPP
Sbjct: 155 DNKSMEPLTGHGLQANSIGFLIDADSPAIWRGPMVTQALEQLLRQTNWRDLDYLIVDMPP 214

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQK+P+ G VIV+TPQD+AL+D ++ + M+QK+ +PI+G++ENM+  + S 
Sbjct: 215 GTGDVALTLAQKVPVVGAVIVTTPQDVALLDARKGLRMFQKVEVPILGVVENMAIHICSQ 274

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    +FG GG +  AE+   P+L S+P  + +R  +D G P VV +  S  + +Y+ I
Sbjct: 275 CGHAEHIFGEGGGQRMAEQYQTPWLGSLPLTLAIREQTDAGTPTVVSDAGSEAAALYRGI 334

Query: 333 SDRI 336
           + ++
Sbjct: 335 ARKL 338


>gi|161950097|ref|YP_403759.2| putative ATPase [Shigella dysenteriae Sd197]
 gi|309787975|ref|ZP_07682584.1| protein mrp [Shigella dysenteriae 1617]
 gi|308924109|gb|EFP69607.1| protein mrp [Shigella dysenteriae 1617]
          Length = 369

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 130/343 (37%), Positives = 200/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + NT+++ + +P       + L+   
Sbjct: 11  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDNTLHVELVMPFVWHSAFEELKEQC 70

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 71  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 126

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 127 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 186

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 187 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 246

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 247 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 306

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 307 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 349


>gi|37525502|ref|NP_928846.1| putative ATPase [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36784930|emb|CAE13848.1| Mrp protein [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 370

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 122/338 (36%), Positives = 202/338 (59%), Gaps = 5/338 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           +LK+Q+   L   +    + ++  ++ L    ++   +++ + +P       ++L++   
Sbjct: 13  LLKSQVTKILATFTHLTLERDLTTLKALHHCTMLDGVLHIELLMPFVWQSGFKALKAATT 72

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIACA 119
           + +Q +   K+    L  + +  ++ N+L     V+  +AV+SGKGGVGKS+T VN+A A
Sbjct: 73  EELQAVTGAKSVAWKLIHDISTLRRANDLPGINGVRNILAVSSGKGGVGKSSTAVNLALA 132

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENV 178
           L  +G  V ILDAD+YGPS+P +L  + +   S D + + P   +G+   S+  LV ++ 
Sbjct: 133 LAQEGAKVGILDADIYGPSVPSMLGTTKERPTSPDGQHMAPIMTHGLATNSIGYLVTDDN 192

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
           AM+WRGPM   A+M ML + +W  LD+L+IDMPPGTGD  LT++Q IP++G ++V+TPQD
Sbjct: 193 AMVWRGPMASKALMQMLQDTLWPDLDYLVIDMPPGTGDIQLTLSQNIPVTGALVVTTPQD 252

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +ALID  + I M+QK+ +P++G+IENMS  +  + G    +FG GGA   A K     L 
Sbjct: 253 IALIDAMKGIVMFQKVKVPVLGIIENMSTHICGNCGHLEPIFGTGGAEKLAAKYHCKLLG 312

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +P  + +R   D G P V+ N +S  ++IY+EI+  I
Sbjct: 313 QIPLHISLREDLDRGEPTVISNPDSEFTDIYREIAANI 350


>gi|120553872|ref|YP_958223.1| hypothetical protein Maqu_0940 [Marinobacter aquaeolei VT8]
 gi|120323721|gb|ABM18036.1| protein of unknown function DUF59 [Marinobacter aquaeolei VT8]
          Length = 388

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 124/305 (40%), Positives = 191/305 (62%), Gaps = 12/305 (3%)

Query: 41  VYLSITVPHT---IAHQLQSLRSNAQQIIQNIPT----VKNAVVTLTENKNPPQQRNNLN 93
           V L + +P+    IA  L+ + +NA + +  + +    V   + +   NK+ P       
Sbjct: 64  VTLMVELPYPSKGIAGGLKQIVANALEFVDGVESAEVHVAQKIHSYKTNKDLPAVPG--- 120

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI--SGKVEI 151
           VK  +AVASGKGGVGKSTT VN+A AL  +G  V ILDAD+YGPSI  +L +    + ++
Sbjct: 121 VKNIIAVASGKGGVGKSTTAVNLALALHAEGARVGILDADIYGPSIGMMLGVPEGKRPDV 180

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            + K+  P   +G++  SMA +  +   M+WRGPMV  A+M +L   +W +LD+L+IDMP
Sbjct: 181 RENKYFVPMLAHGLQANSMAFVTTDKTPMVWRGPMVSGAVMQLLQQTLWDELDYLIIDMP 240

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+A+K+P++G VIV+TPQD+AL+D K+ I M++K++IP++G++ENMS  + S
Sbjct: 241 PGTGDIQLTLARKVPVTGAVIVTTPQDIALLDGKKGIEMFRKVDIPVLGVVENMSVHICS 300

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
           + G +  LFG+GG    AE+     L  +P  M +R  +D G P VV   +S  +  Y++
Sbjct: 301 NCGHEEPLFGHGGGERIAEEYETALLGQLPLHMTIREQTDSGAPTVVAEPDSEVARRYRD 360

Query: 332 ISDRI 336
           I+ R+
Sbjct: 361 IARRV 365


>gi|284007100|emb|CBA72375.1| ATP-binding protein [Arsenophonus nasoniae]
          Length = 370

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 123/337 (36%), Positives = 198/337 (58%), Gaps = 5/337 (1%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L  Q+ + L   S P  ++N+  ++ L    ++ + +++ + +P       + L      
Sbjct: 14  LTQQVAEVLDTFSHPTLQSNLTTLKALYHCALLDDVLHIELVMPFAWKTPFKLLIEQKTS 73

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIACAL 120
            ++ I   +     L  N N  ++ N+L     V+  +A++SGKGGVGKSTT VN+A AL
Sbjct: 74  QLRKIAGAQAVEWKLRHNINTLRRVNDLPGINGVRNIIAISSGKGGVGKSTTTVNLALAL 133

Query: 121 KNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENVA 179
             +G  V ILDAD+YGPSIP +L    +   S D   + P   YG+   S+  LV+++ A
Sbjct: 134 AQEGAKVGILDADIYGPSIPNMLATKNQRPTSPDGHHMVPIMAYGLATNSIGYLVNDDNA 193

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           MIWRGPM   A+M ML +  W +LD+L++DMPPGTGD  LT++Q IP++  ++V+TPQD+
Sbjct: 194 MIWRGPMASKALMQMLQDTQWPELDYLVVDMPPGTGDIQLTLSQNIPVTAAIVVTTPQDI 253

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D  + I+M+ K+ +P++G++ENMS  + S+ G    +FG+GGA   AEK     L  
Sbjct: 254 ALLDAMKGIAMFDKVKVPVLGIVENMSLHICSNCGHIEPIFGSGGAEKLAEKYQCKLLGK 313

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P  + +R   D G P V+ + +   ++IY+EI+  I
Sbjct: 314 IPLHISLREDLDQGQPTVIRDPDGEFADIYREIASTI 350


>gi|149194423|ref|ZP_01871520.1| hypothetical protein CMTB2_07476 [Caminibacter mediatlanticus TB-2]
 gi|149135598|gb|EDM24077.1| hypothetical protein CMTB2_07476 [Caminibacter mediatlanticus TB-2]
          Length = 372

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 132/343 (38%), Positives = 209/343 (60%), Gaps = 11/343 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSIT--VPHTIAHQLQSLRSNA 62
           +K +I++ LK +  PG K ++++   + E+ +  +     IT  +P T     Q L    
Sbjct: 1   MKEKILEKLKEVIYPGFKKSVIDFGFVKEVEVSEDNKKAIITYQIPSTDDVVAQKLNDAT 60

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNN-----LNVKKFVAVASGKGGVGKSTTVVNIA 117
              ++ I     A   +   K P +  +       NVK FV V+SGKGGVGKSTT VN+A
Sbjct: 61  IDKLKEIGI--EATTQIIRPKKPRETSSRGVNKMPNVKSFVMVSSGKGGVGKSTTAVNLA 118

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKV-EISDKKFLKPKENYGIKIMSMASLVDE 176
            +L  +GK V ILD D+YGP++ ++L ++ K  E+   K +KP ENYG+K +SMA+L+ E
Sbjct: 119 LSLAKEGKKVGILDGDIYGPNVARMLGMADKKPEVVGNK-VKPFENYGVKFISMANLLPE 177

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
             A++WRG M+  A+   + +V WG+LD L+IDMPPGTGDA +T+AQ++P++  V V+TP
Sbjct: 178 GKALMWRGAMLVKALQQFMEDVDWGELDILVIDMPPGTGDAQMTMAQQVPVTAGVAVTTP 237

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q +A+ D KR++ M+++++IPI G+IENMS F+  +   KYD+FG+G A   A +     
Sbjct: 238 QTVAVDDAKRSMDMFKQLHIPIAGVIENMSGFICPNCNSKYDIFGSGAAEKLASEYDTKI 297

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
           L  +P +  +R   D G PIVV   NS +++ +Q+ +  + +F
Sbjct: 298 LAKIPIEPAIREGGDKGEPIVVSRPNSESAKEFQKAAKELLKF 340


>gi|300930935|ref|ZP_07146297.1| putative protein mrp [Escherichia coli MS 187-1]
 gi|300461224|gb|EFK24717.1| putative protein mrp [Escherichia coli MS 187-1]
          Length = 379

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 130/343 (37%), Positives = 200/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 21  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 80

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 81  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 136

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 137 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 196

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+LL+DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 197 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLLLDMPPGTGDIQLTLAQNIPVTGAVVV 256

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 257 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 316

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 317 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 359


>gi|298491454|ref|YP_003721631.1| ATPase-like ParA/MinD ['Nostoc azollae' 0708]
 gi|298233372|gb|ADI64508.1| ATPase-like, ParA/MinD ['Nostoc azollae' 0708]
          Length = 356

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 212/337 (62%), Gaps = 10/337 (2%)

Query: 1   MNQILKNQ-IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLR 59
           M Q+L +Q +++ L+ +  P  + ++VE+  +  + I    V  ++ +        + + 
Sbjct: 1   MYQVLDSQSVLEVLRPVEDPELRKSLVELNMIRNVKIDGGKVSFTLVLTTPACPLREFIV 60

Query: 60  SNAQQIIQNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVN 115
            + ++ +  +P V +  V +T    + K+ P +     VK  +AV+SGKGGVGKST  VN
Sbjct: 61  EDCKKAVNKLPGVTDISVDVTAQTPQQKSLPDRTGVDGVKNIIAVSSGKGGVGKSTVAVN 120

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGK---VEISDK-KFLKPKENYGIKIMSMA 171
           +A AL   G  V +LDAD+YGP+ P +L ++     V  +D    L+P  N+G+K++SM 
Sbjct: 121 VAVALAQTGAKVGLLDADIYGPNDPTMLGLADAQITVRCTDTGDILEPAFNHGVKLVSMG 180

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
            L+D +  +IWRGPM+   I   L+ V WG++D+L++DMPPGTGDA LT+ Q +P++G V
Sbjct: 181 FLIDRDQPVIWRGPMLNGVIRQFLYQVQWGEIDYLIVDMPPGTGDAQLTLTQAVPMAGAV 240

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDT-GKKYDLFGNGGARFEAE 290
           IV+TPQ +AL+D ++ + M+Q++N+P++G++ENMSYF+  D    +YD+FG+GG    A 
Sbjct: 241 IVTTPQTVALLDSRKGLRMFQQLNVPVLGIVENMSYFIPPDQPDNQYDIFGSGGGSKTAA 300

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSE 327
           ++G+  L  VP ++  R+  D G+PIVV + +SA+++
Sbjct: 301 ELGVSLLGCVPLEISTRMGGDSGVPIVVGDPDSASAK 337


>gi|152971098|ref|YP_001336207.1| putative ATPase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|150955947|gb|ABR77977.1| putative ATP-binding protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 354

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 128/336 (38%), Positives = 198/336 (58%), Gaps = 11/336 (3%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           +  +L     P  K+N+  ++ L  +  + +TV++ + +P   +   ++L+      +  
Sbjct: 2   VAGTLANFQHPTLKHNLTALKALHHVAWLDDTVHIELQMPFVWSSAFEALKEQCSAELLR 61

Query: 69  IPTVK-------NAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
           I   K       +++ TL   KN P       VK  +A++SGKGGVGKS+T VN+A AL 
Sbjct: 62  ITGAKAIDWKLTHSIATLKRVKNQPGVNG---VKNIIAISSGKGGVGKSSTAVNLALALA 118

Query: 122 NKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENVAM 180
            +G  V ILDAD+YGPSIP +L        S D   + P   YG+   S+  LV ++ AM
Sbjct: 119 AEGAKVGILDADIYGPSIPTMLGAEDSRPTSPDGTHMAPIMKYGLATNSIGYLVTDDNAM 178

Query: 181 IWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLA 240
           +WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+TPQD+A
Sbjct: 179 VWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTTPQDIA 238

Query: 241 LIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESV 300
           LID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK     L  +
Sbjct: 239 LIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAQKLAEKYHTQLLGQL 298

Query: 301 PFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           P  + +R   D G P VV   +S  ++IY++++ R+
Sbjct: 299 PLHITLREDLDNGTPTVVARPDSEFTDIYRQLAGRV 334


>gi|257460153|ref|ZP_05625257.1| cytochrome c oxidase, heme b and copper-binding subunit,
           membrane-bound [Campylobacter gracilis RM3268]
 gi|257442594|gb|EEV17733.1| cytochrome c oxidase, heme b and copper-binding subunit,
           membrane-bound [Campylobacter gracilis RM3268]
          Length = 364

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 123/336 (36%), Positives = 209/336 (62%), Gaps = 5/336 (1%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           K+++++ LK +  PG   +IV+   + E+ I  + +++ I +P         LRS  Q++
Sbjct: 3   KDEVLNLLKSVIYPGFSKSIVDFGFVKEVEI-GDRIFVEIEIPSAKPEIAAELRSAVQKV 61

Query: 66  IQNIPTVKNAVVTLTENKNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKNK 123
           +     +      + E K+  +   N+   +K FV ++SGKGGVGKSTT +N+A +    
Sbjct: 62  LGADVEILIKQPKIAEEKSNSRSGKNIAPQIKHFVMISSGKGGVGKSTTTLNLAISTAKL 121

Query: 124 GKNVAILDADVYGPSIPKLL-KISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIW 182
           GK V ILDAD+YGP++P++L +   +  +  +K LKP  ++G+++MSM  L++E  ++IW
Sbjct: 122 GKRVGILDADIYGPNLPRMLGEDKTQASVVGQK-LKPILSHGVEMMSMGVLMEEGASLIW 180

Query: 183 RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI 242
           RG M+  AI  +L +V W  LD L +DMPPGTGDA LT+AQ +P++  V V+TPQ +AL 
Sbjct: 181 RGSMIMKAIEQLLKDVAWSDLDVLFLDMPPGTGDAQLTLAQSVPVTAGVCVTTPQTVALD 240

Query: 243 DVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPF 302
           D  R + M++K++IPI G+IENMS F+  D GK+YD+FG GGA+  A++     +  +P 
Sbjct: 241 DSARGLDMFEKLHIPIAGLIENMSGFICPDNGKEYDIFGRGGAQKLAQRYNTEVIGEIPI 300

Query: 303 DMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           ++ +R   D G P+  +  +S +++ Y++ + ++ +
Sbjct: 301 EIAIREGGDSGKPVSFYAPDSLSAKRYEDAARKLWE 336


>gi|300114644|ref|YP_003761219.1| ATPase-like protein [Nitrosococcus watsonii C-113]
 gi|299540581|gb|ADJ28898.1| ATPase-like, ParA/MinD [Nitrosococcus watsonii C-113]
          Length = 365

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 127/337 (37%), Positives = 203/337 (60%), Gaps = 4/337 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + + QI ++LK    P  + ++V  + +  I +  N V L I +       + +L +  Q
Sbjct: 6   VTQTQIEEALKSYHDPYLEQDLVSAEAVDSIVLDGNKVNLKIKLGFPAKGYIPALVAAIQ 65

Query: 64  QIIQNIPTVKNAVV----TLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACA 119
           +   ++  V +  V     +  +K     +    +K  +AVASGKGGVGKSTT VN+A A
Sbjct: 66  KATASLEGVTHTEVKVGWEVVTHKVQQGVKPYPEIKNIIAVASGKGGVGKSTTAVNLALA 125

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
           L  +G  V +LDAD+YGPS P++L +  + E  D K ++P  +YGI+ MS+  L+DE   
Sbjct: 126 LAAEGAKVGMLDADIYGPSQPRMLGVQQRPESRDGKSIEPVMSYGIQTMSIGFLIDEEEP 185

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           MIWRGPMV SA+  +L +  W  LD+L++D+PPGTGD  LT+AQ++P+SG VIV+TPQD+
Sbjct: 186 MIWRGPMVTSALQQLLGDTSWRNLDYLVVDLPPGTGDIQLTLAQRVPVSGAVIVTTPQDI 245

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D ++ + M++K+ +P++G++ENMS  + S  G++  +FG GG    A + G+  L  
Sbjct: 246 ALLDARKGLRMFEKVKVPVLGIVENMSIHICSQCGQEEPIFGEGGGERMAVQYGVTLLGQ 305

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P D  +R  +D G P V  +     + IY++I+  I
Sbjct: 306 LPLDKRIREDADSGHPSVATDPEGRIAHIYRDIARHI 342


>gi|254458286|ref|ZP_05071712.1| ATP/GTP-binding protein [Campylobacterales bacterium GD 1]
 gi|207085122|gb|EDZ62408.1| ATP/GTP-binding protein [Campylobacterales bacterium GD 1]
          Length = 368

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 131/339 (38%), Positives = 210/339 (61%), Gaps = 9/339 (2%)

Query: 5   LKNQIVDS-LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           + N+IV+S L  +  PG   +IV    ++ I +  N V  ++ +  +     Q +  +A 
Sbjct: 1   MTNEIVNSALSKVMYPGFTKDIVTFGFVNSIEVNGNDVSFNVEITSSAPEVAQQIIDDAT 60

Query: 64  QIIQNIPTVKNAVVTLTENKNP----PQQRN-NLNVKKFVAVASGKGGVGKSTTVVNIAC 118
             ++ +    N    +   K P    P+ +N    VK F+ V+SGKGGVGKSTT VNIA 
Sbjct: 61  AELKAV-GASNVKCNINAPKMPEAPKPKSKNIAPQVKNFLMVSSGKGGVGKSTTSVNIAI 119

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +GK V +LDAD+YGP+IP+++ +S  K E++  K L P + YGI++MSM SL++E 
Sbjct: 120 ALAAQGKKVGLLDADIYGPNIPRMMGVSDVKPEVNGNKVL-PIKAYGIEMMSMGSLMEEG 178

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            +++WRG M+  AI   L +++W +LD L+IDMPPGTGDA LT+AQ +P++  ++V+TPQ
Sbjct: 179 QSLMWRGAMIMKAIEQFLRDILWSELDVLVIDMPPGTGDAQLTLAQSVPVTAGLVVTTPQ 238

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
            +++ D +R++ M++K+NIPI G++ENMS F+A DTG +YD+FG G +   A++     +
Sbjct: 239 AVSIDDSRRSLDMFRKLNIPIAGIVENMSGFIAPDTGVEYDIFGKGTSGPMAKEFDTKII 298

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P +  +R   D G PI   N  S +++ Y   ++ I
Sbjct: 299 AEIPIEPSIRTGGDEGKPITFVNPTSESAKRYMAAAESI 337


>gi|225706562|gb|ACO09127.1| Nucleotide-binding protein-like [Osmerus mordax]
          Length = 348

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 169/255 (66%), Gaps = 2/255 (0%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK--NKGKNVAILDADVYGPSIPKLL 143
           P+Q+    VK+ + VASGKGGVGKSTT VN+A  L   +  K V +LDADVYGPS+PKL+
Sbjct: 87  PKQKPIPGVKQVIVVASGKGGVGKSTTAVNLALGLTANDPSKTVGLLDADVYGPSVPKLM 146

Query: 144 KISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQL 203
            + G  E++    + P  N+GI  MSM  LV++   ++WRG MV SAI  +L  V WG L
Sbjct: 147 NLRGNPELTQNNLMIPLVNFGIPCMSMGFLVEDVAPIVWRGLMVMSAIEKLLRQVDWGLL 206

Query: 204 DFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIE 263
           D+L+IDMPPGTGD  L+I Q IP++G VIVSTPQD+AL+D +R   M++K+++P++G+++
Sbjct: 207 DYLVIDMPPGTGDVQLSITQNIPIAGAVIVSTPQDIALLDARRGAEMFKKVHVPVLGLVQ 266

Query: 264 NMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS 323
           NMS F          +FG  GAR  A  +G+  L  +P  +++R  SD G P+V+ + +S
Sbjct: 267 NMSVFQCPKCNHPTHIFGMDGARELANTLGVQVLGDIPLHLNIRETSDRGQPVVISSPDS 326

Query: 324 ATSEIYQEISDRIQQ 338
             +E Y++++  + Q
Sbjct: 327 PEAEAYKKVASAVVQ 341


>gi|171059436|ref|YP_001791785.1| hypothetical protein Lcho_2755 [Leptothrix cholodnii SP-6]
 gi|170776881|gb|ACB35020.1| protein of unknown function DUF59 [Leptothrix cholodnii SP-6]
          Length = 364

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 121/326 (37%), Positives = 201/326 (61%), Gaps = 11/326 (3%)

Query: 19  PGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNI----PTVKN 74
           P    + +  +++  + +    V   + + +    QL  LR   +Q+I+ +    P V N
Sbjct: 18  PNTGRDFISGKQVRNLSVDGADVAFDVELGYPARSQLAGLR---KQLIEAVRAALPGVGN 74

Query: 75  AVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAIL 130
             V L+        +  +     VK  VAVASGKGGVGKSTT VN+A AL  +G  V +L
Sbjct: 75  VSVNLSSRITAHAVQRGVQLLPGVKNIVAVASGKGGVGKSTTAVNLALALAAEGAKVGVL 134

Query: 131 DADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSA 190
           DAD+YGPS P +L ++G+ E +D K ++P   +GI++MS+  LVD + AMIWRGPM   A
Sbjct: 135 DADIYGPSQPMMLGVTGRPESADGKTMEPMVGHGIEVMSIGFLVDPDQAMIWRGPMATQA 194

Query: 191 IMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISM 250
           +  +L    W  LD+L++DMPPGTGD  LT++QK+P++G +IV+TPQD+AL+D ++ ++M
Sbjct: 195 LEQLLRQTNWHDLDYLIVDMPPGTGDIQLTLSQKVPVTGALIVTTPQDIALLDARKGLTM 254

Query: 251 YQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLS 310
           ++K+++PI+G++ENM+ ++  + G    +FG  G R  A++ GI +L ++P +  +R  +
Sbjct: 255 FEKVSVPILGIVENMAVYVCENCGHAEHIFGADGGRKLAQEQGIAYLGALPLNRSIREQA 314

Query: 311 DLGIPIVVHNMNSATSEIYQEISDRI 336
           D G P VV   +   + +Y+ ++ ++
Sbjct: 315 DTGCPSVVAEPDGEIAGLYKALARQV 340


>gi|23005594|ref|ZP_00048327.1| COG0489: ATPases involved in chromosome partitioning
           [Magnetospirillum magnetotacticum MS-1]
          Length = 357

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 129/327 (39%), Positives = 195/327 (59%), Gaps = 13/327 (3%)

Query: 19  PGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVK----- 73
           P  K+N+  ++ L  +  +  TV++ I +P       ++L+      +  I   K     
Sbjct: 8   PTLKHNLTTLKALHHVAWLDETVHIEIQMPFVWNSAFEALKEQCSAELLRITGAKAIDWK 67

Query: 74  --NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAIL 130
             +++ TL   KN P     +N VK  +A++SGKGGVGKS+T VN+A AL  +G  V IL
Sbjct: 68  LTHSIATLQRVKNQP----GINGVKNIIAISSGKGGVGKSSTAVNLALALAAEGAKVGIL 123

Query: 131 DADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQS 189
           DAD+YGPSIP +L    +   S D   + P   +G+   S+  LV ++ AM+WRGPM   
Sbjct: 124 DADIYGPSIPTMLGAEDQRPTSPDGTHMAPIMKFGLATNSIGYLVTDDNAMVWRGPMASK 183

Query: 190 AIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAIS 249
           A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+TPQD+ALID K+ I 
Sbjct: 184 ALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTTPQDIALIDAKKGIV 243

Query: 250 MYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVL 309
           M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK     L  +P  + +R  
Sbjct: 244 MFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAQKLAEKYHTQLLGQLPLHITLRED 303

Query: 310 SDLGIPIVVHNMNSATSEIYQEISDRI 336
            D G P VV    S  +E Y++++DR+
Sbjct: 304 LDKGTPTVVARPESEFTETYRQLADRV 330


>gi|171320879|ref|ZP_02909878.1| Cobyrinic acid ac-diamide synthase [Burkholderia ambifaria MEX-5]
 gi|171093864|gb|EDT38996.1| Cobyrinic acid ac-diamide synthase [Burkholderia ambifaria MEX-5]
          Length = 363

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 122/285 (42%), Positives = 188/285 (65%), Gaps = 5/285 (1%)

Query: 54  QLQSLRSNAQQIIQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGK 109
           Q   +R+     ++ +P V++A V +++    +  Q+   L  NVK  VAVASGKGGVGK
Sbjct: 53  QHDDVRARIAAALKAVPGVRDARVAVSQEIVAHTVQRGVKLLPNVKNIVAVASGKGGVGK 112

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIM 168
           STT VN+A AL  +G +V ILDAD+YGPS+P +L I G + E  D + + P   +G++  
Sbjct: 113 STTAVNLALALAAEGASVGILDADIYGPSLPTMLGIHGQRPESPDNQSMNPLVGHGLQAN 172

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           S+  L++E+  M+WRGPM  SA+  +L    W +LD+L++DMPPGTGD  LT+AQ++P++
Sbjct: 173 SIGFLIEEDNPMVWRGPMATSALEQLLRQTNWRELDYLIVDMPPGTGDIQLTLAQRVPVT 232

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFE 288
           G VIV+TPQD+AL+D K+ + M++K+ IPI+G++ENMS  + S+ G +  +FG GGA   
Sbjct: 233 GAVIVTTPQDIALLDAKKGLKMFEKVGIPILGIVENMSIHICSNCGHEEHIFGAGGAERM 292

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           A+  G+  L S+P D+ +R  +D G P V    + A +  Y++I+
Sbjct: 293 AQDYGVNVLGSLPLDIAIRERADSGTPTVAAEPDGALARRYRDIA 337


>gi|301644127|ref|ZP_07244137.1| putative protein mrp [Escherichia coli MS 146-1]
 gi|301077527|gb|EFK92333.1| putative protein mrp [Escherichia coli MS 146-1]
          Length = 379

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 130/343 (37%), Positives = 201/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 21  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 80

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I  VK       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 81  SAELLRITGVKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 136

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 137 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 196

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 197 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 256

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 257 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 316

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 317 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 359


>gi|319764069|ref|YP_004128006.1| atpase-like, para/mind [Alicycliphilus denitrificans BC]
 gi|317118630|gb|ADV01119.1| ATPase-like, ParA/MinD [Alicycliphilus denitrificans BC]
          Length = 363

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 112/241 (46%), Positives = 171/241 (70%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            V+  +AVASGKGGVGKSTT  N+A AL  +G  V +LDAD+YGPS P +L I+ + E  
Sbjct: 96  QVRNIIAVASGKGGVGKSTTAANLALALAAEGARVGVLDADIYGPSQPMMLGINRRPESL 155

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P ENYG+++MS+  LVD++ AMIWRGPM   A+  +L    W  LD+LL+DMPP
Sbjct: 156 DGKNMEPLENYGVQVMSIGFLVDQDEAMIWRGPMATQALEQLLRQTNWKDLDYLLVDMPP 215

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++Q++P++G VIV+TPQD+AL+D ++ I M++K+ +PI+G++ENM+  + S+
Sbjct: 216 GTGDIQLTLSQRVPMTGAVIVTTPQDIALLDARKGIKMFEKVGVPILGIVENMAVHVCSN 275

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    +FG  G R  A++ G+ +L ++P DM +R+ +D G P VV + +   + IY+++
Sbjct: 276 CGHVEHIFGADGGRKMAQEYGMDYLGALPLDMQIRLQADSGKPTVVADPDGEVALIYKKV 335

Query: 333 S 333
           +
Sbjct: 336 A 336


>gi|206579578|ref|YP_002237460.1| mrp protein [Klebsiella pneumoniae 342]
 gi|288934384|ref|YP_003438443.1| ATPase-like, ParA/MinD [Klebsiella variicola At-22]
 gi|290508588|ref|ZP_06547959.1| ATP-binding protein [Klebsiella sp. 1_1_55]
 gi|206568636|gb|ACI10412.1| mrp protein [Klebsiella pneumoniae 342]
 gi|288889113|gb|ADC57431.1| ATPase-like, ParA/MinD [Klebsiella variicola At-22]
 gi|289777982|gb|EFD85979.1| ATP-binding protein [Klebsiella sp. 1_1_55]
          Length = 369

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 129/340 (37%), Positives = 199/340 (58%), Gaps = 11/340 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+  +  +L     P  K+N+  ++ L  +  + +TV++ + +P   +   + L+     
Sbjct: 13  LRAMVAGTLANFQHPTLKHNLTALKALHHVAWLDDTVHIELQMPFVWSSAFEVLKEQCSA 72

Query: 65  IIQNIPTVK-------NAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIA 117
            +  I   K       +++ TL   KN P       VK  +A++SGKGGVGKS+T VN+A
Sbjct: 73  ELLRITGAKAIDWKLTHSIATLKRVKNQPGVNG---VKNIIAISSGKGGVGKSSTAVNLA 129

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDE 176
            AL  +G  V ILDAD+YGPSIP +L        S D   + P   YG+   S+  LV +
Sbjct: 130 LALAAEGAKVGILDADIYGPSIPTMLGAEDSRPTSPDGTHMAPIIKYGLATNSIGYLVTD 189

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           + AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+TP
Sbjct: 190 DNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTTP 249

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK     
Sbjct: 250 QDIALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAQKLAEKYHTQL 309

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L  +P  + +R   D G P VV   +S  ++IY++++ R+
Sbjct: 310 LGQLPLHITLREDLDNGTPTVVARPDSEFTDIYRQLAGRV 349


>gi|298206742|ref|YP_003714921.1| hypothetical protein CA2559_00760 [Croceibacter atlanticus
           HTCC2559]
 gi|83849373|gb|EAP87241.1| hypothetical protein CA2559_00760 [Croceibacter atlanticus
           HTCC2559]
          Length = 376

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 125/331 (37%), Positives = 197/331 (59%), Gaps = 14/331 (4%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           +I K  ++ +L+ +S+ GE  N+VE   ++ +    + V + +T+     H  +   S+ 
Sbjct: 2   KIDKASVLKTLETISVSGEGKNMVESGAVTNVVTFADEVIVDLTLTTPALHIKKRAESDI 61

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL------NVKKFVAVASGKGGVGKSTTVVNI 116
              I +    +NA V +      PQ+ N +       +K  +AVASGKGGVGKST   N+
Sbjct: 62  ISAIHS-GLDENAKVKVNIKIEAPQKTNEIKGKAIPGIKNIIAVASGKGGVGKSTVTSNL 120

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGK----VEISDKKFLKPKENYGIKIMSMAS 172
           A +L   G  V +LDAD+YGPS P +  +  +    V +  K  +KP ENYG+KI+S+  
Sbjct: 121 AVSLSKMGFKVGLLDADIYGPSAPIMFDVEAERPLSVTVDGKSKMKPVENYGVKILSIGF 180

Query: 173 LVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVI 232
               N A++WRGPM   A+  M+ +  WG+LDFLLID+PPGTGD HL+I Q +P++G V+
Sbjct: 181 FTKPNQAVVWRGPMAAKALNQMIFDAAWGELDFLLIDLPPGTGDIHLSIMQSLPITGAVV 240

Query: 233 VSTPQDLALIDVKRAISMYQK--MNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEA 289
           VSTPQ++AL D K+ ++M+Q+  +N+P++G++ENM+YF   +    KY +FG  GA+  A
Sbjct: 241 VSTPQNVALADAKKGVAMFQQESINVPVLGILENMAYFTPEELPDNKYYIFGKDGAKNLA 300

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHN 320
           + +G+PFL  +P    +R   D+G P  +  
Sbjct: 301 DDLGVPFLGQLPLVQSIRESGDIGRPAALQT 331


>gi|238753409|ref|ZP_04614772.1| hypothetical protein yruck0001_19360 [Yersinia ruckeri ATCC 29473]
 gi|238708362|gb|EEQ00717.1| hypothetical protein yruck0001_19360 [Yersinia ruckeri ATCC 29473]
          Length = 370

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 123/338 (36%), Positives = 203/338 (60%), Gaps = 5/338 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           +L++Q+   L   + P  + ++  ++ +    ++ N +++ + +P    +  + L+    
Sbjct: 13  LLQSQVSKVLAAFTHPTLQKDLTALRAVHHCALLDNVLHIELIMPFAWQYGFECLKEAVT 72

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIACA 119
             +Q +   K     L+ N    ++ N+      V+  VAV+SGKGGVGKS+T VN+A A
Sbjct: 73  VELQQLTGAKAIDWKLSHNITTLRRANDQPGVKGVRNIVAVSSGKGGVGKSSTAVNLALA 132

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENV 178
           L ++G  V ILDAD+YGPSIP +L  + +   S D K + P   +G+   S+  LV ++ 
Sbjct: 133 LISEGAKVGILDADIYGPSIPSMLGTTHERPTSPDGKHMAPILAHGLATNSIGYLVTDDN 192

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
           AM+WRGPM   A+M ML + +W  LD+L+IDMPPGTGD  LT++Q IP++G ++V+TPQD
Sbjct: 193 AMVWRGPMASKALMQMLQDTLWPDLDYLVIDMPPGTGDIQLTLSQNIPVTGALVVTTPQD 252

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +ALID  + I M++K+++P++G+IENMS  + S+ G    +FG GGA   AEK     L 
Sbjct: 253 IALIDAMKGIVMFEKVHVPVLGIIENMSMHICSNCGHLEPIFGTGGAEKLAEKYHCKLLG 312

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +P  + +R   D G P VV   +S  ++IY++++  +
Sbjct: 313 QIPLHICLREDLDRGEPTVVSRPDSEFADIYRQLASTV 350


>gi|330823656|ref|YP_004386959.1| ATPase-like, ParA/MinD [Alicycliphilus denitrificans K601]
 gi|329309028|gb|AEB83443.1| ATPase-like, ParA/MinD [Alicycliphilus denitrificans K601]
          Length = 363

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 112/241 (46%), Positives = 171/241 (70%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            V+  +AVASGKGGVGKSTT  N+A AL  +G  V +LDAD+YGPS P +L I+ + E  
Sbjct: 96  QVRNIIAVASGKGGVGKSTTAANLALALAAEGARVGVLDADIYGPSQPMMLGINRRPESL 155

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P ENYG+++MS+  LVD++ AMIWRGPM   A+  +L    W  LD+LL+DMPP
Sbjct: 156 DGKNMEPLENYGVQVMSIGFLVDQDEAMIWRGPMATQALEQLLRQTNWKDLDYLLVDMPP 215

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++Q++P++G VIV+TPQD+AL+D ++ I M++K+ +PI+G++ENM+  + S+
Sbjct: 216 GTGDIQLTLSQRVPMTGAVIVTTPQDIALLDARKGIKMFEKVGVPILGIVENMAVHVCSN 275

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    +FG  G R  A++ G+ +L ++P DM +R+ +D G P VV + +   + IY+++
Sbjct: 276 CGHVEHIFGADGGRKMAQEYGMDYLGALPLDMQIRLQADSGKPTVVADPDGEVALIYKKV 335

Query: 333 S 333
           +
Sbjct: 336 A 336


>gi|70732168|ref|YP_261924.1| ParA family protein [Pseudomonas fluorescens Pf-5]
 gi|68346467|gb|AAY94073.1| ParA family protein [Pseudomonas fluorescens Pf-5]
          Length = 364

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 117/246 (47%), Positives = 169/246 (68%), Gaps = 2/246 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKIS--GKVE 150
           NVK  VAVASGKGGVGKSTT  N+A AL  +G  V ILDAD+YGPS   +  I+   + +
Sbjct: 97  NVKNVVAVASGKGGVGKSTTAANLALALAREGAKVGILDADIYGPSQGIMFGIAEGTRPK 156

Query: 151 ISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDM 210
           I D+K+  P E++G+++MSMA L D+N  M+WRGPMV  A++ ++    WG LD+L+IDM
Sbjct: 157 IKDQKWFVPIESHGVEVMSMAFLTDDNTPMVWRGPMVSGALLQLVTQTDWGNLDYLVIDM 216

Query: 211 PPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLA 270
           PPGTGD  LT+AQK+P++G VIV+TPQDLAL+D ++ + M++K+NIP++G++ENM+  + 
Sbjct: 217 PPGTGDIQLTLAQKVPVAGAVIVTTPQDLALLDARKGVEMFRKVNIPVLGVVENMAVHIC 276

Query: 271 SDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQ 330
           S+ G    LFG GG    A +  +  L S+P  M +R  +D G P V+    S  + +YQ
Sbjct: 277 SNCGHAEHLFGEGGGEKLASQYDVELLASLPLSMLIREQADGGKPTVIAEPESQIAMVYQ 336

Query: 331 EISDRI 336
           E++  +
Sbjct: 337 ELARHV 342


>gi|104780429|ref|YP_606927.1| Mrp family ATPase [Pseudomonas entomophila L48]
 gi|95109416|emb|CAK14116.1| putative ATPase, Mrp family [Pseudomonas entomophila L48]
          Length = 364

 Score =  242 bits (617), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 181/280 (64%), Gaps = 6/280 (2%)

Query: 63  QQIIQNIPTVKNAVVTL----TENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
           Q  I+N+  V +A VT+      +K   Q     NVK  +AVASGKGGVGKSTT  N+A 
Sbjct: 63  QTAIENLDGVASARVTIDCVIATHKAQAQVPALANVKNVIAVASGKGGVGKSTTAANLAL 122

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           AL  +G  V ILDAD+YGPS   +  I    + ++ ++K+  P + +G+++MSMA L D+
Sbjct: 123 ALAREGARVGILDADIYGPSQGVMFGIPEGTRPQVREQKWFVPIKAHGVEVMSMAFLTDD 182

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           N  M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TP
Sbjct: 183 NTPMVWRGPMVSGALLQLVTQTAWDDLDYLVIDMPPGTGDIQLTLAQKVPVAGSVIVTTP 242

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QDLAL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A + G+  
Sbjct: 243 QDLALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLAAQYGVEL 302

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L S+P  M +R  +D G P  +    S  + +YQE++ ++
Sbjct: 303 LASLPLSMLIREQADSGKPTAIAEPESQIAMVYQELARQV 342


>gi|307250248|ref|ZP_07532202.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306857689|gb|EFM89791.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 4 str. M62]
          Length = 365

 Score =  241 bits (616), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 207/345 (60%), Gaps = 10/345 (2%)

Query: 1   MNQILKNQIVD---SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS 57
           MNQ+ + Q+ +    L+  + P  + +++ +    +  +    + L  T+P       ++
Sbjct: 1   MNQLNEQQLSEIKFVLQNFTHPTLQKDLIALNAFKKAELGAGILRLEFTMPFAWNSGFEA 60

Query: 58  LRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLN-----VKKFVAVASGKGGVGKSTT 112
           L+++ +  ++ I T  N V  +   +    +R N +     VK  +AV SGKGGVGKSTT
Sbjct: 61  LKADTEAKLKQI-TGANEVKWILNYQIATLKRANSHPAVNGVKNIIAVTSGKGGVGKSTT 119

Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMA 171
            VN+A ALK +G  V ILDAD+YGPSIP +L    +   S D K + P E YG++  S+ 
Sbjct: 120 SVNLALALKAQGAKVGILDADIYGPSIPHMLGAQDQRPTSPDNKHITPIEVYGLQSNSIG 179

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
            L+ ++ A IWRGPM  SA+  +L+   W +LD+L+IDMPPGTGD  LT++Q+IP++G V
Sbjct: 180 YLMADDNATIWRGPMASSALSQLLNETWWTELDYLVIDMPPGTGDIQLTLSQQIPVTGAV 239

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEK 291
           +V+TPQD+AL+D  + ISM+QK+++P++G+IENMS  +  + G   D+FG GGA   A+K
Sbjct: 240 VVTTPQDIALLDAIKGISMFQKVSVPVLGVIENMSVHICQNCGHHEDIFGTGGANKVAKK 299

Query: 292 IGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            G   L  +P  + +R   D G P VV      TS+ Y E++ ++
Sbjct: 300 YGTQVLGQMPLHIRLRQDLDAGTPTVVAAPEHETSQAYIELAAKV 344


>gi|331006632|ref|ZP_08329916.1| ATP-binding protein, Mrp/Nbp35 family [gamma proteobacterium
           IMCC1989]
 gi|330419547|gb|EGG93929.1| ATP-binding protein, Mrp/Nbp35 family [gamma proteobacterium
           IMCC1989]
          Length = 370

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 133/327 (40%), Positives = 194/327 (59%), Gaps = 10/327 (3%)

Query: 19  PGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVT 78
           P  + +++ +  +S+I   HN + LS+T+ +      Q +       +  I T+    V 
Sbjct: 22  PLSQRSLLSLDAVSDIQFAHNKISLSVTLGYPSESIQQEISEKLWVALNTIDTIDGESVD 81

Query: 79  ---------LTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAI 129
                      +N N  +Q    +V+  +AVASGKGGVGKSTT VN+A AL   G  V I
Sbjct: 82  KVSIDIGWQAPKNVNIEEQPLLNDVRNIIAVASGKGGVGKSTTSVNLALALAKLGAKVGI 141

Query: 130 LDADVYGPSIPKLLKISGKV-EISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQ 188
           LDAD+YGPS   LL I  K  E+ ++K++ P E YG+K MSMA LV E   M+WRGPM  
Sbjct: 142 LDADIYGPSQAMLLGIGTKRPEVREQKYMLPNEAYGVKSMSMAYLVTEQTPMVWRGPMAT 201

Query: 189 SAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAI 248
            A+  +L    W  LD+L +DMPPGTGD  LT++QK+P+SG V+V+TPQD+AL+D K+AI
Sbjct: 202 GALQQLLFQTDWQDLDYLFVDMPPGTGDIQLTLSQKVPVSGAVVVTTPQDIALLDAKKAI 261

Query: 249 SMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRV 308
            M+ K+N+PI+G++ENM+    S  G    +FG GG    A+  G   L ++P  + +R 
Sbjct: 262 EMFNKVNVPIMGVVENMAVHQCSQCGHSEHIFGEGGGERIAKDYGTQLLGALPLALSIRE 321

Query: 309 LSDLGIPIVVHNMNSATSEIYQEISDR 335
            +D G P VV + +SA S+ Y +I+ +
Sbjct: 322 DADSGKPSVVADPDSAISQQYIDIAQK 348


>gi|161367575|ref|NP_288619.2| putative ATPase [Escherichia coli O157:H7 str. EDL933]
          Length = 369

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 129/343 (37%), Positives = 200/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 11  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 70

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 71  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 126

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 127 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 186

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 187 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 246

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 247 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 306

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 307 TQLLGQMPLHISLREDXDKGTPTVISRPESEFTAIYRQLADRV 349


>gi|34496659|ref|NP_900874.1| Mrp protein [Chromobacterium violaceum ATCC 12472]
 gi|34330305|gb|AAQ58879.2| Mrp protein [Chromobacterium violaceum ATCC 12472]
          Length = 362

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 128/340 (37%), Positives = 206/340 (60%), Gaps = 12/340 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+NQI+++LK L       + V  + +  +      + L + + +    Q  ++R   + 
Sbjct: 4   LENQILETLKPLIDANTGKSYVAAKNVKNLKCGDAEISLDVVLAYPAKSQFDAVRQQFEA 63

Query: 65  IIQNIP-------TVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIA 117
            +  +         V   +V+ +  +  P       VK  +AVASGKGGVGKSTT  N+A
Sbjct: 64  ALAPLAEGRAIKIAVSAQIVSHSAQRGVPLLPG---VKNVIAVASGKGGVGKSTTAANLA 120

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMASLVDE 176
            AL ++G  V +LDAD+YGPS P ++ + G + E +D K L P  N+GI+ MS+  LVD 
Sbjct: 121 LALADEGARVGLLDADIYGPSQPLMMGLQGQRPETADGK-LTPLSNHGIQTMSIGYLVDA 179

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           + AM+WRGPMV  A+  +L++  W  LD+L+IDMPPGTGD  LT++QK+P++G +IV+TP
Sbjct: 180 DQAMVWRGPMVSQALQQLLNDTRWDDLDYLVIDMPPGTGDVQLTLSQKVPVTGALIVTTP 239

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QD+AL+D ++ ++M+QK+ +PI+G++ENM+  + S+ G    +FG GGA   A+  G+  
Sbjct: 240 QDIALLDARKGVTMFQKVGVPILGLVENMAIHVCSNCGHAEHIFGEGGAVKMAQDFGVEL 299

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L S+P D+ +R   D G P V  + +   +E+Y+ I+ R+
Sbjct: 300 LGSLPLDLAIRQAVDEGRPSVAADPSGKPAELYRAIARRV 339


>gi|189345963|ref|YP_001942492.1| hypothetical protein Clim_0420 [Chlorobium limicola DSM 245]
 gi|189340110|gb|ACD89513.1| protein of unknown function DUF59 [Chlorobium limicola DSM 245]
          Length = 360

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 131/336 (38%), Positives = 198/336 (58%), Gaps = 12/336 (3%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFI-VHNTVYLSITVPHTIAHQLQSLR 59
           M+ + ++Q++ +L+ +  P  K ++V +  + +I I   N V  S+ +          +R
Sbjct: 1   MHNVEESQVIAALRTVMEPDLKKDLVSLDMIRDIHIDERNRVSFSVVLTTPACPMKNQIR 60

Query: 60  SNAQQIIQN-IPTVKNAVVTLTE-------NKNPPQQRNNLNVKKFVAVASGKGGVGKST 111
                 ++  +P      V +T        +    + R    VK  +AVASGKGGVGKST
Sbjct: 61  QACIDAVRTYVPLADEIEVHMTAKVTSSCGHHQDEEDRPLKKVKNIIAVASGKGGVGKST 120

Query: 112 TVVNIACALKNKGKNVAILDADVYGPSIPKLLKI-SGKVEISDKKFLKPKENYGIKIMSM 170
             VN+A +L   G  V ++DAD+YGPSIP +  +   K E+ +K  + P E YG+K+MS+
Sbjct: 121 FAVNLAVSLAASGAKVGLIDADLYGPSIPTMFGLYDAKPEVVNKNLV-PVEKYGVKLMSI 179

Query: 171 ASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGV 230
             L++ + A+IWRGPM  SAI   +  V WG+LD+L+ D+PPGTGD  LT+ Q IPL+G 
Sbjct: 180 GFLIETDTAVIWRGPMASSAIKQFITEVEWGELDYLIFDLPPGTGDIQLTLVQTIPLTGA 239

Query: 231 VIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAE 290
           VIV+TPQD+AL DV +A+SM++K+++PI+G++ENMSY+   D  K Y +FG  G    A 
Sbjct: 240 VIVTTPQDVALADVSKAVSMFRKVHVPILGLVENMSYYELPDGTKDY-IFGKAGGEKFAR 298

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATS 326
             GI FL S+P   +VR   D G P V+ +  S +S
Sbjct: 299 AQGIAFLGSIPIGREVREGGDSGKPFVLTDPGSVSS 334


>gi|296271790|ref|YP_003654421.1| ParA/MinD-like ATPase [Arcobacter nitrofigilis DSM 7299]
 gi|296095965|gb|ADG91915.1| ATPase-like, ParA/MinD [Arcobacter nitrofigilis DSM 7299]
          Length = 371

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 127/329 (38%), Positives = 205/329 (62%), Gaps = 10/329 (3%)

Query: 19  PGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVT 78
           PG   +IVE   L  + +  + V + + +  ++      +R+N +++++NI  V N  + 
Sbjct: 17  PGFTKSIVEFGFLKNVEVNGDAVSILVEITSSVQEVEHEIRTNIKKVLENI-GVTNLDLQ 75

Query: 79  LTENKNPPQQRNNLN-------VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILD 131
           + + + P Q  N+++       +K FV V+SGKGGVGKSTT VN+A A   +GK V ILD
Sbjct: 76  VKKPEAPKQTSNSVSGKNIAPQIKNFVMVSSGKGGVGKSTTTVNLAVAAAMQGKRVGILD 135

Query: 132 ADVYGPSIPKLLKISGK-VEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSA 190
           AD+YGP+IP++  + GK VE+   K  KP   YG+ +MSM SL++E  A+IWRG M+  A
Sbjct: 136 ADIYGPNIPRMFGLQGKEVEVIGNK-AKPFHAYGVDVMSMGSLMEEGQALIWRGAMIMKA 194

Query: 191 IMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISM 250
           I  +L +++W +LD L IDMPPGTGDA LT+AQ +P++  V V+TPQ +AL D +R++ M
Sbjct: 195 IQQLLRDILWEELDILFIDMPPGTGDAQLTLAQSVPVTCGVNVTTPQHVALDDSRRSLDM 254

Query: 251 YQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLS 310
           ++K++IP+ G++ENMS F+      + D+FG G     A++ G   L ++P +  +R   
Sbjct: 255 FKKLHIPVGGIVENMSGFICPTCNTESDIFGMGTCEALAKEYGTTVLGNLPIEPAIREGG 314

Query: 311 DLGIPIVVHNMNSATSEIYQEISDRIQQF 339
           D G PIV  +  S +++ Y + ++ + +F
Sbjct: 315 DNGKPIVYFHPESISAKRYMKAAETLIEF 343


>gi|157164054|ref|YP_001466562.1| cytochrome c oxidase, heme b and copper-binding subunit,
           membrane-bound [Campylobacter concisus 13826]
 gi|112800262|gb|EAT97606.1| ATP/GTP-binding protein [Campylobacter concisus 13826]
          Length = 366

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 129/338 (38%), Positives = 212/338 (62%), Gaps = 6/338 (1%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           K ++++ LK +  PG + +IV    +  + I    + + + +  +       L+++ +++
Sbjct: 4   KEEVLNRLKGVIYPGFEKDIVSFGFVKNVEI-GEKILIEVEIVSSSPEVANELKTDIKRV 62

Query: 66  IQNIPTVKNAVV-TLTENKNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALKN 122
           + +   V N +   + E K+  Q   N+   VK FV V+SGKGGVGKSTT +N+A ++  
Sbjct: 63  MGSNEYVLNLIQPKIPEEKSNTQSGKNIAPQVKNFVMVSSGKGGVGKSTTTLNLAISMAK 122

Query: 123 KGKNVAILDADVYGPSIPKLL-KISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMI 181
            GK V ILDAD+YGP+IP++L +++ + ++   K LKP  ++G+++MSM  L++E +++I
Sbjct: 123 LGKKVGILDADIYGPNIPRMLGEVNTQPQVVGNK-LKPILSHGVEMMSMGVLMEEGMSLI 181

Query: 182 WRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLAL 241
           WRG M+  AI  +L +V+W +LD L +DMPPGTGDA LT+AQ +P++  V V+TPQ +AL
Sbjct: 182 WRGSMIMKAIEQLLRDVLWSELDVLFLDMPPGTGDAQLTLAQSVPVTAGVCVTTPQVVAL 241

Query: 242 IDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVP 301
            D KRA+ M++K++IPI G+IENMS F+  D GK+YD+FG G     A+      L  +P
Sbjct: 242 DDSKRALDMFEKLHIPIAGVIENMSGFICPDNGKEYDIFGKGTTEEVAKAYNTQILAEIP 301

Query: 302 FDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
            +  VRV  D G P+  +  NS T++ Y+  + R+ + 
Sbjct: 302 IEPAVRVGGDNGKPVSFYEPNSVTAKRYESAAARLWEM 339


>gi|294056509|ref|YP_003550167.1| ATPase-like, ParA/MinD [Coraliomargarita akajimensis DSM 45221]
 gi|293615842|gb|ADE55997.1| ATPase-like, ParA/MinD [Coraliomargarita akajimensis DSM 45221]
          Length = 359

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 142/366 (38%), Positives = 205/366 (56%), Gaps = 42/366 (11%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSI-------TVPHTIAHQLQS- 57
           K  I ++LK +  PG   +IV    + EI +      + +        VP TIA +++S 
Sbjct: 4   KTSIQEALKSVKFPGFSRDIVSFGLIREIEVEAGNALIGVEITTADEAVPETIAAEIKSA 63

Query: 58  ---------------LRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVAS 102
                          +   AQQ     P   N   T     +P  Q+    +K  VAVAS
Sbjct: 64  VGALDGIHEVKVRMEISKPAQQPSPAGPGSTNTAPT----GSPTMQK----IKFAVAVAS 115

Query: 103 GKGGVGKSTTVVNIACALKN----KGK-NVAILDADVYGPSIPKLLKISGKVEISDKKFL 157
           GKGGVGKST   NIACAL+N    +GK  V I+D D+YGPSIP +L  SG+ EI +   +
Sbjct: 116 GKGGVGKSTVTTNIACALQNLLDAQGKPGVGIMDCDIYGPSIPLMLGASGQPEIQND-LI 174

Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217
            P +N+G++ MSM  LVDE+  ++WRGPM+   I     NV WG+L+ L++D+PPGTGDA
Sbjct: 175 VPVQNFGVRTMSMGFLVDEDSPVVWRGPMIMKTIQQFAQNVDWGELEILVVDLPPGTGDA 234

Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277
            L++ Q IPL G +IV+TPQ  A    +R   M++K+N+PI+G+ ENMS FL +  G   
Sbjct: 235 QLSLVQTIPLDGALIVTTPQPAASNVARRGARMFEKVNVPILGVAENMS-FLETPDGTTQ 293

Query: 278 DLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY----QEIS 333
            LFG GG +  A+ +    L  +P D +VR+  D GIPIVV +  S  ++++    QEI 
Sbjct: 294 ALFGEGGGQETADALEADLLGQIPIDPNVRIGCDKGIPIVVSDPESNAAQVFFKIAQEIL 353

Query: 334 DRIQQF 339
           +R+++ 
Sbjct: 354 NRLEKM 359


>gi|49086510|gb|AAT51359.1| PA3481 [synthetic construct]
          Length = 365

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 128/342 (37%), Positives = 201/342 (58%), Gaps = 6/342 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+ I +  +  +L+    P    + V    L E+ I  + V + + + +        L  
Sbjct: 1   MSAITRQTVEATLRQYQDPYLNQDPVSAGCLREVEIQGDRVRVRLELGYAAGLFRNGLAQ 60

Query: 61  NAQQIIQNIPTVKNAVV----TLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNI 116
             Q  ++ +  V  A V     +  +K  PQ     NVK  VAVASGKGGVGK TT  N+
Sbjct: 61  TLQMALEALDGVARAEVRVDCVIQPHKAQPQVEVMGNVKNIVAVASGKGGVGKPTTAANL 120

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLV 174
           A AL  +G  V ILDAD+YGPS   +  +    + ++ ++K+ +P E +G+++MSMA L 
Sbjct: 121 ALALAREGARVGILDADIYGPSQGIMFGLPEGTRPKVREQKWFEPLEAHGVQVMSMAFLT 180

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
           D++  ++WRGPMV  A++ ++    W  LD+L++DMPPGTGD  LT+AQK+P++G VIV+
Sbjct: 181 DDSTPVVWRGPMVSGALIQLITQTAWDNLDYLVVDMPPGTGDIQLTLAQKVPVAGAVIVT 240

Query: 235 TPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGI 294
           TPQDLAL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A + G+
Sbjct: 241 TPQDLALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLAAQFGV 300

Query: 295 PFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             L S P  + +R  +D G P V+ +  S  + +YQEI+  +
Sbjct: 301 ELLASTPLSIAIRTQADSGRPTVIADPESQLAMLYQEIARHV 342


>gi|224583344|ref|YP_002637142.1| ATPase [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|224467871|gb|ACN45701.1| hypothetical protein SPC_1549 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 369

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 199/341 (58%), Gaps = 13/341 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+     
Sbjct: 13  LRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWNSAFEVLKEQCSA 72

Query: 65  IIQNIPTVKNA-------VVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVVNI 116
            +  I   K         + TL   KN P     +N VK  +AV+SGKGGVGKS+T VN+
Sbjct: 73  DLLRITGAKAIDWKLSYNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAVNL 128

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVD 175
           A AL  +G  V +LDAD+YGPSIP +L    +   S D   + P  ++G+   S+  LV 
Sbjct: 129 ALALAAEGAKVGVLDADIYGPSIPTMLGAEDQRPTSPDGTHMAPIMSHGLATNSIGYLVT 188

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
           ++ AM+WRGPM   A+M ML   +W  LDFL++DMPPGTGD  LT+AQ IP++G V+V+T
Sbjct: 189 DDNAMVWRGPMASKALMQMLQETLWPDLDFLVLDMPPGTGDIQLTLAQNIPVTGAVVVTT 248

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK    
Sbjct: 249 PQDIALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAQKLAEKYHTQ 308

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            L  +P  + +R   D G P VV    S  + IY+E++DR+
Sbjct: 309 LLGQMPLHISLREDLDRGTPTVVSRPESEFTAIYRELADRV 349


>gi|12516326|gb|AAG57174.1|AE005437_9 putative ATPase [Escherichia coli O157:H7 str. EDL933]
          Length = 379

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 129/343 (37%), Positives = 200/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 21  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 80

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 81  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 136

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 137 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 196

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 197 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 256

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 257 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 316

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 317 TQLLGQMPLHISLREDXDKGTPTVISRPESEFTAIYRQLADRV 359


>gi|301632781|ref|XP_002945459.1| PREDICTED: protein mrp-like [Xenopus (Silurana) tropicalis]
          Length = 420

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/241 (46%), Positives = 162/241 (67%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            VK  +AVASGKGGVGKSTT VN+A AL  +G  V +LDAD+YGPS P +   SG++E  
Sbjct: 153 GVKNIIAVASGKGGVGKSTTAVNLALALVAEGARVGLLDADIYGPSQPMMTGTSGELESL 212

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++PK   G++I S+  LV +  AMIWRGPM   A+  ++    W  LD+LL+DMPP
Sbjct: 213 DGKLMEPKRAMGLQINSIGFLVKDEQAMIWRGPMASQALEQLVTQTRWDDLDYLLVDMPP 272

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQK+PL+G +IV+TPQD+AL+D ++ I+M+QK+N+PI+G++ENM+  + S 
Sbjct: 273 GTGDIQLTMAQKVPLTGAIIVTTPQDIALLDARKGITMFQKVNVPILGIVENMAVHVCSH 332

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    +FG  G +  A+  G+ +L ++P  + +R  +D G P V    +   + IY+ I
Sbjct: 333 CGHVEHIFGQDGGKKMAQSQGMDYLGALPLRLSIREQADSGCPTVAAEPDGDVARIYKTI 392

Query: 333 S 333
           +
Sbjct: 393 A 393


>gi|123442999|ref|YP_001006974.1| putative ATPase [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|122089960|emb|CAL12817.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 370

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 124/338 (36%), Positives = 201/338 (59%), Gaps = 5/338 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           +L++QI   L   + P  + ++ E++ +    ++ N +++ + +P         L+ +  
Sbjct: 13  LLQSQISKVLAAFTHPTLQKSLTELRAIHHCALLDNVLHIELVMPFAWQFGFDLLKESVS 72

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIACA 119
             +  +   K     L+ N    ++ N+      V+  VAV+SGKGGVGKS+T VN+A A
Sbjct: 73  GELLAVTGAKAIDWKLSHNITTLKRANDQPGVKGVRNIVAVSSGKGGVGKSSTAVNLALA 132

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENV 178
           L  +G  V ILDAD+YGPSIP +L  + +   S D K + P   +GI   S+  LV +  
Sbjct: 133 LAEEGAKVGILDADIYGPSIPNMLGTTNQRPTSPDGKHMAPIMAHGIATNSIGYLVTDEN 192

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
           AM+WRGPM   A+M ML + +W  LD+L+IDMPPGTGD  LT++Q IP++G ++V+TPQD
Sbjct: 193 AMVWRGPMASKALMQMLQDTLWPDLDYLVIDMPPGTGDIQLTLSQNIPVTGALVVTTPQD 252

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +ALID  + I M++K+++P++G+IENMS  + S+ G    +FG GGA   A+K     L 
Sbjct: 253 IALIDAMKGIVMFEKVHVPVLGIIENMSMHICSNCGHLEPIFGTGGAEKLAQKYHCKLLG 312

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +P  + +R   D G P VV + +S  ++IY++++  +
Sbjct: 313 QIPLHISLREDLDRGEPTVVSHPDSEFADIYRQLASNV 350


>gi|50748402|ref|XP_421229.1| PREDICTED: hypothetical protein [Gallus gallus]
          Length = 326

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 112/250 (44%), Positives = 168/250 (67%), Gaps = 2/250 (0%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK--NKGKNVAILDADVYGPSIPKLL 143
           P+Q+    VK+ + VASGKGGVGKST  VNIA AL   +  K V +LDAD+YGPSIPK++
Sbjct: 65  PKQKPIEGVKQVLVVASGKGGVGKSTAAVNIALALAANDSAKEVGLLDADIYGPSIPKMM 124

Query: 144 KISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQL 203
            + G  E++ K  ++P +NYGI  MSM  L++E   ++WRG MV SA+  +L  V WGQL
Sbjct: 125 NLKGNPELTPKNLMRPLKNYGIACMSMGFLIEEAAPVVWRGLMVMSAVEKLLRQVDWGQL 184

Query: 204 DFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIE 263
           D+L+IDMPPGTGD  L+I+Q IP++G VI+STPQD+AL+D ++   M++K+++P++G+++
Sbjct: 185 DYLVIDMPPGTGDVQLSISQNIPIAGAVIISTPQDVALLDARKGTEMFRKVHVPVLGLVQ 244

Query: 264 NMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS 323
           NMS F       +  +FG  G R  A+ +G+  L  +P  + +R   D G P+V+    S
Sbjct: 245 NMSVFRCPKCEHETHIFGADGVRDLAKTLGLDVLGDIPLHVTIRETCDSGQPVVISQPQS 304

Query: 324 ATSEIYQEIS 333
             ++ Y +I+
Sbjct: 305 DAAKAYLKIA 314


>gi|167585791|ref|ZP_02378179.1| Cobyrinic acid a,c-diamide synthase [Burkholderia ubonensis Bu]
          Length = 363

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 120/281 (42%), Positives = 190/281 (67%), Gaps = 5/281 (1%)

Query: 58  LRSNAQQIIQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTV 113
           +R+     ++ +P V++A V ++++   +  Q+   L  NVK  VAVASGKGGVGKSTT 
Sbjct: 57  VRARVSAALEAVPGVRDARVAVSQDIVAHTVQRGVKLLPNVKNIVAVASGKGGVGKSTTA 116

Query: 114 VNIACALKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMAS 172
           VN+A AL  +G +V ILDAD+YGPS+P +L I G + E  D + + P   +G++  S+  
Sbjct: 117 VNLALALAAEGASVGILDADIYGPSLPTMLGIHGQRPESPDNQSMNPLVGHGLQANSIGF 176

Query: 173 LVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVI 232
           L++E+  M+WRGPM  SA+  +L    W +LD+L++DMPPGTGD  LT+AQ++P++G VI
Sbjct: 177 LIEEDNPMVWRGPMATSALEQLLRQTNWRELDYLIVDMPPGTGDIQLTLAQRVPVTGAVI 236

Query: 233 VSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKI 292
           V+TPQD+AL+D K+ + M++K+ IPI+G++ENMS  + S+ G +  +FG GGA+  ++  
Sbjct: 237 VTTPQDIALLDAKKGLKMFEKVGIPILGIVENMSIHVCSNCGHEEHIFGAGGAQRMSQDY 296

Query: 293 GIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           G+  L S+P D+ +R  +D G P V  + +   ++ Y+EI+
Sbjct: 297 GVNVLGSLPLDIAIREQADGGAPTVAADPDGKLAQRYREIA 337


>gi|107103014|ref|ZP_01366932.1| hypothetical protein PaerPA_01004083 [Pseudomonas aeruginosa PACS2]
          Length = 356

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 124/312 (39%), Positives = 192/312 (61%), Gaps = 6/312 (1%)

Query: 31  LSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVV----TLTENKNPP 86
           L E+ I  + V + + + +        L    Q  ++ +  V  A V     +  +K  P
Sbjct: 23  LREVEIQGDRVRVRLELGYAAGLFRNGLAQTLQMALEALDGVARAEVRVDCVIQPHKAQP 82

Query: 87  QQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI- 145
           Q     NVK  VAVASGKGGVGKSTT  N+A AL  +G  V ILDAD+YGPS   +  + 
Sbjct: 83  QVEVMGNVKNIVAVASGKGGVGKSTTAANLALALAREGARVGILDADIYGPSQGIMFGLP 142

Query: 146 -SGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLD 204
              + ++ ++K+ +P E +G+++MSMA L D++  ++WRGPMV  A++ ++    W  LD
Sbjct: 143 EGTRPKVREQKWFEPLEAHGVQVMSMAFLTDDSTPVVWRGPMVSGALIQLITQTAWDNLD 202

Query: 205 FLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIEN 264
           +L++DMPPGTGD  LT+AQK+P++G VIV+TPQDLAL+D K+ + M++K+NIP++G++EN
Sbjct: 203 YLVVDMPPGTGDIQLTLAQKVPVAGAVIVTTPQDLALLDAKKGVEMFRKVNIPVLGVVEN 262

Query: 265 MSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSA 324
           M+  + S+ G    LFG GG    A + G+  L S+P  + +R  +D G P V+ +  S 
Sbjct: 263 MAVHICSNCGHAEHLFGEGGGEKLAAQFGVELLASMPLSIAIRTQADSGRPTVIADPESQ 322

Query: 325 TSEIYQEISDRI 336
            + +YQEI+  +
Sbjct: 323 LAMLYQEIARHV 334


>gi|89092510|ref|ZP_01165463.1| ParA family protein [Oceanospirillum sp. MED92]
 gi|89083022|gb|EAR62241.1| ParA family protein [Oceanospirillum sp. MED92]
          Length = 364

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 123/335 (36%), Positives = 197/335 (58%), Gaps = 6/335 (1%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+  +   L  + IP  + +++    ++ +      + + I +    A   ++L  + Q 
Sbjct: 4   LRTNVESVLGQIEIPFREQDLLTAGAINSLSCEGGEILVGIELDFPSAGVAKALEKSIQD 63

Query: 65  IIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIACAL 120
            +  +  V +  V+++ +    Q + ++     VK  +A+ASGKGGVGKSTT VN+A A+
Sbjct: 64  KLAELSGVNSCKVSISHSVKASQGQQSIPLMAGVKNVIAIASGKGGVGKSTTTVNLALAM 123

Query: 121 KNKGKNVAILDADVYGPSIPKLLKISGKV--EISDKKFLKPKENYGIKIMSMASLVDENV 178
             +G  V ILDAD+YGPS   +L +   V  +  D+K   P E +G++ MSM+ LV+EN 
Sbjct: 124 AAEGAKVGILDADIYGPSQGMMLGVDEGVRPQPYDEKSFSPIEAHGLQSMSMSYLVEENT 183

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
           AM+WRGPM   A+  +L    W  LD+L IDMPPGTGD  LT++QK+P+SG VIV+TPQD
Sbjct: 184 AMVWRGPMAAGALQQLLTQTRWHDLDYLFIDMPPGTGDIQLTLSQKVPVSGAVIVTTPQD 243

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +AL+D K+ I M++K++IP++G++ENMS    S+ G    +FG+GG +  AE      L 
Sbjct: 244 IALLDAKKGIEMFRKVDIPVLGVVENMSTHTCSNCGHTEAIFGDGGGKEIAELYETELLG 303

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
            +P  + +R  +D G P V        ++IY+E++
Sbjct: 304 KLPLALSIRQQADSGKPSVAAEPEGEYAQIYREVA 338


>gi|317405567|gb|EFV85870.1| amidase [Achromobacter xylosoxidans C54]
          Length = 362

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 166/244 (68%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NV+  +AVASGKGGVGKSTT VN+A AL  +G  V +LDAD+YGPS+P +L +SG+ E  
Sbjct: 95  NVRNIIAVASGKGGVGKSTTAVNLALALAAEGAKVGLLDADIYGPSVPTMLGVSGRPESL 154

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P   +G++  S+  L+D +   IWRGPMV  A+  +L    W  LD+L++DMPP
Sbjct: 155 DNKSMEPLTGHGLQANSIGFLIDADSPAIWRGPMVTQALEQLLRQTNWRDLDYLIVDMPP 214

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQK+P+ G VIV+TPQD+AL+D ++ + M+QK+ +PI+G++ENM+  + S 
Sbjct: 215 GTGDVALTLAQKVPVVGAVIVTTPQDVALLDARKGLRMFQKVEVPILGVVENMAIHICSQ 274

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    +FG GG +  A + G P+L S+P  + +R  +D G P VV +  S  + +Y+ I
Sbjct: 275 CGHAEHIFGEGGGQRMAAQYGTPWLGSLPLTLAIREQTDAGTPTVVADPGSEAAGLYRGI 334

Query: 333 SDRI 336
           + ++
Sbjct: 335 ARKL 338


>gi|256421265|ref|YP_003121918.1| hypothetical protein Cpin_2226 [Chitinophaga pinensis DSM 2588]
 gi|256036173|gb|ACU59717.1| protein of unknown function DUF59 [Chitinophaga pinensis DSM 2588]
          Length = 365

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 138/331 (41%), Positives = 200/331 (60%), Gaps = 13/331 (3%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I   QI+ +L  +  P    ++V +  + +I I  N V  ++ +  T A  L+ L  NA 
Sbjct: 2   ITTEQILKALSNVEEPDLGKDLVTLNMVKDIEIDGNKVKFTVVL-TTPACPLKDLIRNAC 60

Query: 64  QIIQNIPTVKNAVV----TLTENKNPPQQRNNL-NVKKFVAVASGKGGVGKSTTVVNIAC 118
               +    K+A V    T   N N    R+ L NVK  + VASGKGGVGKST   N+A 
Sbjct: 61  VNAIHHLVSKDAEVQVNMTANVNSNRKDARSVLPNVKNIIVVASGKGGVGKSTVAANLAL 120

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKV----EISDKKFLKPKENYGIKIMSMASLV 174
           AL   G  V ++DAD+YGPS+P +  I G+      +  K  + P E +GIK+MS+ SL+
Sbjct: 121 ALSEGGAKVGLMDADIYGPSVPIMFGIRGERPMMETVEGKGMIVPIEKHGIKLMSIGSLI 180

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
           DE  A++WRGPMV SA+   L +V WG+LD+L+ID PPGTGD HLT+ Q +P++GVV+V+
Sbjct: 181 DEKQAVVWRGPMVSSALRQFLTDVNWGELDYLVIDTPPGTGDVHLTLVQTVPVTGVVMVT 240

Query: 235 TPQDLALIDVKRAISMY--QKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEK 291
           TPQD+AL D K+ I+M+   ++N+PI+G+IENM+YF  ++    KY +FG  G +  AE+
Sbjct: 241 TPQDVALADAKKGIAMFGGGQINVPILGLIENMAYFTPAELPNNKYYIFGQEGGKRLAEQ 300

Query: 292 IGIPFLESVPFDMDVRVLSDLGIPIVVHNMN 322
           + IPFL  +P    +R   D G+P +V   N
Sbjct: 301 LEIPFLGQIPLVQSIREGGDDGVPAMVGGDN 331


>gi|257053592|ref|YP_003131425.1| Cobyrinic acid ac-diamide synthase [Halorhabdus utahensis DSM
           12940]
 gi|256692355|gb|ACV12692.1| Cobyrinic acid ac-diamide synthase [Halorhabdus utahensis DSM
           12940]
          Length = 348

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 113/309 (36%), Positives = 191/309 (61%), Gaps = 3/309 (0%)

Query: 13  LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTV 72
           L  +  P   ++IV +  ++++ + + T ++ + +    +    ++    +++I +    
Sbjct: 10  LASVEDPDLDDDIVSLGLVNDVELENGTAHIDLALGAPFSPTETTIADRVREVIGD--AA 67

Query: 73  KNAVVTLTENKNPPQQRNNL-NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILD 131
            +  V L+   +   + + L  VK  +AVASGKGGVGKSTT VN+A  L ++G  V + D
Sbjct: 68  PDLAVELSATIDRGTEGDILPGVKNVIAVASGKGGVGKSTTSVNLAAGLADRGARVGLFD 127

Query: 132 ADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAI 191
           AD+YGP++P++L    + E +D   + P E +G+K+MSM  L+ E+  +IWRGPMV   +
Sbjct: 128 ADIYGPNVPRMLDAHERPEATDDDKIIPPEKHGMKLMSMDFLLGEDDPVIWRGPMVHQTL 187

Query: 192 MHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMY 251
             +  +V WG+LD+L++D+PPGTGD  LT+ Q +P++G VIV+TPQ +AL D K+ + M+
Sbjct: 188 TQLFEDVQWGELDYLVVDLPPGTGDTQLTLLQTVPVTGAVIVTTPQGVALDDAKKGLEMF 247

Query: 252 QKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSD 311
            K + P++G++ENMS F   D G ++ +FG GG R  AE++ +PFL  +P D ++R   D
Sbjct: 248 GKHDTPVLGIVENMSSFKCPDCGSEHAIFGEGGGREFAEQVQMPFLGEIPLDPEIRERGD 307

Query: 312 LGIPIVVHN 320
            G P V+ +
Sbjct: 308 EGRPAVLAD 316


>gi|218549527|ref|YP_002383318.1| ATPase [Escherichia fergusonii ATCC 35469]
 gi|218357068|emb|CAQ89700.1| antiporter inner membrane protein [Escherichia fergusonii ATCC
           35469]
 gi|325497929|gb|EGC95788.1| ATPase [Escherichia fergusonii ECD227]
          Length = 369

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 129/343 (37%), Positives = 200/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 11  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 70

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 71  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 126

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 127 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 186

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 187 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 246

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 247 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 306

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 307 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 349


>gi|307721442|ref|YP_003892582.1| ATPase [Sulfurimonas autotrophica DSM 16294]
 gi|306979535|gb|ADN09570.1| ATPase-like, ParA/MinD [Sulfurimonas autotrophica DSM 16294]
          Length = 385

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 127/339 (37%), Positives = 209/339 (61%), Gaps = 9/339 (2%)

Query: 5   LKNQIVDS-LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           +  +IV S L  +  PG   +IV    + +I +  N    ++ +  +     Q ++  A 
Sbjct: 1   MTEEIVKSALSKVMYPGFTKDIVTFGFVKDIVVNGNDTSFTVEITSSAPEVAQQIKDEAT 60

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQRNN-----LNVKKFVAVASGKGGVGKSTTVVNIAC 118
           + +++     N  V +   + P +  ++       VK F+ V+SGKGGVGKSTT VNIA 
Sbjct: 61  EALKSA-GAANVTVNVKAPQMPRESSSHGKNIAPQVKNFLMVSSGKGGVGKSTTSVNIAI 119

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +GK V +LDAD+YGP++P+++ +S  K E++  K L P + YGI++MSM SL+++ 
Sbjct: 120 ALAAQGKKVGLLDADIYGPNVPRMMGVSDVKPEVNGNKVL-PIKAYGIEMMSMGSLMEDG 178

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            ++IWRG M+  AI   L +++W +LD L+IDMPPGTGDA LT+AQ +P++  + V+TPQ
Sbjct: 179 QSLIWRGAMIMKAIEQFLRDILWSELDVLVIDMPPGTGDAQLTLAQSVPVTAGLTVTTPQ 238

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
            ++L D +R++ M++K+NIPI G+IENMS F+A DTG +YD+FG G +   A++     +
Sbjct: 239 GVSLDDSRRSLDMFKKLNIPIAGIIENMSGFIAPDTGVEYDIFGKGTSTPMAKEFDTQII 298

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P +  +R   D G PI   + +S +++ Y + ++ I
Sbjct: 299 AEIPIEPSIRTGGDEGKPITFVDPSSESAKRYMKAAESI 337


>gi|268590248|ref|ZP_06124469.1| mrp protein [Providencia rettgeri DSM 1131]
 gi|291314532|gb|EFE54985.1| mrp protein [Providencia rettgeri DSM 1131]
          Length = 370

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 126/343 (36%), Positives = 199/343 (58%), Gaps = 5/343 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           ++L  Q+   L   + P  + N++ ++ L    ++ N +++ + +P       Q+L S  
Sbjct: 12  ELLTEQVSKVLASFTHPTLQRNLISIKALHHCAMLDNVLHVELVMPFVWKGPFQTLISEK 71

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIAC 118
              ++           L  +    ++ N+L     V+  +AV+SGKGGVGKS+T VN+A 
Sbjct: 72  TAELKQQTGAHAVEWKLRHDITTLKRANDLPGINGVRNILAVSSGKGGVGKSSTSVNLAL 131

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G  V ILDAD+YGPSIP +L  + +   S D + + P   YG+   S+  LV ++
Sbjct: 132 ALAQEGAKVGILDADIYGPSIPNMLGTTLERPTSPDGQHMAPIMAYGLATNSIGYLVTDD 191

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A+M ML + +W  LD+L+IDMPPGTGD  LT++Q IP++G V+V+TPQ
Sbjct: 192 NAMVWRGPMASKALMQMLQDTLWPDLDYLVIDMPPGTGDIQLTLSQNIPVTGAVVVTTPQ 251

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+AL+D  + I M++K+N+P++G++ENMS  + S+ G    +FG GGA   AEK     L
Sbjct: 252 DIALVDAMKGIVMFKKVNVPVLGVVENMSAHICSNCGHVEPIFGTGGAEKLAEKYHTKLL 311

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
             VP  + +R   D G P V+ +     ++IY+EI+  I    
Sbjct: 312 GQVPLHISLREDLDRGQPTVMRDPEGEFADIYREIASGISALM 354


>gi|167035307|ref|YP_001670538.1| hypothetical protein PputGB1_4314 [Pseudomonas putida GB-1]
 gi|166861795|gb|ABZ00203.1| protein of unknown function DUF59 [Pseudomonas putida GB-1]
          Length = 364

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 180/280 (64%), Gaps = 6/280 (2%)

Query: 63  QQIIQNIPTVKNAVVTL----TENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
           Q  I N+  V  A V++      +K   Q     NVK  +AVASGKGGVGKSTT  N+A 
Sbjct: 63  QTAIGNLEGVSGAQVSIDCVVAAHKAQAQVPAMANVKNIIAVASGKGGVGKSTTAANLAL 122

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKIS--GKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           AL  +G  V ILDAD+YGPS   +  I+   + +I ++K+  P + +G+++MSMA L D+
Sbjct: 123 ALAREGARVGILDADIYGPSQGVMFGIAEGTRPQIREQKWFVPIKAHGVEVMSMAFLTDD 182

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           N  M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TP
Sbjct: 183 NTPMVWRGPMVSGALLQLVTQTAWDDLDYLVIDMPPGTGDIQLTLAQKVPVAGSVIVTTP 242

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QDLAL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A + G+  
Sbjct: 243 QDLALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLASQYGVDL 302

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L S+P  M +R  +D G P  +    S  + +YQE++ ++
Sbjct: 303 LASLPLSMLIREQADSGKPTAIAEPESQIAMVYQELARQV 342


>gi|38704052|ref|NP_310946.2| ATPase [Escherichia coli O157:H7 str. Sakai]
 gi|89108931|ref|AP_002711.1| antiporter inner membrane protein [Escherichia coli str. K-12
           substr. W3110]
 gi|90111388|ref|NP_416616.4| antiporter inner membrane protein [Escherichia coli str. K-12
           substr. MG1655]
 gi|110642321|ref|YP_670051.1| putative ATPase [Escherichia coli 536]
 gi|110806075|ref|YP_689595.1| putative ATPase [Shigella flexneri 5 str. 8401]
 gi|157155630|ref|YP_001463461.1| putative ATPase [Escherichia coli E24377A]
 gi|157161596|ref|YP_001458914.1| putative ATPase [Escherichia coli HS]
 gi|161486183|ref|NP_754529.2| putative ATPase [Escherichia coli CFT073]
 gi|162138410|ref|YP_541386.2| putative ATPase [Escherichia coli UTI89]
 gi|168750113|ref|ZP_02775135.1| mrp protein [Escherichia coli O157:H7 str. EC4113]
 gi|168756377|ref|ZP_02781384.1| mrp protein [Escherichia coli O157:H7 str. EC4401]
 gi|168761859|ref|ZP_02786866.1| mrp protein [Escherichia coli O157:H7 str. EC4501]
 gi|168770092|ref|ZP_02795099.1| mrp protein [Escherichia coli O157:H7 str. EC4486]
 gi|168775930|ref|ZP_02800937.1| mrp protein [Escherichia coli O157:H7 str. EC4196]
 gi|168783889|ref|ZP_02808896.1| mrp protein [Escherichia coli O157:H7 str. EC4076]
 gi|168789081|ref|ZP_02814088.1| mrp protein [Escherichia coli O157:H7 str. EC869]
 gi|168798956|ref|ZP_02823963.1| mrp protein [Escherichia coli O157:H7 str. EC508]
 gi|170019567|ref|YP_001724521.1| putative ATPase [Escherichia coli ATCC 8739]
 gi|170081737|ref|YP_001731057.1| antiporter inner membrane protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|170682232|ref|YP_001743010.1| putative ATPase [Escherichia coli SMS-3-5]
 gi|187732057|ref|YP_001879552.1| putative ATPase [Shigella boydii CDC 3083-94]
 gi|188495832|ref|ZP_03003102.1| mrp protein [Escherichia coli 53638]
 gi|191165418|ref|ZP_03027260.1| mrp protein [Escherichia coli B7A]
 gi|191170265|ref|ZP_03031819.1| mrp protein [Escherichia coli F11]
 gi|194431354|ref|ZP_03063646.1| mrp protein [Shigella dysenteriae 1012]
 gi|194435972|ref|ZP_03068074.1| mrp protein [Escherichia coli 101-1]
 gi|195937885|ref|ZP_03083267.1| putative ATPase [Escherichia coli O157:H7 str. EC4024]
 gi|208808502|ref|ZP_03250839.1| mrp protein [Escherichia coli O157:H7 str. EC4206]
 gi|208813212|ref|ZP_03254541.1| mrp protein [Escherichia coli O157:H7 str. EC4045]
 gi|208819623|ref|ZP_03259943.1| mrp protein [Escherichia coli O157:H7 str. EC4042]
 gi|209398237|ref|YP_002271395.1| mrp protein [Escherichia coli O157:H7 str. EC4115]
 gi|209919573|ref|YP_002293657.1| putative ATPase [Escherichia coli SE11]
 gi|215487335|ref|YP_002329766.1| putative ATPase [Escherichia coli O127:H6 str. E2348/69]
 gi|217329601|ref|ZP_03445680.1| mrp protein [Escherichia coli O157:H7 str. TW14588]
 gi|218554678|ref|YP_002387591.1| putative ATPase [Escherichia coli IAI1]
 gi|218559032|ref|YP_002391945.1| ATPase [Escherichia coli S88]
 gi|218695731|ref|YP_002403398.1| putative ATPase [Escherichia coli 55989]
 gi|218699296|ref|YP_002406925.1| putative ATPase [Escherichia coli IAI39]
 gi|218705642|ref|YP_002413161.1| putative ATPase [Escherichia coli UMN026]
 gi|238901299|ref|YP_002927095.1| antiporter inner membrane protein [Escherichia coli BW2952]
 gi|253772959|ref|YP_003035790.1| ATPase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254162128|ref|YP_003045236.1| putative ATPase [Escherichia coli B str. REL606]
 gi|254793940|ref|YP_003078777.1| putative ATPase [Escherichia coli O157:H7 str. TW14359]
 gi|256017718|ref|ZP_05431583.1| putative ATPase [Shigella sp. D9]
 gi|256022201|ref|ZP_05436066.1| putative ATPase [Escherichia sp. 4_1_40B]
 gi|260856088|ref|YP_003229979.1| antiporter inner membrane protein Mrp [Escherichia coli O26:H11
           str. 11368]
 gi|260868818|ref|YP_003235220.1| antiporter inner membrane protein Mrp [Escherichia coli O111:H-
           str. 11128]
 gi|261224995|ref|ZP_05939276.1| antiporter inner membrane protein [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261257657|ref|ZP_05950190.1| antiporter inner membrane protein Mrp [Escherichia coli O157:H7
           str. FRIK966]
 gi|291283361|ref|YP_003500179.1| putative ATPase [Escherichia coli O55:H7 str. CB9615]
 gi|293405582|ref|ZP_06649574.1| ATPase [Escherichia coli FVEC1412]
 gi|293410472|ref|ZP_06654048.1| ATPase [Escherichia coli B354]
 gi|293415398|ref|ZP_06658041.1| ATPase [Escherichia coli B185]
 gi|293446465|ref|ZP_06662887.1| ATPase [Escherichia coli B088]
 gi|297518780|ref|ZP_06937166.1| putative ATPase [Escherichia coli OP50]
 gi|298381263|ref|ZP_06990862.1| ATPase [Escherichia coli FVEC1302]
 gi|301026437|ref|ZP_07189876.1| putative protein mrp [Escherichia coli MS 196-1]
 gi|306814770|ref|ZP_07448932.1| putative ATPase [Escherichia coli NC101]
 gi|307138767|ref|ZP_07498123.1| putative ATPase [Escherichia coli H736]
 gi|307314907|ref|ZP_07594497.1| ATPase-like, ParA/MinD [Escherichia coli W]
 gi|312968927|ref|ZP_07783134.1| protein mrp [Escherichia coli 2362-75]
 gi|312973642|ref|ZP_07787814.1| protein mrp [Escherichia coli 1827-70]
 gi|331663605|ref|ZP_08364515.1| protein mrp [Escherichia coli TA143]
 gi|331668808|ref|ZP_08369656.1| protein mrp [Escherichia coli TA271]
 gi|331683791|ref|ZP_08384387.1| protein mrp [Escherichia coli H299]
 gi|84028165|sp|P0AF09|MRP_ECOL6 RecName: Full=Protein mrp
 gi|84028166|sp|P0AF08|MRP_ECOLI RecName: Full=Protein mrp
 gi|42017|emb|CAA39316.1| put. ATPase [Escherichia coli K-12]
 gi|85675228|dbj|BAE76591.1| antiporter inner membrane protein [Escherichia coli str. K12
           substr. W3110]
 gi|87082045|gb|AAC75174.2| antiporter inner membrane protein [Escherichia coli str. K-12
           substr. MG1655]
 gi|110343913|gb|ABG70150.1| Mrp protein [Escherichia coli 536]
 gi|110615623|gb|ABF04290.1| putative ATPase [Shigella flexneri 5 str. 8401]
 gi|157067276|gb|ABV06531.1| mrp protein [Escherichia coli HS]
 gi|157077660|gb|ABV17368.1| mrp protein [Escherichia coli E24377A]
 gi|169754495|gb|ACA77194.1| putative ATPase [Escherichia coli ATCC 8739]
 gi|169889572|gb|ACB03279.1| antiporter inner membrane protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|170519950|gb|ACB18128.1| mrp protein [Escherichia coli SMS-3-5]
 gi|187429049|gb|ACD08323.1| mrp protein [Shigella boydii CDC 3083-94]
 gi|187768596|gb|EDU32440.1| mrp protein [Escherichia coli O157:H7 str. EC4196]
 gi|188015644|gb|EDU53766.1| mrp protein [Escherichia coli O157:H7 str. EC4113]
 gi|188491031|gb|EDU66134.1| mrp protein [Escherichia coli 53638]
 gi|188998849|gb|EDU67835.1| mrp protein [Escherichia coli O157:H7 str. EC4076]
 gi|189356431|gb|EDU74850.1| mrp protein [Escherichia coli O157:H7 str. EC4401]
 gi|189360980|gb|EDU79399.1| mrp protein [Escherichia coli O157:H7 str. EC4486]
 gi|189367842|gb|EDU86258.1| mrp protein [Escherichia coli O157:H7 str. EC4501]
 gi|189371230|gb|EDU89646.1| mrp protein [Escherichia coli O157:H7 str. EC869]
 gi|189378432|gb|EDU96848.1| mrp protein [Escherichia coli O157:H7 str. EC508]
 gi|190904581|gb|EDV64288.1| mrp protein [Escherichia coli B7A]
 gi|190909781|gb|EDV69366.1| mrp protein [Escherichia coli F11]
 gi|194420179|gb|EDX36256.1| mrp protein [Shigella dysenteriae 1012]
 gi|194424700|gb|EDX40685.1| mrp protein [Escherichia coli 101-1]
 gi|208728303|gb|EDZ77904.1| mrp protein [Escherichia coli O157:H7 str. EC4206]
 gi|208734489|gb|EDZ83176.1| mrp protein [Escherichia coli O157:H7 str. EC4045]
 gi|208739746|gb|EDZ87428.1| mrp protein [Escherichia coli O157:H7 str. EC4042]
 gi|209159637|gb|ACI37070.1| mrp protein [Escherichia coli O157:H7 str. EC4115]
 gi|209912832|dbj|BAG77906.1| putative ATPase [Escherichia coli SE11]
 gi|215265407|emb|CAS09807.1| antiporter inner membrane protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217317369|gb|EEC25798.1| mrp protein [Escherichia coli O157:H7 str. TW14588]
 gi|218352463|emb|CAU98239.1| antiporter inner membrane protein [Escherichia coli 55989]
 gi|218361446|emb|CAQ99033.1| antiporter inner membrane protein [Escherichia coli IAI1]
 gi|218365801|emb|CAR03541.1| antiporter inner membrane protein [Escherichia coli S88]
 gi|218369282|emb|CAR17040.1| antiporter inner membrane protein [Escherichia coli IAI39]
 gi|218432739|emb|CAR13633.1| antiporter inner membrane protein [Escherichia coli UMN026]
 gi|222033876|emb|CAP76617.1| Protein mrp [Escherichia coli LF82]
 gi|226237468|dbj|BAH46990.1| antiporter inner membrane protein [Escherichia coli O55:H7]
 gi|238859992|gb|ACR61990.1| antiporter inner membrane protein [Escherichia coli BW2952]
 gi|242377756|emb|CAQ32518.1| putative ATPase [Escherichia coli BL21(DE3)]
 gi|253324003|gb|ACT28605.1| mrp protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974029|gb|ACT39700.1| antiporter inner membrane protein [Escherichia coli B str. REL606]
 gi|253978197|gb|ACT43867.1| antiporter inner membrane protein [Escherichia coli BL21(DE3)]
 gi|254593340|gb|ACT72701.1| antiporter inner membrane protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|257754737|dbj|BAI26239.1| antiporter inner membrane protein Mrp [Escherichia coli O26:H11
           str. 11368]
 gi|257765174|dbj|BAI36669.1| antiporter inner membrane protein Mrp [Escherichia coli O111:H-
           str. 11128]
 gi|260448790|gb|ACX39212.1| Mrp protein [Escherichia coli DH1]
 gi|281179205|dbj|BAI55535.1| putative ATPase [Escherichia coli SE15]
 gi|284922101|emb|CBG35180.1| conserved hypothetical protein [Escherichia coli 042]
 gi|290763234|gb|ADD57195.1| Putative ATPase [Escherichia coli O55:H7 str. CB9615]
 gi|291323295|gb|EFE62723.1| ATPase [Escherichia coli B088]
 gi|291427790|gb|EFF00817.1| ATPase [Escherichia coli FVEC1412]
 gi|291433046|gb|EFF06025.1| ATPase [Escherichia coli B185]
 gi|291470940|gb|EFF13424.1| ATPase [Escherichia coli B354]
 gi|294490932|gb|ADE89688.1| mrp protein [Escherichia coli IHE3034]
 gi|298278705|gb|EFI20219.1| ATPase [Escherichia coli FVEC1302]
 gi|299879674|gb|EFI87885.1| putative protein mrp [Escherichia coli MS 196-1]
 gi|305852164|gb|EFM52616.1| putative ATPase [Escherichia coli NC101]
 gi|306905613|gb|EFN36143.1| ATPase-like, ParA/MinD [Escherichia coli W]
 gi|307554182|gb|ADN46957.1| Mrp protein [Escherichia coli ABU 83972]
 gi|307626342|gb|ADN70646.1| putative ATPase [Escherichia coli UM146]
 gi|309702431|emb|CBJ01755.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|310332237|gb|EFP99472.1| protein mrp [Escherichia coli 1827-70]
 gi|312286329|gb|EFR14242.1| protein mrp [Escherichia coli 2362-75]
 gi|312946733|gb|ADR27560.1| putative ATPase [Escherichia coli O83:H1 str. NRG 857C]
 gi|315061426|gb|ADT75753.1| antiporter inner membrane protein [Escherichia coli W]
 gi|315136744|dbj|BAJ43903.1| putative ATPase [Escherichia coli DH1]
 gi|315618109|gb|EFU98700.1| protein mrp [Escherichia coli 3431]
 gi|320191723|gb|EFW66371.1| putative ATPase [Escherichia coli O157:H7 str. EC1212]
 gi|320195980|gb|EFW70604.1| putative ATPase [Escherichia coli WV_060327]
 gi|320199177|gb|EFW73770.1| putative ATPase [Escherichia coli EC4100B]
 gi|320641294|gb|EFX10767.1| antiporter inner membrane protein [Escherichia coli O157:H7 str.
           G5101]
 gi|320646658|gb|EFX15562.1| antiporter inner membrane protein [Escherichia coli O157:H- str.
           493-89]
 gi|320651945|gb|EFX20313.1| antiporter inner membrane protein [Escherichia coli O157:H- str. H
           2687]
 gi|320657545|gb|EFX25343.1| antiporter inner membrane protein [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320668027|gb|EFX34923.1| antiporter inner membrane protein [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323152333|gb|EFZ38622.1| protein mrp [Escherichia coli EPECa14]
 gi|323172705|gb|EFZ58339.1| protein mrp [Escherichia coli LT-68]
 gi|323176993|gb|EFZ62583.1| protein mrp [Escherichia coli 1180]
 gi|323183729|gb|EFZ69121.1| protein mrp [Escherichia coli 1357]
 gi|323377995|gb|ADX50263.1| ATPase-like, ParA/MinD [Escherichia coli KO11]
 gi|323936727|gb|EGB33012.1| ParA/MinD ATPase like protein [Escherichia coli E1520]
 gi|323940819|gb|EGB37007.1| ParA/MinD ATPase [Escherichia coli E482]
 gi|323944928|gb|EGB40993.1| ParA/MinD ATPase-like protein [Escherichia coli H120]
 gi|323951908|gb|EGB47782.1| ParA/MinD ATPase [Escherichia coli H252]
 gi|323956147|gb|EGB51899.1| ParA/MinD ATPase [Escherichia coli H263]
 gi|323961709|gb|EGB57313.1| ParA/MinD ATPase [Escherichia coli H489]
 gi|323968242|gb|EGB63651.1| ParA/MinD ATPase [Escherichia coli M863]
 gi|323972902|gb|EGB68100.1| ParA/MinD ATPase [Escherichia coli TA007]
 gi|323977698|gb|EGB72784.1| ParA/MinD ATPase [Escherichia coli TW10509]
 gi|324118044|gb|EGC11943.1| ParA/MinD ATPase [Escherichia coli E1167]
 gi|326338467|gb|EGD62295.1| putative ATPase [Escherichia coli O157:H7 str. 1044]
 gi|326347010|gb|EGD70743.1| putative ATPase [Escherichia coli O157:H7 str. 1125]
 gi|327253240|gb|EGE64894.1| protein mrp [Escherichia coli STEC_7v]
 gi|330911945|gb|EGH40455.1| scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like
           [Escherichia coli AA86]
 gi|331059404|gb|EGI31381.1| protein mrp [Escherichia coli TA143]
 gi|331064002|gb|EGI35913.1| protein mrp [Escherichia coli TA271]
 gi|331078743|gb|EGI49945.1| protein mrp [Escherichia coli H299]
 gi|332091497|gb|EGI96581.1| protein mrp [Shigella dysenteriae 155-74]
 gi|333002150|gb|EGK21715.1| protein mrp [Shigella flexneri VA-6]
 gi|333002425|gb|EGK21987.1| protein mrp [Shigella flexneri K-218]
 gi|333003466|gb|EGK23010.1| protein mrp [Shigella flexneri K-272]
 gi|333017295|gb|EGK36615.1| protein mrp [Shigella flexneri K-227]
          Length = 369

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/343 (37%), Positives = 200/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 11  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 70

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 71  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 126

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 127 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 186

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 187 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 246

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 247 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 306

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 307 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 349


>gi|77360261|ref|YP_339836.1| MinD/MRP family ATPase [Pseudoalteromonas haloplanktis TAC125]
 gi|76875172|emb|CAI86393.1| putative ATPase of the MinD/MRP superfamily [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 358

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 163/238 (68%), Gaps = 2/238 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            +K  V +ASGKGGVGKSTT VN+A AL ++G  V ILDAD+YGPSIP LL + G   I+
Sbjct: 95  TIKHIVLIASGKGGVGKSTTAVNLAGALHSEGAKVGILDADIYGPSIPMLLGLVGAEPIT 154

Query: 153 -DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K L+P +  GIK  S+  LV  + A +WRGPM   A+  +L+   WG+LD+L++DMP
Sbjct: 155 KDNKQLQPFDANGIKAQSIGFLVPSDDATVWRGPMASGALSQLLNETDWGELDYLIVDMP 214

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT++QK+P SG VIV+TPQDLAL D ++ I+M+ K+N+P++G+IENMS+++ S
Sbjct: 215 PGTGDIQLTMSQKVPASGTVIVTTPQDLALADAQKGIAMFNKVNVPVLGLIENMSHYICS 274

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
             G+   +FG  GA+  A K G+P L  +P  +D+R  S+ G  I   N  +A S+ Y
Sbjct: 275 HCGEANHVFGKDGAQKLAHKHGVPVLSHIPLAIDIREYSEQGKLIACDN-TAAISKTY 331


>gi|117624318|ref|YP_853231.1| putative ATPase [Escherichia coli APEC O1]
 gi|227887165|ref|ZP_04004970.1| ATPase [Escherichia coli 83972]
 gi|237704572|ref|ZP_04535053.1| mrp protein [Escherichia sp. 3_2_53FAA]
 gi|300818888|ref|ZP_07099093.1| putative protein mrp [Escherichia coli MS 107-1]
 gi|300821784|ref|ZP_07101929.1| putative protein mrp [Escherichia coli MS 119-7]
 gi|300901273|ref|ZP_07119371.1| putative protein mrp [Escherichia coli MS 198-1]
 gi|300902241|ref|ZP_07120239.1| putative protein mrp [Escherichia coli MS 84-1]
 gi|300917050|ref|ZP_07133743.1| putative protein mrp [Escherichia coli MS 115-1]
 gi|300924517|ref|ZP_07140484.1| putative protein mrp [Escherichia coli MS 182-1]
 gi|300936577|ref|ZP_07151484.1| putative protein mrp [Escherichia coli MS 21-1]
 gi|300948208|ref|ZP_07162331.1| putative protein mrp [Escherichia coli MS 116-1]
 gi|300955138|ref|ZP_07167540.1| putative protein mrp [Escherichia coli MS 175-1]
 gi|300978882|ref|ZP_07174395.1| putative protein mrp [Escherichia coli MS 45-1]
 gi|300981630|ref|ZP_07175616.1| putative protein mrp [Escherichia coli MS 200-1]
 gi|301021169|ref|ZP_07185206.1| putative protein mrp [Escherichia coli MS 69-1]
 gi|301305155|ref|ZP_07211254.1| putative protein mrp [Escherichia coli MS 124-1]
 gi|301329301|ref|ZP_07222269.1| putative protein mrp [Escherichia coli MS 78-1]
 gi|309792991|ref|ZP_07687419.1| putative protein mrp [Escherichia coli MS 145-7]
 gi|331642729|ref|ZP_08343864.1| protein mrp [Escherichia coli H736]
 gi|331647761|ref|ZP_08348853.1| protein mrp [Escherichia coli M605]
 gi|331673640|ref|ZP_08374403.1| protein mrp [Escherichia coli TA280]
 gi|331678062|ref|ZP_08378737.1| protein mrp [Escherichia coli H591]
 gi|332278734|ref|ZP_08391147.1| mrp protein [Shigella sp. D9]
 gi|26108894|gb|AAN81097.1|AE016763_56 Mrp protein [Escherichia coli CFT073]
 gi|405896|gb|AAA60527.1| mrp [Escherichia coli]
 gi|13362388|dbj|BAB36342.1| putative ATPase [Escherichia coli O157:H7 str. Sakai]
 gi|91072974|gb|ABE07855.1| putative ATPase [Escherichia coli UTI89]
 gi|115513442|gb|ABJ01517.1| putative ATPase [Escherichia coli APEC O1]
 gi|209747804|gb|ACI72209.1| putative ATPase [Escherichia coli]
 gi|209747806|gb|ACI72210.1| putative ATPase [Escherichia coli]
 gi|209747808|gb|ACI72211.1| putative ATPase [Escherichia coli]
 gi|226900938|gb|EEH87197.1| mrp protein [Escherichia sp. 3_2_53FAA]
 gi|227835515|gb|EEJ45981.1| ATPase [Escherichia coli 83972]
 gi|300307431|gb|EFJ61951.1| putative protein mrp [Escherichia coli MS 200-1]
 gi|300317933|gb|EFJ67717.1| putative protein mrp [Escherichia coli MS 175-1]
 gi|300355270|gb|EFJ71140.1| putative protein mrp [Escherichia coli MS 198-1]
 gi|300398257|gb|EFJ81795.1| putative protein mrp [Escherichia coli MS 69-1]
 gi|300405646|gb|EFJ89184.1| putative protein mrp [Escherichia coli MS 84-1]
 gi|300409515|gb|EFJ93053.1| putative protein mrp [Escherichia coli MS 45-1]
 gi|300415686|gb|EFJ98996.1| putative protein mrp [Escherichia coli MS 115-1]
 gi|300419283|gb|EFK02594.1| putative protein mrp [Escherichia coli MS 182-1]
 gi|300452256|gb|EFK15876.1| putative protein mrp [Escherichia coli MS 116-1]
 gi|300458297|gb|EFK21790.1| putative protein mrp [Escherichia coli MS 21-1]
 gi|300525626|gb|EFK46695.1| putative protein mrp [Escherichia coli MS 119-7]
 gi|300528507|gb|EFK49569.1| putative protein mrp [Escherichia coli MS 107-1]
 gi|300839559|gb|EFK67319.1| putative protein mrp [Escherichia coli MS 124-1]
 gi|300844391|gb|EFK72151.1| putative protein mrp [Escherichia coli MS 78-1]
 gi|308123277|gb|EFO60539.1| putative protein mrp [Escherichia coli MS 145-7]
 gi|315255376|gb|EFU35344.1| putative protein mrp [Escherichia coli MS 85-1]
 gi|315285706|gb|EFU45146.1| putative protein mrp [Escherichia coli MS 110-3]
 gi|315294366|gb|EFU53714.1| putative protein mrp [Escherichia coli MS 153-1]
 gi|315299518|gb|EFU58769.1| putative protein mrp [Escherichia coli MS 16-3]
 gi|324006408|gb|EGB75627.1| putative protein mrp [Escherichia coli MS 57-2]
 gi|324013837|gb|EGB83056.1| putative protein mrp [Escherichia coli MS 60-1]
 gi|324015991|gb|EGB85210.1| putative protein mrp [Escherichia coli MS 117-3]
 gi|331039527|gb|EGI11747.1| protein mrp [Escherichia coli H736]
 gi|331043485|gb|EGI15623.1| protein mrp [Escherichia coli M605]
 gi|331068913|gb|EGI40305.1| protein mrp [Escherichia coli TA280]
 gi|331074522|gb|EGI45842.1| protein mrp [Escherichia coli H591]
 gi|332101086|gb|EGJ04432.1| mrp protein [Shigella sp. D9]
 gi|744212|prf||2014253F ATPase
          Length = 379

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/343 (37%), Positives = 200/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 21  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 80

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 81  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 136

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 137 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 196

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 197 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 256

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 257 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 316

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 317 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 359


>gi|121608676|ref|YP_996483.1| hypothetical protein Veis_1710 [Verminephrobacter eiseniae EF01-2]
 gi|121553316|gb|ABM57465.1| protein of unknown function DUF59 [Verminephrobacter eiseniae
           EF01-2]
          Length = 363

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 125/332 (37%), Positives = 200/332 (60%), Gaps = 4/332 (1%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           +  ++ +L  +  P   ++ V    L  + I    V   + + +     L  LR      
Sbjct: 5   EQSLLAALSCVQDPHAGHDFVSTHALRNLQIQGGDVAFDVELGYPAKSLLPELRRQLVAA 64

Query: 66  IQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACALK 121
            + +  V N  V ++     +  Q+   L   V+  VAVASGKGGVGKSTT  N+A AL 
Sbjct: 65  AKGVAGVGNVSVNISTRVIAHAVQRGVPLLPQVRNIVAVASGKGGVGKSTTAANLALALA 124

Query: 122 NKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMI 181
            +G +V +LDAD+YGPS P +L I  + + +D K ++P ENYG+++MS+  LVD++ AMI
Sbjct: 125 AEGASVGVLDADIYGPSQPMMLGIDRRPDSADGKTMEPLENYGLQVMSIGFLVDQDQAMI 184

Query: 182 WRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLAL 241
           WRGPM   A+  +L    W  LD+L++DMPPGTGD  LT++Q++P++G VIV+TPQD+AL
Sbjct: 185 WRGPMATQALEQLLRQTRWRDLDYLIVDMPPGTGDIQLTLSQRVPMTGAVIVTTPQDIAL 244

Query: 242 IDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVP 301
           +D K+ I M++K+ +PI+G++ENM+  + S  G    +FG  G +  A   GI +L ++P
Sbjct: 245 LDAKKGIRMFEKVGVPILGIVENMAAHICSHCGHLEHIFGADGGKKMAADYGIDYLGALP 304

Query: 302 FDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
            D+ +R+ +D G P VV + +   + IY++++
Sbjct: 305 LDIRIRLQADSGRPTVVADPDGEVARIYKKMA 336


>gi|330502375|ref|YP_004379244.1| hypothetical protein MDS_1461 [Pseudomonas mendocina NK-01]
 gi|328916661|gb|AEB57492.1| hypothetical protein MDS_1461 [Pseudomonas mendocina NK-01]
          Length = 362

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 126/342 (36%), Positives = 202/342 (59%), Gaps = 6/342 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+ + +  +   L+  + P    + V    L E+ I    V + + + +           
Sbjct: 1   MSAVTREAVEACLRQFTDPHLDQDPVSAGCLREVDIQGARVAVRLELGYAAGLFKSGWAQ 60

Query: 61  NAQQIIQNIPTVKNAVV----TLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNI 116
             Q  ++N+  V +A V     +  ++   Q      VK  +AVASGKGGVGKSTT  N+
Sbjct: 61  MLQMALENLDGVDSARVQVDCVIDSHQGQAQVPGLAGVKNVIAVASGKGGVGKSTTAANL 120

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKIS--GKVEISDKKFLKPKENYGIKIMSMASLV 174
           A AL  +G  V ILDAD+YGPS   +  I+   + E+ ++K+  P E +G+++MSMA L 
Sbjct: 121 ALALAREGARVGILDADIYGPSQGIMFGIAEGTRPEVREQKWFVPLEAHGVQVMSMAFLT 180

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
           D+N  M+WRGPMV  A++ ++    W  LD+L++DMPPGTGD  LT+AQK+P++G VIV+
Sbjct: 181 DDNTPMVWRGPMVSGALLQLITQTAWNDLDYLVVDMPPGTGDIQLTLAQKVPVAGSVIVT 240

Query: 235 TPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGI 294
           TPQDLAL+D K+ + M++K++IP++G++ENM+  + S+ G    LFG GG    A + G+
Sbjct: 241 TPQDLALLDAKKGVEMFRKVHIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLAAQYGV 300

Query: 295 PFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             L S+P  M +R+ +D G P  + +  S  + IYQ+++ ++
Sbjct: 301 ELLASLPLSMAIRMQADDGKPTTIADPESQIAMIYQDLARKV 342


>gi|218690178|ref|YP_002398390.1| putative ATPase [Escherichia coli ED1a]
 gi|218427742|emb|CAR08651.2| antiporter inner membrane protein [Escherichia coli ED1a]
          Length = 369

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/343 (37%), Positives = 200/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 11  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 70

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 71  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 126

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 127 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 186

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 187 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 246

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 247 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 306

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 307 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTTIYRQLADRV 349


>gi|301048842|ref|ZP_07195838.1| putative protein mrp [Escherichia coli MS 185-1]
 gi|300299356|gb|EFJ55741.1| putative protein mrp [Escherichia coli MS 185-1]
          Length = 379

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/343 (37%), Positives = 200/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 21  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 80

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 81  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 136

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 137 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLTTNSIGYL 196

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 197 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 256

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 257 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 316

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 317 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 359


>gi|167737605|ref|ZP_02410379.1| putative ATP-binding protein [Burkholderia pseudomallei 14]
          Length = 299

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/241 (47%), Positives = 166/241 (68%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NVK  VAVASGKGGVGKSTT VN+A AL  +G +V +LDAD+YGPS+P +L I  + E  
Sbjct: 33  NVKNIVAVASGKGGVGKSTTAVNLALALAAEGASVGMLDADIYGPSLPTMLGIHERPESP 92

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K + P   +G++  S+  LV E+  M+WRGPM  SA+  +L    W  LD+L++DMPP
Sbjct: 93  DNKSMNPLVGHGLQANSIGFLVGEDNPMVWRGPMATSALEQLLRQTNWRDLDYLIVDMPP 152

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQ++P++G VIV+TPQD+AL+D K+ + M++K+NIPI+G++ENMS  + S+
Sbjct: 153 GTGDIQLTLAQRVPVTGAVIVTTPQDIALLDAKKGLKMFEKVNIPILGIVENMSIHVCSN 212

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG GGA   A + G+  L S+P D+ +R  +D G P V  + +   +E Y+ I
Sbjct: 213 CGHEEHVFGAGGAERMAREYGVAVLGSLPLDIRIREQADSGAPTVAADPHGKLAERYRAI 272

Query: 333 S 333
           +
Sbjct: 273 A 273


>gi|322615181|gb|EFY12103.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322617772|gb|EFY14668.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322624634|gb|EFY21465.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626915|gb|EFY23711.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322634101|gb|EFY30837.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322635708|gb|EFY32418.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322640157|gb|EFY36821.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322646420|gb|EFY42932.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322649388|gb|EFY45824.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322656508|gb|EFY52797.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322661484|gb|EFY57708.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322665628|gb|EFY61812.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322667152|gb|EFY63319.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322671158|gb|EFY67286.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322675201|gb|EFY71278.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322680810|gb|EFY76845.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322686985|gb|EFY82962.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323192749|gb|EFZ77976.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323198819|gb|EFZ83918.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323205171|gb|EFZ90149.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323208214|gb|EFZ93158.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323210976|gb|EFZ95837.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323215761|gb|EGA00504.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323220693|gb|EGA05139.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323224685|gb|EGA08957.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323231206|gb|EGA15321.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323233641|gb|EGA17733.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323237711|gb|EGA21771.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323245694|gb|EGA29688.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323248942|gb|EGA32866.1| antiporter inner membrane protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323252987|gb|EGA36820.1| antiporter inner membrane protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323258663|gb|EGA42325.1| antiporter inner membrane protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323259495|gb|EGA43130.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323268278|gb|EGA51753.1| antiporter inner membrane protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323271932|gb|EGA55348.1| antiporter inner membrane protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 369

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 199/341 (58%), Gaps = 13/341 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+     
Sbjct: 13  LRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVEVVMPFVWNSAFEVLKEQCSA 72

Query: 65  IIQNIPTVKNA-------VVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVVNI 116
            +  I   K         + TL   KN P     +N VK  +AV+SGKGGVGKS+T VN+
Sbjct: 73  DLLRITGAKAIDWKLSYNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAVNL 128

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVD 175
           A AL  +G  V +LDAD+YGPSIP +L    +   S D   + P  ++G+   S+  LV 
Sbjct: 129 ALALAAEGAKVGVLDADIYGPSIPTMLGAEDQRPTSPDGTHMAPIMSHGLATNSIGYLVT 188

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
           ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+T
Sbjct: 189 DDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTT 248

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK    
Sbjct: 249 PQDIALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAQKLAEKYHTQ 308

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            L  +P  + +R   D G P VV    S  + IY+E++DR+
Sbjct: 309 LLGQMPLHISLREDLDRGTPTVVSRPESEFTAIYRELADRV 349


>gi|118591781|ref|ZP_01549177.1| Mrp/NBP35 family protein [Stappia aggregata IAM 12614]
 gi|118435774|gb|EAV42419.1| Mrp/NBP35 family protein [Stappia aggregata IAM 12614]
          Length = 369

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 110/241 (45%), Positives = 165/241 (68%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            + + +AVASGKGGVGKST   N+ACAL  +G+ V +LDADVYGPS PK+L ISG+    
Sbjct: 120 GIDRVIAVASGKGGVGKSTVAANLACALAAEGRKVGLLDADVYGPSQPKMLGISGRPTSP 179

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D + + P  N+G+ +MS+  +   + A+ WRGPM+  A+  M+  V WG LD L++D+PP
Sbjct: 180 DGQMILPLRNHGVTMMSIGLMTSGDEAVAWRGPMLMGALQQMMTQVQWGALDVLIVDLPP 239

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  +T+ QK  + G +IVSTPQD+ALID ++ ISM+ +M +P+IGMIENMS  + S+
Sbjct: 240 GTGDVQMTLCQKFAVDGAIIVSTPQDVALIDARKGISMFNQMQVPLIGMIENMSTHICSN 299

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG+GG   EAEK+G+P L  VP  +++R+  D G PI +    +  + +++++
Sbjct: 300 CGHEEHVFGHGGVAEEAEKLGVPLLAEVPLHLNIRLAGDGGTPIAIKTPEAPEASVFRQL 359

Query: 333 S 333
           +
Sbjct: 360 A 360


>gi|326334798|ref|ZP_08201003.1| mrp/Nbp35 family ATP-binding protein [Capnocytophaga sp. oral taxon
           338 str. F0234]
 gi|325693047|gb|EGD34981.1| mrp/Nbp35 family ATP-binding protein [Capnocytophaga sp. oral taxon
           338 str. F0234]
          Length = 378

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 208/344 (60%), Gaps = 15/344 (4%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           ILK+Q++++L+ ++ PGE  N+++   +  I I  + V + +T+ +      + +     
Sbjct: 3   ILKSQVIEALRKITSPGEGGNLIDTGVVKNIVIFGDEVVVDVTISNPTLQAKKKIEVEIM 62

Query: 64  QIIQNIPTVKNAV-VTLTENKNPPQQRNNL------NVKKFVAVASGKGGVGKSTTVVNI 116
           + I      K  V V +T    P  ++N +       ++  +AVASGKGGVGKST   N+
Sbjct: 63  KAIHAEVHEKAKVKVNITVEAAPTVEKNEIKGKPIEGIRNIIAVASGKGGVGKSTITANL 122

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGK----VEISDKKFLKPKENYGIKIMSMAS 172
           A AL+  G  V +LDAD+YGPSIP +  +  +    V+I  +  ++P ENYG+KI+S+  
Sbjct: 123 AIALRKMGFKVGLLDADIYGPSIPMMFDVQEQRPVSVDIEGRSKMEPVENYGVKILSIGF 182

Query: 173 LVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVI 232
               + A+IWRGPM   A+  M+ +  WG+LDFLLID+PPGTGD HL+I Q +P++G ++
Sbjct: 183 FTHPDQAVIWRGPMASKALNQMIFDAHWGELDFLLIDLPPGTGDIHLSIMQALPITGAIV 242

Query: 233 VSTPQDLALIDVKRAISMYQK--MNIPIIGMIENMSYFLASDTGK-KYDLFGNGGARFEA 289
           VSTPQ++AL D ++ I+M+++  +N+P++G++ENM+YF  ++  + KY +FG  G +  A
Sbjct: 243 VSTPQNVALADARKGIAMFRQETINVPVLGLVENMAYFTPAELPENKYYIFGKEGVKSLA 302

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           E+   P L  +P    +R   D+G P  +    +  ++ ++E++
Sbjct: 303 ERTDTPLLGEIPLVQSLRESGDVGRPAALQE-GTPLAKAFEELA 345


>gi|53802761|ref|YP_112592.1| mrP protein [Methylococcus capsulatus str. Bath]
 gi|53756522|gb|AAU90813.1| mrP protein [Methylococcus capsulatus str. Bath]
          Length = 361

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 168/244 (68%), Gaps = 1/244 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            V+  +AVASGKGGVGKSTT VN+A AL  +G  V ILDAD++GPS P +L +SG+ E  
Sbjct: 96  GVRNIIAVASGKGGVGKSTTAVNLALALAGEGARVGILDADIHGPSQPLMLGVSGRPETE 155

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
            +K + P   +G++ MS+  L+DE+  MIWRGPMV  A+  +L++ +W  LD+L++D+PP
Sbjct: 156 GRK-IHPIVAHGLQSMSIGYLIDEDTPMIWRGPMVVGALQQLLNDTLWEDLDYLIVDLPP 214

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  L++AQ+IP+SG VIV+TPQD+AL+D ++ + M++K++IP++G+IENMS  + S 
Sbjct: 215 GTGDIQLSLAQQIPVSGAVIVTTPQDIALLDAQKGLKMFEKVSIPVLGIIENMSVHVCSR 274

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    +FG GG    A+K G   L  +P D  +R  +D G P V+   +S  + +Y+ I
Sbjct: 275 CGHAEPIFGEGGGEKMAQKYGTELLGQLPLDRSIREDADGGRPTVIAAPDSEPARMYRSI 334

Query: 333 SDRI 336
           + ++
Sbjct: 335 ARKV 338


>gi|167718576|ref|ZP_02401812.1| putative ATP-binding protein [Burkholderia pseudomallei DM98]
          Length = 278

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/241 (47%), Positives = 166/241 (68%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NVK  VAVASGKGGVGKSTT VN+A AL  +G +V +LDAD+YGPS+P +L I  + E  
Sbjct: 12  NVKNIVAVASGKGGVGKSTTAVNLALALAAEGASVGMLDADIYGPSLPTMLGIHERPESP 71

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K + P   +G++  S+  LV E+  M+WRGPM  SA+  +L    W  LD+L++DMPP
Sbjct: 72  DNKSMNPLVGHGLQANSIGFLVGEDNPMVWRGPMATSALEQLLRQTNWRDLDYLIVDMPP 131

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQ++P++G VIV+TPQD+AL+D K+ + M++K+NIPI+G++ENMS  + S+
Sbjct: 132 GTGDIQLTLAQRVPVTGAVIVTTPQDIALLDAKKGLKMFEKVNIPILGIVENMSIHVCSN 191

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG GGA   A + G+  L S+P D+ +R  +D G P V  + +   +E Y+ I
Sbjct: 192 CGHEEHVFGAGGAERMAREYGVAVLGSLPLDIRIREQADSGAPTVAADPHGKLAERYRAI 251

Query: 333 S 333
           +
Sbjct: 252 A 252


>gi|75910277|ref|YP_324573.1| hypothetical protein Ava_4074 [Anabaena variabilis ATCC 29413]
 gi|75704002|gb|ABA23678.1| Protein of unknown function DUF59 [Anabaena variabilis ATCC 29413]
          Length = 336

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 127/333 (38%), Positives = 203/333 (60%), Gaps = 19/333 (5%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           + ++V+ LK +  P  KN+IV +  +  + IV + VYL + +    +HQ Q L++  +  
Sbjct: 10  QQEVVELLKQVIEPNLKNDIVSLGMVRNLRIVDDYVYLRLYIG---SHQ-QQLQTEVEAK 65

Query: 66  IQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGK 125
           +  +   K   + +              VK  + ++SGKGGVGKSTT VNIA AL  +G 
Sbjct: 66  LSALSWCKKTYIQICTIPG---------VKITLGISSGKGGVGKSTTAVNIAAALSLQGA 116

Query: 126 NVAILDADVYGPSIPKLLKIS-GKVEI----SDKKFLKPKENYGIKIMSMASLVDENVAM 180
            V +LDADVYGP++P++L +    VE+    + +KFL P E  GIK+MS+  L +EN  +
Sbjct: 117 KVGLLDADVYGPNVPQMLGLGQADVEVIQTPTGEKFL-PLEVQGIKLMSVGLLAEENRPL 175

Query: 181 IWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLA 240
            WRGP++   I   +++V WG+LD+LLID+PPGTGDA +TI Q+ P+ GV++V+TPQ +A
Sbjct: 176 AWRGPVLHKIITQFINDVEWGELDYLLIDLPPGTGDAQITIIQESPICGVILVTTPQQVA 235

Query: 241 LIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESV 300
           + DV+R I M++++ +P++G++ENMSY +  D G +  +FG+GG    A ++  P L  +
Sbjct: 236 VADVRRNIYMFRQVGVPVLGIVENMSYLICGDCGSRTYIFGSGGGEQLATELQAPLLGQI 295

Query: 301 PFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
           P D  +    D G PI +    S  SE+++ I+
Sbjct: 296 PIDQRICSGGDSGNPIAISEQTSPASEVFRNIA 328


>gi|228472138|ref|ZP_04056904.1| ATP-binding protein, Mrp/Nbp35 family [Capnocytophaga gingivalis
           ATCC 33624]
 gi|228276341|gb|EEK15065.1| ATP-binding protein, Mrp/Nbp35 family [Capnocytophaga gingivalis
           ATCC 33624]
          Length = 378

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 124/331 (37%), Positives = 197/331 (59%), Gaps = 14/331 (4%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           ILK Q++++L+ ++ PGE  N+++   +  I +  + V +  T+ +      + +     
Sbjct: 3   ILKAQVIEALRKITSPGEGGNLIDAGVVKNIVVFGDEVVVDATISNPSLQAKKKVEVEIM 62

Query: 64  QIIQNIPTVKNAV-VTLTENKNPPQQRNNL------NVKKFVAVASGKGGVGKSTTVVNI 116
           + I      K  V V +T    P  Q N +       +K  +AVASGKGGVGKST   N+
Sbjct: 63  KAIHAEVYEKAKVKVNITVEVAPTSQTNEIKGKPIEGIKNIIAVASGKGGVGKSTVTANL 122

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGK----VEISDKKFLKPKENYGIKIMSMAS 172
           A AL+  G  V +LDAD+YGPSIP +  +  +    VEI  +  +KP ENYG+KI+S+  
Sbjct: 123 AVALRKMGFKVGLLDADIYGPSIPMMFDVQEERPISVEIDGRSKMKPVENYGVKILSIGF 182

Query: 173 LVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVI 232
               + A+IWRGPM   A+  M+ +  WG+LDFLLID+PPGTGD HL+I Q +P++G ++
Sbjct: 183 FTHPDQAVIWRGPMASKALNQMIFDADWGELDFLLIDLPPGTGDIHLSIMQALPITGAIV 242

Query: 233 VSTPQDLALIDVKRAISMYQK--MNIPIIGMIENMSYFLASDTGK-KYDLFGNGGARFEA 289
           VSTPQ++AL D ++ I+M+++  +N+P++G++ENM+YF  ++  + KY +FG  G +  A
Sbjct: 243 VSTPQNVALADARKGIAMFRQETINVPVLGLVENMAYFTPAELPQNKYYIFGKEGVKSLA 302

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHN 320
           E+   P L  +P    +R   D+G P  +  
Sbjct: 303 ERTDTPLLGEIPLVQSLRESGDVGRPAALQE 333


>gi|152987251|ref|YP_001347029.1| hypothetical protein PSPA7_1645 [Pseudomonas aeruginosa PA7]
 gi|150962409|gb|ABR84434.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 364

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 127/342 (37%), Positives = 202/342 (59%), Gaps = 6/342 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+ I +  +  +L+    P    + V    L E+ I  + V + + + +           
Sbjct: 1   MSAITRQTVEATLRQYQDPYLNQDPVSAGCLREVEIHGDRVRVRLELGYAAGLFRNGWAQ 60

Query: 61  NAQQIIQNIPTVKNAVV----TLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNI 116
             Q  ++ +  V  A V     +  +K  PQ     NVK  VAVASGKGGVGKSTT  N+
Sbjct: 61  TLQMALEALDGVGRAEVQVDCVIQSHKAQPQVEVMGNVKNIVAVASGKGGVGKSTTAANL 120

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGIKIMSMASLV 174
           A AL  +G  V ILDAD+YGPS   +  +    + ++ ++K+ +P + +G+++MSMA L 
Sbjct: 121 ALALAREGARVGILDADIYGPSQGIMFGLPEGTRPKVREQKWFEPLQAHGVQVMSMAFLT 180

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
           D++  ++WRGPMV  A++ ++    W  LD+L++DMPPGTGD  LT+AQK+P++G VIV+
Sbjct: 181 DDSTPVVWRGPMVSGALIQLITQTAWDNLDYLVVDMPPGTGDIQLTLAQKVPVAGAVIVT 240

Query: 235 TPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGI 294
           TPQDLAL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A + G+
Sbjct: 241 TPQDLALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLAAQFGV 300

Query: 295 PFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             L S+P  + +R  +D G P V+ +  S  + +YQEI+  +
Sbjct: 301 ELLASMPLSIAIRTQADSGRPTVIADPESQLAMLYQEIARHV 342


>gi|260427875|ref|ZP_05781854.1| Mrp/NBP35 family protein [Citreicella sp. SE45]
 gi|260422367|gb|EEX15618.1| Mrp/NBP35 family protein [Citreicella sp. SE45]
          Length = 354

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/339 (38%), Positives = 206/339 (60%), Gaps = 19/339 (5%)

Query: 13  LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPH-TIAHQLQSLRSNAQQIIQNIPT 71
           L  L +PG   +++    +  + +  + V   I  P   +A Q++ LR+ A++ + ++P 
Sbjct: 12  LARLELPG-GGDLISRDMIRALSVDGDAVRFVIEAPSPEMARQMEPLRAAAERAVASLPG 70

Query: 72  VKNAVVTLTEN----KNP---------PQQR--NNLNVKKFVAVASGKGGVGKSTTVVNI 116
           V+   V LT +    K P         PQ+   N   VK  +A+ SGKGGVGKST   N+
Sbjct: 71  VRTVSVALTAHGPAAKAPSLKIGGHAKPQEGKMNPPGVKTVIAIGSGKGGVGKSTVSSNL 130

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           A AL   GK V +LDAD++GPS P++  IS +    D K + P + +G+ +MS+  ++ E
Sbjct: 131 AVALARAGKKVGLLDADIHGPSQPRMFGISKRPASPDGKTIIPLKAHGVTLMSIGFMLPE 190

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           + A++WRGPM+  A+  M+  V WG+LD LLID+PPGTGD  L++ QK  L+G ++VSTP
Sbjct: 191 DKAVVWRGPMLMGALQQMMMQVEWGELDVLLIDLPPGTGDVQLSLGQKSELAGAIVVSTP 250

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QD+A+ID K+A+  +Q +N+P++G+IENMS ++  D G +  LFG GG   EAE++G+P 
Sbjct: 251 QDVAMIDAKKALDAFQTLNVPVLGLIENMSLYICPDCGHEAHLFGQGGVAAEAERLGLPV 310

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
           L  +P D++ R+  D G P+ +   +   ++ Y  ++DR
Sbjct: 311 LAQLPIDLETRIGGDAGTPVALG--DGVMAQAYATLADR 347


>gi|53718642|ref|YP_107628.1| putative ATP-binding protein [Burkholderia pseudomallei K96243]
 gi|53725211|ref|YP_102482.1| ParA family protein [Burkholderia mallei ATCC 23344]
 gi|67639752|ref|ZP_00438588.1| Mrp protein [Burkholderia mallei GB8 horse 4]
 gi|121599258|ref|YP_993610.1| ParA family protein [Burkholderia mallei SAVP1]
 gi|124385103|ref|YP_001028929.1| ParA family protein [Burkholderia mallei NCTC 10229]
 gi|126440995|ref|YP_001058105.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 668]
 gi|126448539|ref|YP_001081158.1| ParA family protein [Burkholderia mallei NCTC 10247]
 gi|126452577|ref|YP_001065341.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 1106a]
 gi|134281196|ref|ZP_01767905.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 305]
 gi|167003045|ref|ZP_02268835.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia mallei
           PRL-20]
 gi|167814739|ref|ZP_02446419.1| putative ATP-binding protein [Burkholderia pseudomallei 91]
 gi|167844757|ref|ZP_02470265.1| putative ATP-binding protein [Burkholderia pseudomallei B7210]
 gi|167893291|ref|ZP_02480693.1| putative ATP-binding protein [Burkholderia pseudomallei 7894]
 gi|167901749|ref|ZP_02488954.1| putative ATP-binding protein [Burkholderia pseudomallei NCTC 13177]
 gi|167909988|ref|ZP_02497079.1| putative ATP-binding protein [Burkholderia pseudomallei 112]
 gi|167918021|ref|ZP_02505112.1| putative ATP-binding protein [Burkholderia pseudomallei BCC215]
 gi|237811324|ref|YP_002895775.1| ParA family protein [Burkholderia pseudomallei MSHR346]
 gi|242316230|ref|ZP_04815246.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 1106b]
 gi|254178643|ref|ZP_04885298.1| ParA family protein [Burkholderia mallei ATCC 10399]
 gi|254181402|ref|ZP_04887999.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 1655]
 gi|254196460|ref|ZP_04902884.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei S13]
 gi|254199386|ref|ZP_04905752.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia mallei
           FMH]
 gi|254205700|ref|ZP_04912052.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia mallei
           JHU]
 gi|254357861|ref|ZP_04974134.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia mallei
           2002721280]
 gi|52209056|emb|CAH34996.1| putative ATP-binding protein [Burkholderia pseudomallei K96243]
 gi|52428634|gb|AAU49227.1| ParA family protein [Burkholderia mallei ATCC 23344]
 gi|121228068|gb|ABM50586.1| ParA family protein [Burkholderia mallei SAVP1]
 gi|124293123|gb|ABN02392.1| ParA family protein [Burkholderia mallei NCTC 10229]
 gi|126220488|gb|ABN83994.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 668]
 gi|126226219|gb|ABN89759.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 1106a]
 gi|126241409|gb|ABO04502.1| ParA family protein [Burkholderia mallei NCTC 10247]
 gi|134247502|gb|EBA47587.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 305]
 gi|147748982|gb|EDK56056.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia mallei
           FMH]
 gi|147753143|gb|EDK60208.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia mallei
           JHU]
 gi|148026988|gb|EDK85009.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia mallei
           2002721280]
 gi|160699682|gb|EDP89652.1| ParA family protein [Burkholderia mallei ATCC 10399]
 gi|169653203|gb|EDS85896.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei S13]
 gi|184211940|gb|EDU08983.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 1655]
 gi|237505876|gb|ACQ98194.1| ParA family protein [Burkholderia pseudomallei MSHR346]
 gi|238520350|gb|EEP83811.1| Mrp protein [Burkholderia mallei GB8 horse 4]
 gi|242139469|gb|EES25871.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 1106b]
 gi|243061350|gb|EES43536.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia mallei
           PRL-20]
          Length = 362

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/241 (47%), Positives = 166/241 (68%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NVK  VAVASGKGGVGKSTT VN+A AL  +G +V +LDAD+YGPS+P +L I  + E  
Sbjct: 96  NVKNIVAVASGKGGVGKSTTAVNLALALAAEGASVGMLDADIYGPSLPTMLGIHERPESP 155

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K + P   +G++  S+  LV E+  M+WRGPM  SA+  +L    W  LD+L++DMPP
Sbjct: 156 DNKSMNPLVGHGLQANSIGFLVGEDNPMVWRGPMATSALEQLLRQTNWRDLDYLIVDMPP 215

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQ++P++G VIV+TPQD+AL+D K+ + M++K+NIPI+G++ENMS  + S+
Sbjct: 216 GTGDIQLTLAQRVPVTGAVIVTTPQDIALLDAKKGLKMFEKVNIPILGIVENMSIHVCSN 275

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG GGA   A + G+  L S+P D+ +R  +D G P V  + +   +E Y+ I
Sbjct: 276 CGHEEHVFGAGGAERMAREYGVAVLGSLPLDIRIREQADSGAPTVAADPHGKLAERYRAI 335

Query: 333 S 333
           +
Sbjct: 336 A 336


>gi|254431518|ref|ZP_05045221.1| ATPase [Cyanobium sp. PCC 7001]
 gi|197625971|gb|EDY38530.1| ATPase [Cyanobium sp. PCC 7001]
          Length = 367

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 109/248 (43%), Positives = 168/248 (67%), Gaps = 5/248 (2%)

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV-EIS 152
           VK+ +AV+SGKGGVGKST  VN+ACAL   G  V +LDAD+YGP+ P +L ++ +  E+S
Sbjct: 112 VKQVIAVSSGKGGVGKSTVAVNLACALARSGLRVGLLDADIYGPNAPTMLGVADRTPEVS 171

Query: 153 DK---KFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID 209
            +   + L+P E  GI ++SM  L+ EN  +IWRGPM+   I   L+ V WGQ D +++D
Sbjct: 172 GEGASQELQPIETCGIAMVSMGLLIAENQPVIWRGPMLNGIIRQFLYQVAWGQRDVVVVD 231

Query: 210 MPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFL 269
           +PPGTGDA LT+AQ +P++GV++V+TPQ+++L D +R ++M+ +M +P++G++ENMS F+
Sbjct: 232 LPPGTGDAQLTLAQAVPMAGVIVVTTPQEVSLADARRGLAMFLQMGVPVLGVVENMSGFI 291

Query: 270 ASDTGKK-YDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEI 328
             D   K Y +FG GG    A + G+P L  +P +M VR   D G P+V+    SAT+  
Sbjct: 292 PPDAPDKLYPIFGQGGGERLAREAGVPLLAELPLEMPVREAGDGGRPVVLTAPESATARG 351

Query: 329 YQEISDRI 336
           +  ++ ++
Sbjct: 352 FMALAGKV 359


>gi|205353292|ref|YP_002227093.1| ATPase [Salmonella enterica subsp. enterica serovar Gallinarum str.
           287/91]
 gi|205273073|emb|CAR38025.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326628381|gb|EGE34724.1| mrp protein [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 9]
          Length = 369

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 199/341 (58%), Gaps = 13/341 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+     
Sbjct: 13  LRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWNSAFEVLKEQCSA 72

Query: 65  IIQNIPTVKNA-------VVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVVNI 116
            +  I   K         + TL   KN P     +N VK  +AV+SGKGGVGKS+T VN+
Sbjct: 73  DLLRIAGAKAIDWKLSYNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAVNL 128

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVD 175
           A AL  +G  V +LDAD+YGPSIP +L    +   S D   + P  ++G+   S+  LV 
Sbjct: 129 ALALAAEGAKVGVLDADIYGPSIPTMLGAEDQRPTSPDGTHMAPIMSHGLATNSIGYLVT 188

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
           ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+T
Sbjct: 189 DDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTT 248

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK    
Sbjct: 249 PQDIALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAQKLAEKYHTQ 308

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            L  +P  + +R   D G P VV    S  + IY+E++DR+
Sbjct: 309 LLGQMPLHISLREDLDRGTPTVVSRPESEFTAIYRELADRV 349


>gi|307109013|gb|EFN57252.1| hypothetical protein CHLNCDRAFT_34906 [Chlorella variabilis]
          Length = 307

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 182/278 (65%), Gaps = 3/278 (1%)

Query: 63  QQIIQNIPTVKNAVVTLTENKNPPQQRNNL-NVKKFVAVASGKGGVGKSTTVVNIACALK 121
           + +++  P +    +  +    P   R  +  V+  +AVASGKGGVGKSTT VN+A AL 
Sbjct: 7   RSLLEECPRLLLPALARSYAAGPGAARLGIPGVQHIIAVASGKGGVGKSTTAVNLAVALA 66

Query: 122 NK-GKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAM 180
            + G  V +LDADVYGPSIP+++ +SGK  + + + + P  N+G+  MSM  L++E+VA 
Sbjct: 67  QRLGLRVGLLDADVYGPSIPRMMCLSGKPRVDEDEKMIPLINHGVACMSMGFLMEEDVAA 126

Query: 181 IWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLA 240
           +WRGPMV SA+   +H V W  LD L+IDMPPGTGDA L+I+Q++ LSG VIVSTPQ   
Sbjct: 127 VWRGPMVMSALETFMHRVRWAPLDVLVIDMPPGTGDAQLSISQRLRLSGAVIVSTPQA-T 185

Query: 241 LIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESV 300
           L+D +R  +M++K+N+PI+G++ENMS+F+    G +   FG+GGA   A  + +  L  +
Sbjct: 186 LLDARRGCTMFRKVNVPILGIVENMSWFICGACGHESHPFGSGGAEKAAADLDMEVLGKI 245

Query: 301 PFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
           P ++ +R  SD+G PIV    +S+ +  Y  +++R+ Q
Sbjct: 246 PLNIAIRETSDVGAPIVATQPDSSAAAAYVSVAERVWQ 283


>gi|193062827|ref|ZP_03043920.1| mrp protein [Escherichia coli E22]
 gi|194428870|ref|ZP_03061404.1| mrp protein [Escherichia coli B171]
 gi|260844720|ref|YP_003222498.1| antiporter inner membrane protein Mrp [Escherichia coli O103:H2
           str. 12009]
 gi|192931470|gb|EDV84071.1| mrp protein [Escherichia coli E22]
 gi|194413038|gb|EDX29326.1| mrp protein [Escherichia coli B171]
 gi|257759867|dbj|BAI31364.1| antiporter inner membrane protein Mrp [Escherichia coli O103:H2
           str. 12009]
 gi|323161832|gb|EFZ47711.1| protein mrp [Escherichia coli E128010]
          Length = 369

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/343 (37%), Positives = 200/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 11  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 70

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 71  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 126

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 127 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIVSHGLATNSIGYL 186

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 187 VTDDNAMVWRGPMASKALMQMLQETLWPGLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 246

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 247 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 306

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 307 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 349


>gi|307257046|ref|ZP_07538821.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|306864417|gb|EFM96325.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
          Length = 365

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 131/347 (37%), Positives = 201/347 (57%), Gaps = 14/347 (4%)

Query: 1   MNQILKNQIVD---SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS 57
           MNQ+ + Q+ +    L+  + P  + +++ +    +  +    + L +T+P         
Sbjct: 1   MNQLNEQQLSEIKFVLQNFTHPTLQKDLIALNVFKKAELGAGILRLELTMPFAWNSGFAV 60

Query: 58  LRSNAQQIIQNIPTVKNA-------VVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKS 110
           L++  +  ++ +             + TL    N P       VK  +AV SGKGGVGKS
Sbjct: 61  LKTETEAQLKQVTGASEVKWILNYQIATLKRANNHPAVNG---VKNIIAVTSGKGGVGKS 117

Query: 111 TTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMS 169
           TT VN+A ALK +G  V ILDAD+YGPSIP +L    +   S D K + P E YGI+  S
Sbjct: 118 TTSVNLALALKAQGAKVGILDADIYGPSIPHMLGAQDQRPTSPDNKHITPIEVYGIQSNS 177

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           +  L+ ++ A IWRGPM  SA+  +L+   W +LD+L+IDMPPGTGD  LT++Q+IP++G
Sbjct: 178 IGYLMADDNATIWRGPMASSALSQLLNETWWTELDYLVIDMPPGTGDIQLTLSQQIPVTG 237

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEA 289
            V+V+TPQD+AL+D  + ISM+QK+++P++G+IENMS  +  + G   D+FG GGA   A
Sbjct: 238 AVVVTTPQDIALLDAVKGISMFQKVSVPVLGIIENMSVHICQNCGHHEDIFGTGGAEKVA 297

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +K G   L  +P  + +R   D G P VV      TS+ Y E++ ++
Sbjct: 298 KKYGTKVLGQMPLHIRLRQDLDAGTPTVVAAPEHETSQAYIELAAKV 344


>gi|302343332|ref|YP_003807861.1| ATPase-like, ParA/MinD [Desulfarculus baarsii DSM 2075]
 gi|301639945|gb|ADK85267.1| ATPase-like, ParA/MinD [Desulfarculus baarsii DSM 2075]
          Length = 353

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 127/346 (36%), Positives = 203/346 (58%), Gaps = 11/346 (3%)

Query: 2   NQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSN 61
            +IL   ++++LK +  PG   +IV M  + E  +      + +      A   + L   
Sbjct: 5   ERILDPDLLEALKQVKYPGFDADIVAMGLVLEARVEDGKAVVLMRPVAAPAKVREDLEDA 64

Query: 62  AQQIIQNIPTVKNAVVTLTENKNPPQQ-----RNNLNVKKFVAVASGKGGVGKSTTVVNI 116
               I ++P V+   + + E   P  Q     R    VK  V VASGKGGVGKST  VN+
Sbjct: 65  IAAQIGSLPGVRELELNMPEPPQPKAQQKQGPRPIPGVKAIVPVASGKGGVGKSTVSVNL 124

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGK--VEISDKKFLKPKENYGIKIMSMASLV 174
           A AL   G  V +LD D+YGPSIP +L + G    +  D K + P E  G+K++S+  L+
Sbjct: 125 ALALAEMGLKVGLLDLDLYGPSIPIMLGLQGAQPSQGRDNK-IAPVEARGLKVLSIGFLI 183

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
             + A+IWRGP+V  A+  +LH   WG+LD L++D+PPGTGD  +T+ Q+ P++G V+V+
Sbjct: 184 GADRALIWRGPLVMKAVRQLLHEADWGELDALILDLPPGTGDVQITMTQETPITGAVVVT 243

Query: 235 TPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGI 294
           TPQD+AL D  RA+ M++++N  ++G++ENMSYF+  D G ++++FG+G     ++K+G+
Sbjct: 244 TPQDVALADAIRAVDMFKQVNAKVLGIVENMSYFICPDCGGRHEIFGHGSVEPLSQKLGV 303

Query: 295 PFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFF 340
           PFL  +P D DV  L+D G   V     + ++E Y++I+ ++ +  
Sbjct: 304 PFLGELPLDPDVPKLADHGQAAV---QAAGSAEAYRQIAVKVARML 346


>gi|311278895|ref|YP_003941126.1| ATPase-like, ParA/MinD [Enterobacter cloacae SCF1]
 gi|308748090|gb|ADO47842.1| ATPase-like, ParA/MinD [Enterobacter cloacae SCF1]
          Length = 369

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 125/341 (36%), Positives = 199/341 (58%), Gaps = 11/341 (3%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           +L+  +  +L     P  K+N+  ++ L  +  + +TV++ + +P       + L+    
Sbjct: 12  VLRAMVAGTLANFQHPTLKHNLTALKALHHVAWLDDTVHIELQMPFAWHSAFEELKEQCS 71

Query: 64  QIIQNIP-------TVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNI 116
             +  I         + +++ TL   KN P       VK  +AV+SGKGGVGKS+T VN+
Sbjct: 72  ADLLRITGASAIDWRLTHSIATLKRVKNQPGVNG---VKNIIAVSSGKGGVGKSSTAVNL 128

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVD 175
           A AL  +G  V ILDAD+YGPSIP +L   G    S D   + P   YG+   S+  LV 
Sbjct: 129 ALALAAEGAKVGILDADIYGPSIPMMLGAEGSRPTSPDGTHMAPIMKYGLATNSIGYLVT 188

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
           ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G ++V+T
Sbjct: 189 DDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGALVVTT 248

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   A++    
Sbjct: 249 PQDVALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAERLAQQYHTQ 308

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            L  +P  +++R   D G P V+   +S  + +Y++++ R+
Sbjct: 309 LLGQMPLHINLREDLDRGTPTVIARPDSEFTTLYRQLAGRV 349


>gi|307245910|ref|ZP_07527993.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|307254883|ref|ZP_07536705.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307259324|ref|ZP_07541051.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|306853129|gb|EFM85351.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|306862124|gb|EFM94096.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306866560|gb|EFM98421.1| Protein mrp [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
          Length = 365

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 130/347 (37%), Positives = 202/347 (58%), Gaps = 14/347 (4%)

Query: 1   MNQILKNQIVDS---LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS 57
           MNQ+ + Q+ +    L+  + P  + +++ +    +  +    + L  T+P       ++
Sbjct: 1   MNQLNEQQLSEIKFILQNFTHPTLQKDLIALNAFKKAELGAGILRLEFTMPFAWNSGFEA 60

Query: 58  LRSNAQQIIQNIPTVKNA-------VVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKS 110
           L+++ +  ++ +             + TL    N P       VK  +AV SGKGGVGKS
Sbjct: 61  LKADTEVKLKQVTGANEVKWILNYQIATLKRANNHPAVNG---VKNIIAVTSGKGGVGKS 117

Query: 111 TTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMS 169
           TT VN+A ALK +G  V ILDAD+YGPSIP +L    +   S D K + P E YG++  S
Sbjct: 118 TTSVNLALALKAQGAKVGILDADIYGPSIPHMLGAQDQRPTSPDNKHITPIEVYGLQSNS 177

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           +  L+ ++ A IWRGPM  SA+  +L+   W +LD+L+IDMPPGTGD  LT++Q+IP++G
Sbjct: 178 IGYLMADDNATIWRGPMASSALSQLLNETWWTELDYLVIDMPPGTGDIQLTLSQQIPVTG 237

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEA 289
            V+V+TPQD+AL+D  + ISM+QK+++P++G+IENMS  +  + G   D+FG GGA   A
Sbjct: 238 AVVVTTPQDIALLDAVKGISMFQKVSVPVLGIIENMSVHICQNCGHHEDIFGTGGAEKVA 297

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +K G   L  +P  + +R   D G P VV      TS  Y E++ ++
Sbjct: 298 KKYGTKVLGQMPLHIRLRQDLDAGTPTVVAAPEHETSRAYIELAAKV 344


>gi|94498898|ref|ZP_01305436.1| ATPase involved in chromosome partitioning [Oceanobacter sp. RED65]
 gi|94428530|gb|EAT13502.1| ATPase involved in chromosome partitioning [Oceanobacter sp. RED65]
          Length = 361

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 125/288 (43%), Positives = 179/288 (62%), Gaps = 10/288 (3%)

Query: 56  QSLRSNAQQIIQ----NIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGV 107
           + L++  +Q++Q    NI  + +A VT+    +  +   NL    NVK  +AVASGKGGV
Sbjct: 51  EYLKAGIEQMLQIALENIEGIDSAEVTIDWAVSSHKAHENLPNIANVKNIIAVASGKGGV 110

Query: 108 GKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI--SGKVEISDKKFLKPKENYGI 165
           GKSTT VN+A AL   G  V ILDAD+YGPS+  +L +    + E  D K+ KP    GI
Sbjct: 111 GKSTTSVNLALALAEDGAKVGILDADIYGPSVGMMLGMPEGTRPETVDDKYFKPVIAKGI 170

Query: 166 KIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKI 225
           + MSMA LV +   M+WRGPMV  A+  ++   +W  LD+L+IDMPPGTGD  LT++QK+
Sbjct: 171 QSMSMAYLVTDKTPMVWRGPMVSGALQQLITQTMWDDLDYLIIDMPPGTGDIQLTLSQKV 230

Query: 226 PLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGA 285
           P+S  V+V+TPQD+AL+D K+ I M++K+NIP++G+IENMS  + S+ G    +FG  GA
Sbjct: 231 PVSASVVVTTPQDIALLDAKKGIEMFRKVNIPVLGIIENMSIHICSNCGHAEHIFGEAGA 290

Query: 286 RFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
              A +     L S+P    +R  SD+G P V H+  S    +Y+  +
Sbjct: 291 EQIAAEYNTELLGSLPLSKYIREQSDIGEPPVAHDPASEVGMMYRHCA 338


>gi|30063550|ref|NP_837721.1| putative ATPase [Shigella flexneri 2a str. 2457T]
 gi|56480037|ref|NP_708000.2| putative ATPase [Shigella flexneri 2a str. 301]
 gi|30041803|gb|AAP17530.1| putative ATPase [Shigella flexneri 2a str. 2457T]
 gi|56383588|gb|AAN43707.2| putative ATPase [Shigella flexneri 2a str. 301]
 gi|281601554|gb|ADA74538.1| putative ATPase [Shigella flexneri 2002017]
 gi|313649840|gb|EFS14260.1| protein mrp [Shigella flexneri 2a str. 2457T]
 gi|332755946|gb|EGJ86300.1| protein mrp [Shigella flexneri K-671]
 gi|332756890|gb|EGJ87235.1| protein mrp [Shigella flexneri 2747-71]
 gi|332766464|gb|EGJ96673.1| putative ATPase [Shigella flexneri 2930-71]
 gi|333017150|gb|EGK36471.1| protein mrp [Shigella flexneri K-304]
          Length = 369

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/343 (37%), Positives = 200/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 11  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 70

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 71  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 126

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 127 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 186

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 187 VTDDNAMVWRGPMAGKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 246

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 247 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 306

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 307 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 349


>gi|332161116|ref|YP_004297693.1| putative ATPase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318604997|emb|CBY26495.1| scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like
           [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325665346|gb|ADZ41990.1| putative ATPase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330859357|emb|CBX69703.1| protein mrp [Yersinia enterocolitica W22703]
          Length = 370

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 124/338 (36%), Positives = 201/338 (59%), Gaps = 5/338 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           +L++QI   L   + P  + ++ E++ +    ++ N +++ + +P         L+ +  
Sbjct: 13  LLQSQISKVLAAFTHPTLQKSLTELRAIHHCALLDNVLHIELVMPFAWQFGFDILKESVS 72

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIACA 119
             +  +   K     L+ N    ++ N+      V+  VAV+SGKGGVGKS+T VN+A A
Sbjct: 73  GELLVVTGAKAIDWKLSHNITTLKRANDQPGVKGVRNIVAVSSGKGGVGKSSTAVNLALA 132

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENV 178
           L  +G  V ILDAD+YGPSIP +L  + +   S D K + P   +GI   S+  LV +  
Sbjct: 133 LAEEGAKVGILDADIYGPSIPNMLGTTNQRPTSPDGKHMAPIMAHGIATNSIGYLVTDEN 192

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
           AM+WRGPM   A+M ML + +W  LD+L+IDMPPGTGD  LT++Q IP++G ++V+TPQD
Sbjct: 193 AMVWRGPMASKALMQMLQDTLWPDLDYLVIDMPPGTGDIQLTLSQNIPVTGALVVTTPQD 252

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +ALID  + I M++K+++P++G+IENMS  + S+ G    +FG GGA   A+K     L 
Sbjct: 253 IALIDAMKGIVMFEKVHVPVLGIIENMSMHICSNCGHLEPIFGTGGAEKLAQKYHCKLLG 312

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +P  + +R   D G P VV + +S  ++IY++++  +
Sbjct: 313 QIPLHISLREDLDRGEPTVVSHPDSEFADIYRQLASNV 350


>gi|73856108|gb|AAZ88815.1| putative ATPase [Shigella sonnei Ss046]
          Length = 379

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/343 (37%), Positives = 199/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  +  L  +  + +T+++ + +P       + L+   
Sbjct: 21  EALRAMVAGTLANFQHPTLKHNLTTLNALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 80

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 81  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 136

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 137 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 196

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 197 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 256

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 257 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 316

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 317 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 359


>gi|320663152|gb|EFX30461.1| antiporter inner membrane protein [Escherichia coli O55:H7 str.
           USDA 5905]
          Length = 369

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/343 (37%), Positives = 200/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 11  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 70

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 71  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 126

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 127 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 186

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 187 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 246

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 247 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHYEPIFGTGGAEKLAEKYH 306

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 307 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 349


>gi|331653540|ref|ZP_08354541.1| protein mrp [Escherichia coli M718]
 gi|331048389|gb|EGI20465.1| protein mrp [Escherichia coli M718]
          Length = 379

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 128/343 (37%), Positives = 200/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 21  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 80

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 81  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 136

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 137 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 196

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G ++V
Sbjct: 197 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAIVV 256

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 257 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 316

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 317 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 359


>gi|161986505|ref|YP_311050.2| putative ATPase [Shigella sonnei Ss046]
 gi|323168763|gb|EFZ54443.1| protein mrp [Shigella sonnei 53G]
          Length = 369

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/343 (37%), Positives = 199/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  +  L  +  + +T+++ + +P       + L+   
Sbjct: 11  EALRAMVAGTLANFQHPTLKHNLTTLNALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 70

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 71  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 126

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 127 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 186

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 187 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 246

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK  
Sbjct: 247 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYH 306

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 307 TQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 349


>gi|113954835|ref|YP_729694.1| ATPase [Synechococcus sp. CC9311]
 gi|113882186|gb|ABI47144.1| MRP protein homolog [Synechococcus sp. CC9311]
          Length = 358

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 124/349 (35%), Positives = 210/349 (60%), Gaps = 22/349 (6%)

Query: 7   NQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66
            Q  + LK +   G   +++++  L  + +      L + +P     Q + + S A++ +
Sbjct: 5   EQAAELLKGIVDAGSNRSVMDLGWLDRVRVDPPRAVLRLNLPGFAQGQRERIVSEARERL 64

Query: 67  QNIPTVKNAVVTLTENKNPPQQ-------------RNNL-NVKKFVAVASGKGGVGKSTT 112
             +  +++  +   E   PP Q             R  +  VK+ +AV+SGKGGVGKST 
Sbjct: 65  LGLEAIQDVQI---EVGTPPSQGGIGQAGHGQAAERQPIPGVKQVIAVSSGKGGVGKSTV 121

Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV-EIS---DKKFLKPKENYGIKIM 168
            VN+AC+L  +G  V +LDAD+YGP+ P +L ++ +  E+S   D + + P E+ G+ ++
Sbjct: 122 AVNLACSLAKQGLRVGLLDADIYGPNAPIMLGVADQSPEVSGSGDDQRMIPLESCGVAMV 181

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           SM  L++EN  +IWRGPM+   I   L+ V W + D L++D+PPGTGDA L++AQ +P++
Sbjct: 182 SMGLLIEENQPVIWRGPMLNGIIRQFLYQVDWTERDVLIVDLPPGTGDAQLSLAQAVPMA 241

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDT-GKKYDLFGNGGARF 287
           GVVIV+TPQ +AL D +R ++M+ +M +P++G++ENMS F+  D   K Y LFG+GG + 
Sbjct: 242 GVVIVTTPQKVALQDARRGLAMFLQMGVPVLGVVENMSAFIPPDQPDKSYALFGSGGGQT 301

Query: 288 EAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            AE   +P L  +P +M V+   D G PI + + NSA+++ ++E+++ +
Sbjct: 302 LAEAFDVPLLAQIPMEMSVQEGGDQGQPISISHPNSASAQAFKELAETL 350


>gi|194337373|ref|YP_002019167.1| Cobyrinic acid ac-diamide synthase [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194309850|gb|ACF44550.1| Cobyrinic acid ac-diamide synthase [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 298

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 176/262 (67%), Gaps = 12/262 (4%)

Query: 80  TENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSI 139
            E++ P QQ     VK  +AVASGKGGVGKST  VN++ AL   G  V ++DAD+YGPSI
Sbjct: 32  CEHERPLQQ-----VKHIIAVASGKGGVGKSTFAVNLSIALAQTGAKVGLIDADLYGPSI 86

Query: 140 PKLLK-ISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNV 198
           P +   +  K E+++K  L P E +G+K+MS+  L++ + A+IWRGPMV +AI   +  V
Sbjct: 87  PTMFGLLDAKPEVTEKH-LVPLEKWGVKLMSIGFLIETDTAVIWRGPMVSNAIKQFISEV 145

Query: 199 VWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPI 258
            W +LD+L+ D+PPGTGD  +TIAQ +PL+G +IV+TPQD+A+ DV +A+SM++K+N+PI
Sbjct: 146 DWSELDYLIFDLPPGTGDIQITIAQTVPLTGAIIVTTPQDVAIADVSKAVSMFRKVNVPI 205

Query: 259 IGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVV 318
           +G++ENMSY+   D  K Y +FG+ G    A   G+ FL S+P D  VR   D G P ++
Sbjct: 206 LGVVENMSYYELPDGTKDY-IFGHHGGEIFARTQGLSFLGSIPIDRAVREGGDNGTPYML 264

Query: 319 HNMNSATS----EIYQEISDRI 336
            + +SATS    +   E++ RI
Sbjct: 265 SHPDSATSKAINQATMEVARRI 286


>gi|114331897|ref|YP_748119.1| hypothetical protein Neut_1922 [Nitrosomonas eutropha C91]
 gi|114308911|gb|ABI60154.1| protein of unknown function DUF59 [Nitrosomonas eutropha C91]
          Length = 361

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 130/337 (38%), Positives = 206/337 (61%), Gaps = 4/337 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I + QI   L     P    N +  + ++ I I   +V + I + +     L+++R   +
Sbjct: 2   ITQQQIETVLGQTIDPTTGKNYLTSKTVNNIQINQTSVVIDIELGYPAKSVLKTVRQQIE 61

Query: 64  QIIQNIPTVKNAVVTLTEN--KNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACA 119
             ++ +P + +  V +T N   +  Q++  L   VK  +A+ASGKGGVGKS T VN+A A
Sbjct: 62  HALRTLPGIGSVTVNVTSNIIAHGAQRKLKLLPGVKNVIAIASGKGGVGKSATAVNLALA 121

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
           L  +G  V ILDAD+YGPS P++L +SG+    D K ++P   +GI++MS+  L+D    
Sbjct: 122 LAAEGATVGILDADIYGPSQPQMLGVSGQPNSPDGKTIEPMRAHGIQMMSIGLLIDVETP 181

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A+  +L++ +W  LD+LLID+PPGTGD  LT+AQKIP++G VIV+TPQD+
Sbjct: 182 MVWRGPMVTQALQQLLNDTLWQDLDYLLIDLPPGTGDIQLTLAQKIPVTGAVIVTTPQDI 241

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D ++ + M++K+ IPI+G++ENMS    S+ G    +FG GG    ++   +  L +
Sbjct: 242 ALLDARKGLKMFEKVGIPILGIVENMSLHTCSNCGHTEPIFGTGGGEKMSKDYNVELLGA 301

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P D+ +R  +D G P VV   +   + IY+ I+ R+
Sbjct: 302 LPLDIRIREHTDAGTPSVVAEPDGQIATIYRTIARRV 338


>gi|91214968|ref|ZP_01251940.1| Mrp/Nbp35 family ATP-binding protein [Psychroflexus torquis ATCC
           700755]
 gi|91186573|gb|EAS72944.1| Mrp/Nbp35 family ATP-binding protein [Psychroflexus torquis ATCC
           700755]
          Length = 381

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 130/350 (37%), Positives = 205/350 (58%), Gaps = 15/350 (4%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAH-----QLQSLRS 60
           K+ I  +L+ +++ GE  NIVE   L  I    + V + + +     H     ++  +++
Sbjct: 5   KDDIKKALETITVAGEGQNIVESGALQNIVTFGDEVVIDLKLSTPALHIKKRAEVDVMKA 64

Query: 61  NAQQIIQNIPTVKNAVVTLTENK--NPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
             + + +         V   E K  N  + +    ++  +AVASGKGGVGKST   N+A 
Sbjct: 65  IHKHVYEKAKVEVKISVEAKEKKATNEIKGKPIPGIQNIIAVASGKGGVGKSTVTANLAV 124

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS----DKKFLKPKENYGIKIMSMASLV 174
            L   G  V +LDAD+YGPS P +  ++ +  +S     K  +KP ENYG+KI+S+    
Sbjct: 125 TLTKMGFKVGLLDADIYGPSGPMMFDVANEKPLSVTKNGKSKMKPIENYGVKILSIGFFT 184

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
             + A+IWRGPM   A+  M+ +  WG+LDFLL+D+PPGTGD HL+I Q +P++G +IVS
Sbjct: 185 KPDEAVIWRGPMAAKALNQMIFDSDWGELDFLLVDLPPGTGDIHLSIMQSMPITGALIVS 244

Query: 235 TPQDLALIDVKRAISMYQK--MNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEK 291
           TPQ++AL D K+A+SM+Q+  +N+P++G+ ENM+YF   +   KKY +FG  GA++ AE 
Sbjct: 245 TPQNVALADAKKAVSMFQQESINVPVLGICENMAYFTPEELPDKKYYIFGEKGAKYLAED 304

Query: 292 IGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV 341
           IG+PFL  +P    +R   D+G P  + +  +  SE ++E++    Q  V
Sbjct: 305 IGVPFLGEIPLVQSLRESGDIGRPAALQD-GTPLSESFKELTKNTVQEVV 353


>gi|16765483|ref|NP_461098.1| ATPase [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|62180739|ref|YP_217156.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161502697|ref|YP_001569809.1| putative ATPase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|161613159|ref|YP_001587124.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|167551106|ref|ZP_02344861.1| mrp protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167991076|ref|ZP_02572175.1| mrp protein [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168242235|ref|ZP_02667167.1| mrp protein [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|168259510|ref|ZP_02681483.1| mrp protein [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168466171|ref|ZP_02700041.1| mrp protein [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|168818141|ref|ZP_02830141.1| mrp protein [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194442302|ref|YP_002041425.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194451212|ref|YP_002046207.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|197248671|ref|YP_002147125.1| putative ATPase [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197261949|ref|ZP_03162023.1| mrp protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|198243601|ref|YP_002216238.1| putative ATPase [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|200387630|ref|ZP_03214242.1| mrp protein [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204929319|ref|ZP_03220462.1| mrp protein [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|207857588|ref|YP_002244239.1| ATPase [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|238912597|ref|ZP_04656434.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|16420689|gb|AAL21057.1| putative ATP-binding protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|62128372|gb|AAX66075.1| putative ATP-binding protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|160864044|gb|ABX20667.1| hypothetical protein SARI_00744 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161362523|gb|ABX66291.1| hypothetical protein SPAB_00867 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194400965|gb|ACF61187.1| mrp protein [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194409516|gb|ACF69735.1| mrp protein [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|195631400|gb|EDX49960.1| mrp protein [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197212374|gb|ACH49771.1| mrp protein [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197240204|gb|EDY22824.1| mrp protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197938117|gb|ACH75450.1| mrp protein [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|199604728|gb|EDZ03273.1| mrp protein [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204321863|gb|EDZ07062.1| mrp protein [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205324069|gb|EDZ11908.1| mrp protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205330545|gb|EDZ17309.1| mrp protein [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205338654|gb|EDZ25418.1| mrp protein [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|205345102|gb|EDZ31866.1| mrp protein [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205351112|gb|EDZ37743.1| mrp protein [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|206709391|emb|CAR33732.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261247368|emb|CBG25193.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267994215|gb|ACY89100.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301158715|emb|CBW18227.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312913144|dbj|BAJ37118.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|320086591|emb|CBY96362.1| Cytosolic Fe-S cluster assembling factor nbp-35 Nucleotide-binding
           protein 35 [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321224805|gb|EFX49868.1| Scaffold protein for 4Fe-4S cluster assembly ApbC [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|322715214|gb|EFZ06785.1| mrp protein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323130479|gb|ADX17909.1| mrp protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|326623988|gb|EGE30333.1| putative ATPase [Salmonella enterica subsp. enterica serovar Dublin
           str. 3246]
 gi|332989087|gb|AEF08070.1| putative ATPase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 369

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 199/341 (58%), Gaps = 13/341 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+     
Sbjct: 13  LRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWNSAFEVLKEQCSA 72

Query: 65  IIQNIPTVKNA-------VVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVVNI 116
            +  I   K         + TL   KN P     +N VK  +AV+SGKGGVGKS+T VN+
Sbjct: 73  DLLRITGAKAIDWKLSYNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAVNL 128

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVD 175
           A AL  +G  V +LDAD+YGPSIP +L    +   S D   + P  ++G+   S+  LV 
Sbjct: 129 ALALAAEGAKVGVLDADIYGPSIPTMLGAEDQRPTSPDGTHMAPIMSHGLATNSIGYLVT 188

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
           ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+T
Sbjct: 189 DDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTT 248

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK    
Sbjct: 249 PQDIALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAQKLAEKYHTQ 308

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            L  +P  + +R   D G P VV    S  + IY+E++DR+
Sbjct: 309 LLGQMPLHISLREDLDRGTPTVVSRPESEFTAIYRELADRV 349


>gi|284929348|ref|YP_003421870.1| chromosome partitioning ATPase [cyanobacterium UCYN-A]
 gi|284809792|gb|ADB95489.1| ATPase involved in chromosome partitioning [cyanobacterium UCYN-A]
          Length = 353

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 124/337 (36%), Positives = 207/337 (61%), Gaps = 9/337 (2%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           I+++L+ +  P  K ++V +  +  + I  +TV  ++ +        + +  + ++ ++ 
Sbjct: 7   ILNALQPVQDPELKKSLVTLNMIRNVSIKDSTVEFTLVLTTPACPLKELIIQDCEKALKE 66

Query: 69  IPTVKNAVVTLTEN----KNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKG 124
           +P V+   + +T      K  P Q++  NVK  +AV+SGKGGVGKST  VN A AL   G
Sbjct: 67  LPEVQEVKINVTSETPVQKALPTQQSIPNVKNIIAVSSGKGGVGKSTVAVNTAVALAQMG 126

Query: 125 KNVAILDADVYGPSIPKLLKISGKVEISDKK----FLKPKENYGIKIMSMASLVDENVAM 180
             V +LDAD+YGP+ P +L +       +K+     L+P  + GIK++SM  L++    +
Sbjct: 127 AKVGLLDADIYGPNAPTMLGVEDYQVTVEKRPEGDILEPVLSNGIKMVSMGFLINPGQPV 186

Query: 181 IWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLA 240
           IWRGPM+   I   LH V WG LD+L++DMPPGTGD  LT+AQ +P++GVVIV+TPQ+++
Sbjct: 187 IWRGPMLTGIIRQFLHQVNWGSLDYLIVDMPPGTGDVQLTLAQSVPMAGVVIVTTPQNVS 246

Query: 241 LIDVKRAISMYQKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGIPFLES 299
           LID  R I M++++   I+G++ENMSYF+  D     YD+FG+GG    ++++ IP L  
Sbjct: 247 LIDAYRGIKMFEQLKTNILGIVENMSYFIPPDLPDHSYDIFGSGGGMKASQELQIPLLGL 306

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P ++ +R   D G+PI++ +  SA+++  + I+ +I
Sbjct: 307 IPLEISLRQGGDNGVPILISHPQSASAKALKLIAQKI 343


>gi|322369541|ref|ZP_08044106.1| ATP-binding protein Mrp 1 [Haladaptatus paucihalophilus DX253]
 gi|320551273|gb|EFW92922.1| ATP-binding protein Mrp 1 [Haladaptatus paucihalophilus DX253]
          Length = 346

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 116/324 (35%), Positives = 195/324 (60%), Gaps = 2/324 (0%)

Query: 13  LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTV 72
           L+ +  P    +IV +  ++++ +   T  +S+ +    A     + +  ++ + N   +
Sbjct: 10  LRTVEDPDLGEDIVSLGLVNDVTVEDETARISLALGAPYAPHESEIANRVREAL-NDEGI 68

Query: 73  KNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDA 132
              +    + +  P+++    VK  +AVASGKGGVGKST  VN+A  L   G  V + DA
Sbjct: 69  DTELSARVDTQLSPEEQVLPGVKNIIAVASGKGGVGKSTVAVNLAAGLAKLGARVGLFDA 128

Query: 133 DVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIM 192
           DVYGP++P+++  + +   ++++ L P E +G+K+MSMA L  ++  +IWRGPMV   + 
Sbjct: 129 DVYGPNVPRMVDANERPRATEEQKLVPPEKFGVKLMSMAFLTGKDDPVIWRGPMVHKVLT 188

Query: 193 HMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQ 252
            +  +V WGQLD++++D+PPGTGD  LT+ Q +P++G VIV+TPQ +AL D  + + M+ 
Sbjct: 189 QLWEDVEWGQLDYMVVDLPPGTGDTQLTLLQSVPVTGAVIVTTPQQVALDDANKGLQMFG 248

Query: 253 KMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDL 312
           K + P++G+ ENMS F   D G ++D+FG+GG    AE   +PFL S+P D  VR   D 
Sbjct: 249 KHDTPVLGIAENMSTFKCPDCGGEHDIFGHGGGAEFAEDHEMPFLGSIPLDPSVRSGGDE 308

Query: 313 GIPIVVHNMNSATSEIYQEISDRI 336
           G PIV+ +  S T E ++ +++ +
Sbjct: 309 GEPIVLDD-ESDTGESFRTLTENV 331


>gi|323187875|gb|EFZ73171.1| protein mrp [Escherichia coli RN587/1]
          Length = 369

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 127/339 (37%), Positives = 196/339 (57%), Gaps = 5/339 (1%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 11  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 70

Query: 63  QQIIQNIPTVKNAVVTLTEN----KNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
              +  I   K     L+ N    K    Q     VK  +AV+SGKGGVGKS+T VN+A 
Sbjct: 71  SAELLRITGAKAIDWKLSHNIATLKRVKSQPGINGVKNIIAVSSGKGGVGKSSTAVNLAL 130

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDEN 177
           AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  LV ++
Sbjct: 131 ALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYLVTDD 190

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+TPQ
Sbjct: 191 NAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTTPQ 250

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           D+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK     L
Sbjct: 251 DIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYHTQLL 310

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P  + +R   D G P V+    S  + IY++++DR+
Sbjct: 311 GQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRV 349


>gi|146306438|ref|YP_001186903.1| hypothetical protein Pmen_1406 [Pseudomonas mendocina ymp]
 gi|145574639|gb|ABP84171.1| protein of unknown function DUF59 [Pseudomonas mendocina ymp]
          Length = 362

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 126/342 (36%), Positives = 202/342 (59%), Gaps = 6/342 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           M+ + +  +   L+  + P    + V    L E+ I    V + + + +           
Sbjct: 1   MSAVTREAVEACLRQFTDPHLDQDPVSAGCLREVDIQGARVAVRLELGYAAGLFKNGWAQ 60

Query: 61  NAQQIIQNIPTVKNAVV----TLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNI 116
             Q  ++N+  V +A V     +  ++   Q      VK  +AVASGKGGVGKSTT  N+
Sbjct: 61  MLQMALENLDGVDSAQVQVDCVIDSHQGQAQVPALAGVKNVIAVASGKGGVGKSTTAANL 120

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKIS--GKVEISDKKFLKPKENYGIKIMSMASLV 174
           A AL  +G  V ILDAD+YGPS   +  I+   + E+ ++K+  P E +G+++MSMA L 
Sbjct: 121 ALALAREGARVGILDADIYGPSQGIMFGIAEGTRPEVREQKWFVPLEAHGVQVMSMAFLT 180

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
           D+N  M+WRGPMV  A++ ++    W  LD+L++DMPPGTGD  LT+AQK+P++G VIV+
Sbjct: 181 DDNTPMVWRGPMVSGALLQLITQTAWNDLDYLVVDMPPGTGDIQLTLAQKVPVAGSVIVT 240

Query: 235 TPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGI 294
           TPQDLAL+D K+ + M++K++IP++G++ENM+  + S+ G    LFG GG    A + G+
Sbjct: 241 TPQDLALLDAKKGVEMFRKVHIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLAAQYGV 300

Query: 295 PFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             L S+P  M +R+ +D G P  + +  S  + IYQ+++ ++
Sbjct: 301 ELLASLPLSMAIRMQADDGKPTTIADPESQIAMIYQDLARKV 342


>gi|82703087|ref|YP_412653.1| hypothetical protein Nmul_A1966 [Nitrosospira multiformis ATCC
           25196]
 gi|82411152|gb|ABB75261.1| domain of unknown function DUF59 [Nitrosospira multiformis ATCC
           25196]
          Length = 362

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 135/337 (40%), Positives = 205/337 (60%), Gaps = 4/337 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I + QI  +L+ ++      + +       I I  N V L I + +     ++ +R+   
Sbjct: 3   ITEQQIQVALREITDLTTGKDYISTNEARNIVIEGNNVSLDIVLGYPAKSVMEDIRAQVI 62

Query: 64  QIIQNIPTVK--NAVVTLTENKNPPQQRNNL--NVKKFVAVASGKGGVGKSTTVVNIACA 119
             ++ IP +   NA V+     +  Q+   L   VK  +AVASGKGGVGKS T VN+A A
Sbjct: 63  GKLKAIPGIGSVNANVSSKIVSHAVQRGVKLIPGVKNIIAVASGKGGVGKSATAVNLALA 122

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
           L  +G +V ILDAD+YGPS P++L I+G+ E  D K ++P   +GI+ MS+  L+D    
Sbjct: 123 LAAEGASVGILDADIYGPSQPQMLGITGRPESPDGKTIEPMRAHGIQAMSIGLLIDAETP 182

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           M+WRGPMV  A+  +L +  W ++D+L++DMPPGTGD  LT+AQK+P++G VIV+TPQD+
Sbjct: 183 MVWRGPMVTQALQQLLTDTRWEEIDYLIVDMPPGTGDIQLTLAQKVPVTGAVIVTTPQDI 242

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL+D ++ + M+QK+ IPIIG+IENMS  + S+ G +  +FG GGA        +  L +
Sbjct: 243 ALLDARKGLKMFQKVGIPIIGIIENMSTHICSNCGHEEHIFGTGGAEKMCRDYDVELLGA 302

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P D+ +R  +D G P VV   +   SEIY+ I+ R+
Sbjct: 303 LPLDIKIREHTDSGNPTVVAEPDGRISEIYRSIARRL 339


>gi|226939670|ref|YP_002794743.1| Mrp protein [Laribacter hongkongensis HLHK9]
 gi|226714596|gb|ACO73734.1| Mrp protein [Laribacter hongkongensis HLHK9]
          Length = 387

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 172/245 (70%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            VK  +AVASGKGGVGKSTT VN+A AL  +G  V ILDAD+YGPS+P +L + G+   S
Sbjct: 120 GVKNIIAVASGKGGVGKSTTSVNLALALAAEGARVGILDADIYGPSLPLMLGMQGQRPAS 179

Query: 153 -DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K + P EN+GI+ MSM  +VD++ AM+WRGPMV  A+M +L++  W  LD+L+ID+P
Sbjct: 180 PDGKSILPIENHGIQTMSMGYMVDDDQAMVWRGPMVTQALMQLLNDTRWDNLDYLVIDLP 239

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT+AQKIP++G VIV+TPQD+ALID ++ ++M++K+ +P++G++ENM+  + S
Sbjct: 240 PGTGDVQLTLAQKIPVTGAVIVTTPQDIALIDARKGLTMFEKVGVPVLGIVENMAMHVCS 299

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G    +FG+GG    A +  +  +  +P ++ +R   D G P +V   +S  + +Y++
Sbjct: 300 QCGHVEAIFGSGGGARMAGQYQVELIGQLPLELAIRQSMDEGRPTLVSAPDSPAAALYRQ 359

Query: 332 ISDRI 336
           I+ ++
Sbjct: 360 IARKV 364


>gi|293411861|ref|ZP_06654586.1| mrp [Escherichia coli B354]
 gi|220980039|emb|CAP72231.1| Putative protein mrp [Escherichia coli LF82]
 gi|291469416|gb|EFF11905.1| mrp [Escherichia coli B354]
 gi|323934276|gb|EGB30698.1| ParA/MinD ATPase like protein [Escherichia coli E1520]
          Length = 366

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 128/340 (37%), Positives = 199/340 (58%), Gaps = 11/340 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+  +  +L     P  K+N+  ++ L  + ++ +T+++ + +P       + L+     
Sbjct: 10  LRAMVAGTLANFQHPTLKHNLTTLKALHHVALMDDTLHVELIMPFVWNKPFEDLKEQCSG 69

Query: 65  IIQNIPTVKNA-------VVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIA 117
            +  I   K         + TL   KN P       VK  +AV+SGKGGVGKS+T VN+A
Sbjct: 70  DLLRITGAKAIDWKLSYNIATLKRVKNQPGING---VKNIIAVSSGKGGVGKSSTAVNLA 126

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDE 176
            AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  LV +
Sbjct: 127 LALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYLVTD 186

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           + AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+TP
Sbjct: 187 DNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTTP 246

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK     
Sbjct: 247 QDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAQKLAEKYNTQL 306

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L  +P  + +R   D G P V+   +S  + IY++++DR+
Sbjct: 307 LGQMPLHISLREDLDNGTPTVISRPDSEFTAIYRDLADRV 346


>gi|33241185|ref|NP_876127.1| ATPase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
 gi|33238715|gb|AAQ00780.1| ATPase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
          Length = 359

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 122/346 (35%), Positives = 212/346 (61%), Gaps = 20/346 (5%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           + +++ +L  +   G   ++V++  L ++ I H    + + +P     Q   + + A++I
Sbjct: 4   EEELLKALSSIKDSGSNRSVVDLGWLDQLRINHPKAIVRLNLPSYAQSQRDRIAAEAKRI 63

Query: 66  IQNIPTVKNAVVTLTENKNPPQQRNNLN------------VKKFVAVASGKGGVGKSTTV 113
           +++   +    + L+ N N   +  N              VK  +AV+SGKGGVGKST  
Sbjct: 64  VESYREISELQIELS-NANGQSEIGNAGHGQVSSLQKIPGVKNVIAVSSGKGGVGKSTVA 122

Query: 114 VNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV-EI----SDKKFLKPKENYGIKIM 168
           VN+AC L  KG +V +LDAD+YGP+ P +L +S K  E+    +++K + P E++GI ++
Sbjct: 123 VNLACGLSQKGYSVGLLDADIYGPNTPIMLGVSDKTPEVQGSGAEQKII-PIESFGISMV 181

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           SM  L+D+N  +IWRGPM+   I   L+   WG+ DFL++D+PPGTGDA L++AQ +P+S
Sbjct: 182 SMGLLIDDNQPVIWRGPMLNGIIRQFLYQASWGEKDFLVVDLPPGTGDAQLSLAQAVPMS 241

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDT-GKKYDLFGNGGARF 287
           GV+IV+TPQ ++L D +R ++M+++MN+PI+G+IENMS F+  D   ++Y +FG GG + 
Sbjct: 242 GVLIVTTPQKVSLQDSRRGLAMFKQMNVPILGVIENMSSFIPPDQPEREYAIFGTGGGQV 301

Query: 288 EAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
            +E+  +P L  +P +M+    ++   PIV    +S T++ ++ ++
Sbjct: 302 LSEENSVPLLAKLPLEMNTSNGNEEDKPIVFQYPDSKTAKAFERLA 347


>gi|160871866|ref|ZP_02061998.1| Mrp protein [Rickettsiella grylli]
 gi|159120665|gb|EDP46003.1| Mrp protein [Rickettsiella grylli]
          Length = 273

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 168/246 (68%), Gaps = 1/246 (0%)

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKN-KGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           +K  +A+ASGKGGVGKSTT VN+A AL   + KNV ILDAD+YGP+ P++L ++ K    
Sbjct: 8   IKHIIAIASGKGGVGKSTTAVNLALALAEVENKNVGILDADIYGPNQPQMLGVNEKPTSK 67

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K L+P   +G++ MS+  L+D +  MIWRGPM   A+  +L++  W  LD+L++D+PP
Sbjct: 68  DGKTLEPVYAHGLQSMSIGYLIDASTPMIWRGPMATGALQQLLNDTHWNNLDYLVVDLPP 127

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+ QKIPLSG VIV+TPQD+AL+DV++AI M+ K+ +P++G++ENM  +   +
Sbjct: 128 GTGDIQLTLTQKIPLSGAVIVTTPQDIALLDVRKAIGMFNKVKVPLLGIVENMCMYACRN 187

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G K  +FG+GG    A+   +  L ++P D  +R  +D+G PI +     A ++IY++I
Sbjct: 188 CGHKEPIFGHGGGERLAKAYDMRLLGTLPLDGKIREQADVGTPIFLAEPQGAIADIYRKI 247

Query: 333 SDRIQQ 338
           +  I +
Sbjct: 248 AREITE 253


>gi|37521049|ref|NP_924426.1| hypothetical protein glr1480 [Gloeobacter violaceus PCC 7421]
 gi|35212045|dbj|BAC89421.1| glr1480 [Gloeobacter violaceus PCC 7421]
          Length = 361

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 128/343 (37%), Positives = 216/343 (62%), Gaps = 10/343 (2%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I + +I++ LK +  P  + ++VE+  +  + I    V  ++ +        + +  + +
Sbjct: 9   IQQEEILNVLKPVQDPELRRSLVELGMIRNVDIQGGNVSFTLVLTTPACPLREMIVGDCK 68

Query: 64  QIIQNIPTVKNAVVTLT----ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACA 119
           + +  I  V++  V +T    + K  P ++    VK  +AV+SGKGGVGK+T  VN+A +
Sbjct: 69  KAVFAIDGVQSVEVEVTAETPKAKALPDRQGIPGVKNIIAVSSGKGGVGKTTVSVNVAVS 128

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISG-KVEI----SDKKFLKPKENYGIKIMSMASLV 174
           L   G  V ILDAD+YGP++P +L + G K+ +    +  +  +P  NYG+K++SM   V
Sbjct: 129 LAQSGAQVGILDADIYGPNVPLMLGLQGQKMPVRHNENGGEIFEPLFNYGVKVVSMGFWV 188

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
            E+  +IWRGPM+ SAI   L+ V WG+LD+L+ID+PPGTGDA LT+ Q +PL+G VIV+
Sbjct: 189 GEDQPLIWRGPMLNSAIRQFLYQVDWGELDYLIIDLPPGTGDAQLTLCQSVPLAGAVIVT 248

Query: 235 TPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDT-GKKYDLFGNGGARFEAEKIG 293
           TPQ +AL+D ++ + M+Q++ +P++G++ENMSYF+  D   KKYD+F +GG    A ++G
Sbjct: 249 TPQTVALLDSRKGLRMFQQLGVPVLGIVENMSYFIPPDAPEKKYDIFSSGGGERTARELG 308

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +P L  +P +M VR   D G+PI +   +SA+++ +++++  I
Sbjct: 309 LPLLGMLPLEMPVREGGDRGVPIAMARPDSASAQAFRKLAQVI 351


>gi|152995575|ref|YP_001340410.1| ParA family protein [Marinomonas sp. MWYL1]
 gi|150836499|gb|ABR70475.1| ParA family protein [Marinomonas sp. MWYL1]
          Length = 356

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 163/246 (66%), Gaps = 2/246 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI--SGKVE 150
            VK  +AVASGKGGVGKSTT VN+A A+  +G  V ILDAD+YGPS   LL      + +
Sbjct: 89  GVKNIIAVASGKGGVGKSTTTVNLALAMAKEGARVGILDADIYGPSQGMLLGFEEGTRPQ 148

Query: 151 ISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDM 210
           + + KF  P   +G+++MSMA L  ++  + WRGPMV  A+M +L    W  LD+L IDM
Sbjct: 149 VREDKFFVPPTAFGVQVMSMAFLTTKDTPLAWRGPMVTGALMQILTQTDWDNLDYLFIDM 208

Query: 211 PPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLA 270
           PPGTGD  LT+AQK+P++G V+V+TPQD+AL+D +R I M+ K+NIP++G++ENMS  + 
Sbjct: 209 PPGTGDIQLTLAQKVPVAGSVVVTTPQDIALLDARRGIEMFNKVNIPVLGVVENMSTHIC 268

Query: 271 SDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQ 330
           S+ G    +FG+ G    A++  +  L  +P  + +R  SD G PIVV+   S T+ IYQ
Sbjct: 269 SNCGHHEAIFGDEGGASLAKEYNVNVLGKLPLSLAIREQSDAGRPIVVNAPESDTAGIYQ 328

Query: 331 EISDRI 336
            I+ ++
Sbjct: 329 SIARKL 334


>gi|309797879|ref|ZP_07692260.1| putative protein mrp [Escherichia coli MS 145-7]
 gi|308118487|gb|EFO55749.1| putative protein mrp [Escherichia coli MS 145-7]
          Length = 366

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 128/340 (37%), Positives = 198/340 (58%), Gaps = 11/340 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+  +  +L     P  K+N+  ++ L  + ++ +T+++ + +P       + L+     
Sbjct: 10  LRAMVAGTLANFQHPTLKHNLTTLKALHHVALMDDTLHVELIMPFVWNKPFEDLKEQCSG 69

Query: 65  IIQNIPTVKNA-------VVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIA 117
            +  I   K         + TL   KN P       VK  +AV+SGKGGVGKS+T VN+A
Sbjct: 70  DLLRITGAKAIDWKLSYNIATLKRVKNQPGING---VKNIIAVSSGKGGVGKSSTAVNLA 126

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDE 176
            AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  LV +
Sbjct: 127 LALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYLVTD 186

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           + AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+TP
Sbjct: 187 DNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTTP 246

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA   AEK     
Sbjct: 247 QDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEKLAEKYNTQL 306

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L  +P  + +R   D G P V+   +S  + IY++++DR+
Sbjct: 307 LGQMPLHISLREDLDNGTPTVISRPDSEFTAIYRDLADRV 346


>gi|284164855|ref|YP_003403134.1| ATPase-like, ParA/MinD [Haloterrigena turkmenica DSM 5511]
 gi|284014510|gb|ADB60461.1| ATPase-like, ParA/MinD [Haloterrigena turkmenica DSM 5511]
          Length = 358

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 119/329 (36%), Positives = 196/329 (59%), Gaps = 2/329 (0%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           + D L+ +  P   ++IV +  +++I +    V + + +    +     +    ++++++
Sbjct: 6   VRDRLRTVEDPELGDDIVSLGLVNDITVDGEQVDIDLALGAPYSPTETDIAGEVRRLLED 65

Query: 69  IPTVKNAVVTLTENKNPPQQRNNL-NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNV 127
                +   ++ +  +   +   L  VK  +AVASGKGGVGKST  VN+A  L   G  V
Sbjct: 66  EGLEPDLSASVPDRDDVANEDQVLPGVKNVIAVASGKGGVGKSTVAVNLAAGLSRLGATV 125

Query: 128 AILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMV 187
            + DADVYGP++P+++        ++ + L P E YG+K+MSMA L  E+  +IWRGPMV
Sbjct: 126 GLFDADVYGPNVPRMVDADEPPMATEDETLVPPEKYGVKLMSMAFLTGEDDPVIWRGPMV 185

Query: 188 QSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRA 247
              I  +  +V WG LD+L+ID+PPGTGD  LT+ Q +P++G VIV+TPQD+AL D ++ 
Sbjct: 186 HKVITQLTEDVEWGHLDYLVIDLPPGTGDTQLTMLQTMPVTGAVIVTTPQDVALDDARKG 245

Query: 248 ISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVR 307
           + M+ K +  ++G+ ENMS F   D G ++D+FG+GG R  A++  +PFL S+P D  VR
Sbjct: 246 LEMFAKHDTVVLGIAENMSTFACPDCGGEHDIFGSGGGREFADEHELPFLGSIPLDPAVR 305

Query: 308 VLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              D G P V+ +  SAT + ++ I++ +
Sbjct: 306 EGGDGGKPTVLED-ESATGDAFRTITENV 333


>gi|332092689|gb|EGI97759.1| protein mrp [Shigella boydii 5216-82]
          Length = 369

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 128/343 (37%), Positives = 201/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 11  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 70

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 71  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 126

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 127 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 186

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 187 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 246

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENM+  + S+ G    +FG GGA   AEK  
Sbjct: 247 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMNVHICSNCGHHEPIFGTGGAEKLAEKYH 306

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V++   S  + IY++++DR+
Sbjct: 307 TQLLGQMPLHISLREDLDKGTPTVINRPESEFTAIYRQLADRV 349


>gi|303256179|ref|ZP_07342195.1| mrP protein [Burkholderiales bacterium 1_1_47]
 gi|331001235|ref|ZP_08324861.1| mrp family protein [Parasutterella excrementihominis YIT 11859]
 gi|302860908|gb|EFL83983.1| mrP protein [Burkholderiales bacterium 1_1_47]
 gi|329568962|gb|EGG50758.1| mrp family protein [Parasutterella excrementihominis YIT 11859]
          Length = 357

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 170/244 (69%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           +V+  +AV+SGKGGVGKST   N+A AL+ +G  V +LDADVYGPS P +L I+ K    
Sbjct: 91  SVRNIIAVSSGKGGVGKSTVSANLALALQQEGAKVGLLDADVYGPSQPTMLGITDKPYSV 150

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K L+P   +G+++ S+  L+D +  MIWRGP+  SA+  +L    W  LD+L++DMPP
Sbjct: 151 DGKTLEPMVAHGLQVASVGVLIDPDQPMIWRGPLAVSALQQLLKQTNWKDLDYLIVDMPP 210

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  L+++Q++PL+G V+V+TPQD+AL+D ++ + M++K+N+PI+G+IENM+  + S 
Sbjct: 211 GTGDIQLSLSQEVPLTGAVVVTTPQDIALMDARKGLVMFEKVNVPILGIIENMATHICSK 270

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG GGA   A + G+  L  +P D+++R+  D G PIV+ + +S  ++ Y+EI
Sbjct: 271 CGHEEHIFGEGGAAKMAAQYGVELLGELPLDINIRLSMDKGEPIVISDPDSKVAQAYREI 330

Query: 333 SDRI 336
           + ++
Sbjct: 331 ARKL 334


>gi|261416340|ref|YP_003250023.1| ATPase-like, ParA/MinD [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261372796|gb|ACX75541.1| ATPase-like, ParA/MinD [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302327051|gb|ADL26252.1| ATP-binding protein, Mrp/Nbp35 family [Fibrobacter succinogenes
           subsp. succinogenes S85]
          Length = 375

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 125/345 (36%), Positives = 194/345 (56%), Gaps = 12/345 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           Q+ +  I+ +L+ +  P    NIVE+  +  + I    V   + +           +   
Sbjct: 2   QLNEQNILSALRAVQDPDLHKNIVELNFVQNLKIEGTKVSFDLKLTTPACPIRDRFKDQC 61

Query: 63  QQIIQNIPTVKNAVVTLTENKN----------PPQQRNNLNVKKFVAVASGKGGVGKSTT 112
             I++++   +   VTLT ++            PQ  +   V   VAVASGKGGVGKST 
Sbjct: 62  ITIVKSLGATE-VEVTLTSSQGRVGDDNSAAKAPQNSHIGEVAHVVAVASGKGGVGKSTV 120

Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKE-NYGIKIMSMA 171
             N+A AL   G  V ILDAD+YGPS+  +  I    E+ +   + P E   GI I+SM 
Sbjct: 121 TANLAMALSLSGARVGILDADIYGPSMGLMFGIDKAPEVFEDNTIAPVEAKGGISIVSMC 180

Query: 172 SLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVV 231
              D + A IWRGPMV   I H +H+V WG+LD+LL+D PPGTGD  LT+ Q  P++G V
Sbjct: 181 MFADSDKATIWRGPMVSQMIQHFIHHVRWGKLDYLLVDFPPGTGDIQLTLTQNCPMAGAV 240

Query: 232 IVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEK 291
           +V+TPQ +AL D ++ I+M+  + +P+IG++ENMSYF+  + GK +++F  GG +  AEK
Sbjct: 241 VVTTPQQVALADCQKGIAMFDNVGVPVIGIVENMSYFICDECGKHHNIFPAGGGQKIAEK 300

Query: 292 IGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            G+P +  VP +  V    D G P V+   NS +++++ + ++++
Sbjct: 301 WGVPLIGKVPMEPAVADCGDCGTPAVLRYPNSESAKVFMDAAEKM 345


>gi|327399059|ref|YP_004339928.1| ParA/MinD-like ATPase [Hippea maritima DSM 10411]
 gi|327181688|gb|AEA33869.1| ATPase-like, ParA/MinD [Hippea maritima DSM 10411]
          Length = 340

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 123/339 (36%), Positives = 209/339 (61%), Gaps = 12/339 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITV----PHTIAHQLQSLRS 60
           +K+++++ L  +  PG+ ++I++   L ++ +  + V + + +      ++   L+    
Sbjct: 1   MKDRVINELSRVFYPGKTHSIIKEGVLDDVVVEGSKVIVKLKLNSDEKDSVVELLKKSIP 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACAL 120
            + + ++ I  V+  +  + + +N        ++K  +A  SGKGGVGKST  VN A AL
Sbjct: 61  MSLKKLEGIEDVELVIEKIVDEENKLS-----HIKHVIATTSGKGGVGKSTVSVNTALAL 115

Query: 121 KNKGKNVAILDADVYGPSIPKLLKISGK---VEISDKKFLKPKENYGIKIMSMASLVDEN 177
              G  V +LDAD+YGP+IP ++ I G    +++  K  + P E YGIKI+S+ +LV ++
Sbjct: 116 AKFGYKVGLLDADIYGPNIPTMMGIEGTPITIDLKYKDKILPIEKYGIKILSIGNLVPKD 175

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            A+IWRG ++  AI   L +V+WG LDFL++D+PPGTGDA L++AQ   +SG +IV TPQ
Sbjct: 176 AAVIWRGALIHQAIKQFLDDVIWGDLDFLVVDLPPGTGDAQLSLAQLTKVSGGIIVITPQ 235

Query: 238 DLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFL 297
           ++A+ D  RA   ++++NIP IG+IENMSYF+    G + D+F +GGA+  A + G+ FL
Sbjct: 236 NVAMSDAMRAYDFFKRLNIPTIGVIENMSYFICPHCGARTDIFDHGGAKKFANETGLDFL 295

Query: 298 ESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +P D++VR   D G PIV+ N  S  ++ +++++  I
Sbjct: 296 GEIPIDVEVREGGDKGKPIVISNPTSPVAKAFEDVARSI 334


>gi|88801952|ref|ZP_01117480.1| Mrp/Nbp35 family ATP-binding protein [Polaribacter irgensii 23-P]
 gi|88782610|gb|EAR13787.1| Mrp/Nbp35 family ATP-binding protein [Polaribacter irgensii 23-P]
          Length = 379

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 127/346 (36%), Positives = 201/346 (58%), Gaps = 16/346 (4%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           K  +  +L  ++ PGE  ++VE + ++ +    + V + +T+ +      + +     ++
Sbjct: 5   KEDVYKALDTITAPGEGKSLVENKNITNVVAFGDEVEIDVTIGNPTLQAKKKIEGEITKV 64

Query: 66  IQNIPTVKNAV-VTLT-------ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIA 117
           I    + K  V + LT       EN N  + +   N+K  +A+ASGKGGVGKST   N A
Sbjct: 65  IHAKVSEKIVVKINLTVEKTASKENPNKIRGKEIPNIKNIIAIASGKGGVGKSTITANTA 124

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGK----VEISDKKFLKPKENYGIKIMSMASL 173
            +L   G NV +LDADVYGPS   +  +  K    V +  +  +KP ENYG+K++S+   
Sbjct: 125 ISLAKMGFNVGVLDADVYGPSQHIMFDVERKKPLSVNVEGRSKMKPVENYGVKLLSLGFF 184

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
            D   A+IWRGPM   A+  ++ +  WG+LDFLLID+PPGTGD HL+I Q +P+SG V+V
Sbjct: 185 TDPGQAVIWRGPMASKALNQLIFDADWGELDFLLIDLPPGTGDVHLSIVQALPISGAVVV 244

Query: 234 STPQDLALIDVKRAISMYQK--MNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAE 290
           STPQ++AL D ++ ++M+Q+  +N+P++G+IENMSYF   +    KY +FG  GA+  AE
Sbjct: 245 STPQNIALADARKGVAMFQQENINVPVLGIIENMSYFTPEELPNNKYYIFGKDGAKNLAE 304

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            I   FL  +P    +R   D+G P+ +    +A    ++EI+  +
Sbjct: 305 DIKTRFLGEIPLVQSIRESGDVGRPVALQE-GTALENAFKEITKEM 349


>gi|325275203|ref|ZP_08141170.1| hypothetical protein G1E_17935 [Pseudomonas sp. TJI-51]
 gi|324099690|gb|EGB97569.1| hypothetical protein G1E_17935 [Pseudomonas sp. TJI-51]
          Length = 364

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 180/280 (64%), Gaps = 6/280 (2%)

Query: 63  QQIIQNIPTVKNAVVTL----TENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
           Q  I N+  V  A V++      +K   Q     NVK  +AVASGKGGVGKSTT  N+A 
Sbjct: 63  QTAIGNLEGVSGAQVSIDCVVAAHKAQAQVPAMANVKNIIAVASGKGGVGKSTTAANLAL 122

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKIS--GKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           AL  +G  V ILDAD+YGPS   +  I+   + +I ++K+  P + +G+++MSMA L D+
Sbjct: 123 ALAREGARVGILDADIYGPSQGVMFGIAEGTRPQIREQKWFVPIKAHGVEVMSMAFLTDD 182

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           N  M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P++G VIV+TP
Sbjct: 183 NTPMVWRGPMVSGALLQLVTQTAWDDLDYLVIDMPPGTGDIQLTLAQKVPVAGSVIVTTP 242

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QDLAL+D ++ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A + G+  
Sbjct: 243 QDLALLDARKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLASQYGVDL 302

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L S+P  M +R  +D G P  +    S  + +YQE++ ++
Sbjct: 303 LASLPLSMVIREQADNGKPTAIAEPESQIAMVYQELARQV 342


>gi|32033984|ref|ZP_00134240.1| COG0489: ATPases involved in chromosome partitioning
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126208474|ref|YP_001053699.1| putative ATPase [Actinobacillus pleuropneumoniae L20]
 gi|126097266|gb|ABN74094.1| Mrp-like protein [Actinobacillus pleuropneumoniae serovar 5b str.
           L20]
          Length = 365

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 130/347 (37%), Positives = 201/347 (57%), Gaps = 14/347 (4%)

Query: 1   MNQILKNQIVD---SLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS 57
           MNQ+ + Q+ +    L+  + P  + +++ +    +  +    + L +T+P         
Sbjct: 1   MNQLNEQQLSEIKFVLQNFTHPTLQKDLIALNVFKKAELGAGILRLELTMPFAWNSGFAV 60

Query: 58  LRSNAQQIIQNIPTVKNA-------VVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKS 110
           L++  +  ++ +             + TL    N P       VK  +AV SGKGGVGKS
Sbjct: 61  LKTETEAQLKQVTGASEVKWILNYQIATLKRANNHPAVNG---VKNIIAVTSGKGGVGKS 117

Query: 111 TTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMS 169
           TT VN+A ALK +G  V ILDAD+YGPSIP +L    +   S D K + P E YG++  S
Sbjct: 118 TTSVNLALALKAQGAKVGILDADIYGPSIPHMLGAQDQRPTSPDNKHITPIEVYGLQSNS 177

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           +  L+ ++ A IWRGPM  SA+  +L+   W +LD+L+IDMPPGTGD  LT++Q+IP++G
Sbjct: 178 IGYLMADDNATIWRGPMASSALSQLLNETWWTELDYLVIDMPPGTGDIQLTLSQQIPVTG 237

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEA 289
            V+V+TPQD+AL+D  + ISM+QK+++P++G+IENMS  +  + G   D+FG GGA   A
Sbjct: 238 AVVVTTPQDIALLDAVKGISMFQKVSVPVLGIIENMSVHICQNCGHHEDIFGTGGAEKVA 297

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           +K G   L  +P  + +R   D G P VV      TS+ Y E++ ++
Sbjct: 298 KKYGTKVLGQMPLHIRLRQDLDAGTPTVVAAPEHETSQAYIELAAKV 344


>gi|50421479|ref|XP_459290.1| DEHA2D18524p [Debaryomyces hansenii CBS767]
 gi|49654957|emb|CAG87464.1| DEHA2D18524p [Debaryomyces hansenii]
          Length = 313

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 165/243 (67%)

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISD 153
           V K + V+S KGGVGKST  +NIA AL+  GK V +LD DV+GPSIP+LL +SG+  IS+
Sbjct: 66  VNKILLVSSAKGGVGKSTVSINIALALQGLGKKVGVLDTDVFGPSIPRLLNLSGEPRISE 125

Query: 154 KKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPG 213
              L P  NYG++ MSM  L+    A++WRG MV  A+  +L  V W  LD+L++DMPPG
Sbjct: 126 DGKLIPLTNYGVESMSMGYLIKPENAVVWRGLMVMKALQQLLFEVKWTNLDYLVVDMPPG 185

Query: 214 TGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDT 273
           TGD  LTI+Q++ + G +IV+TPQD+ALID  + I+M+ K+NIPI+G+++NMSYFL  + 
Sbjct: 186 TGDTQLTISQQLKVDGSIIVTTPQDIALIDAVKGIAMFNKVNIPILGLVQNMSYFLCPNC 245

Query: 274 GKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEIS 333
             +  +FG  GAR EAE   +  L S+P + ++   SD G P++V N  S  S+ Y +I+
Sbjct: 246 NHESHIFGTDGARREAENHHLDVLGSIPLNEEICTQSDKGKPVIVSNPGSKISQPYIDIA 305

Query: 334 DRI 336
            ++
Sbjct: 306 QKV 308


>gi|194334613|ref|YP_002016473.1| hypothetical protein Paes_1814 [Prosthecochloris aestuarii DSM 271]
 gi|194312431|gb|ACF46826.1| protein of unknown function DUF59 [Prosthecochloris aestuarii DSM
           271]
          Length = 363

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 133/354 (37%), Positives = 211/354 (59%), Gaps = 21/354 (5%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVH-NTVYLSITVPHTIAHQLQSLR 59
           M+ I ++Q++++L  +  P  K ++V +  + +I I   N +  S+ +          +R
Sbjct: 1   MSTIQESQVIEALSTVMEPDLKKDLVSLGMVQDITIDESNNISFSVVLTTPACPMKDRIR 60

Query: 60  SNAQQIIQN-IPTVKN------AVVTLTENKNPPQQRNNL--NVKKFVAVASGKGGVGKS 110
            +    ++N IP          A VT   +     +R+N    V+  +AVASGKGGVGKS
Sbjct: 61  QSCISAVKNHIPEAAAITVNLPAKVTSGGSCGHHGERDNPLPGVRNIIAVASGKGGVGKS 120

Query: 111 TTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI-SGKVEISDKKFLKPKENYGIKIMS 169
           T  VN+A +L   G +V ++DAD+YGPSIP +  + + + E+ +K  + P E YG+K+MS
Sbjct: 121 TVAVNLAVSLAKTGASVGLIDADLYGPSIPTMFGLENARPEVINKSII-PLEKYGVKLMS 179

Query: 170 MASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSG 229
           +  LV+ +  +IWRGPM  +AI   + +V WG+LD+L+ D+PPGTGD  LT+ Q +P++G
Sbjct: 180 IGFLVESDTPVIWRGPMASTAIKQFITDVAWGELDYLIFDLPPGTGDIQLTLVQTVPVNG 239

Query: 230 VVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEA 289
            VIV+TPQD+AL DV +A++M++K+++P++G++ENMSY+L  D  K Y    +GG RF A
Sbjct: 240 AVIVTTPQDVALADVSKAVTMFRKVDVPLLGLVENMSYYLLPDGSKDYIFGRSGGERF-A 298

Query: 290 EKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS--------ATSEIYQEISDR 335
           +   IP L SVP    VR   D G P+ + +  S        A  E+ ++IS R
Sbjct: 299 KAQAIPLLGSVPIGGVVREGGDSGKPVAIEHPESEPAAAFLQAAREVARQISIR 352


>gi|320161222|ref|YP_004174446.1| hypothetical protein ANT_18200 [Anaerolinea thermophila UNI-1]
 gi|319995075|dbj|BAJ63846.1| hypothetical protein ANT_18200 [Anaerolinea thermophila UNI-1]
          Length = 359

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 128/340 (37%), Positives = 205/340 (60%), Gaps = 9/340 (2%)

Query: 2   NQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS-LRS 60
           + + K  ++ +L  +  P    ++V +  + ++ I    V   I +  T A  L+S + +
Sbjct: 3   SAVTKEAVLQALSHVQEPELHKDLVTLGMVRDVEIEAGKVRFRIVL-TTPACPLKSRIEN 61

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRN----NLNVKKFVAVASGKGGVGKSTTVVNI 116
            A+  + ++  V+   V L + + P   RN    +L V+  VAVASGKGGVGKST  VN+
Sbjct: 62  EARSAVLSLSGVQEVEVIL-DAQVPSDGRNRGVLSLPVRNVVAVASGKGGVGKSTVAVNL 120

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           A +L   G  V +LDAD+YGP+IP ++ +  ++   + + L P E YG+++MS+  LV  
Sbjct: 121 AVSLAQSGARVGLLDADIYGPNIPTMMGVQ-RLPPQNGQKLIPAEAYGVQVMSIGFLVKP 179

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
              +IWRGPM+ SAI   L +V W +LD++++D+PPGTGDA L++AQ +PLSG VIV+ P
Sbjct: 180 GQPLIWRGPMLHSAIRQFLADVAWNELDYMIVDLPPGTGDAQLSLAQSVPLSGGVIVTLP 239

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           Q ++  D  R + M++++N+P++G+IENMSY    D G + D+FG GG    A+   +PF
Sbjct: 240 QRVSQEDAMRGLQMFRELNVPVLGVIENMSYLELPD-GTRMDIFGTGGGEDLAQAAEVPF 298

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L ++P D  VRV  D G+P+V+    SA +     I+ +I
Sbjct: 299 LGAIPIDPGVRVGGDQGVPVVISAPQSAPARALTAIAQKI 338


>gi|76810758|ref|YP_332624.1| putative ATP-binding protein [Burkholderia pseudomallei 1710b]
 gi|167823193|ref|ZP_02454664.1| putative ATP-binding protein [Burkholderia pseudomallei 9]
 gi|217420183|ref|ZP_03451689.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 576]
 gi|226194342|ref|ZP_03789940.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei Pakistan 9]
 gi|254298275|ref|ZP_04965727.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 406e]
 gi|76580211|gb|ABA49686.1| putative ATP-binding protein [Burkholderia pseudomallei 1710b]
 gi|157808406|gb|EDO85576.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 406e]
 gi|217397487|gb|EEC37503.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 576]
 gi|225933427|gb|EEH29416.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei Pakistan 9]
          Length = 362

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 115/241 (47%), Positives = 165/241 (68%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NVK  VAVASGKGGVGKSTT VN+A AL  +G +V +LDAD+YGPS+P +L I  + E  
Sbjct: 96  NVKNIVAVASGKGGVGKSTTAVNLALALAAEGASVGMLDADIYGPSLPTMLGIHERPESP 155

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K + P   +G++  S+  LV E+  M+WRGPM  SA+  +L    W  LD+L++DMPP
Sbjct: 156 DNKSMNPLVGHGLQANSIGFLVGEDNPMVWRGPMATSALEQLLRQTNWRDLDYLIVDMPP 215

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQ++P++G VIV+TPQD+AL+D K+ + M++K+NIPI+G++ENMS  + S+
Sbjct: 216 GTGDIQLTLAQRVPVTGAVIVTTPQDIALLDAKKGLKMFEKVNIPILGIVENMSIHVCSN 275

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG GGA   A + G+  L S+P D+ +R  +D G P V  + +   +E Y  I
Sbjct: 276 CGHEEHVFGAGGAERMAREYGVAVLGSLPLDIRIREQADSGAPTVAADPHGKLAERYCAI 335

Query: 333 S 333
           +
Sbjct: 336 A 336


>gi|77164487|ref|YP_343012.1| hypothetical protein Noc_0972 [Nitrosococcus oceani ATCC 19707]
 gi|254433886|ref|ZP_05047394.1| conserved domain protein [Nitrosococcus oceani AFC27]
 gi|76882801|gb|ABA57482.1| Protein of unknown function DUF59 [Nitrosococcus oceani ATCC 19707]
 gi|207090219|gb|EDZ67490.1| conserved domain protein [Nitrosococcus oceani AFC27]
          Length = 365

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 166/244 (68%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            +K  +AVASGKGGVGKSTT VN+A AL  +G  V +LDAD+YGPS P++L +  + E  
Sbjct: 99  EIKNIIAVASGKGGVGKSTTAVNLALALAAEGATVGMLDADIYGPSQPRMLGVQQRPESR 158

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P  +YGI+ MS+  L+DE   MIWRGPMV SA+  +L +  W  LD+L++D+PP
Sbjct: 159 DGKSIEPVMSYGIQTMSIGFLIDEEEPMIWRGPMVTSALQQLLGDTSWRNLDYLVVDLPP 218

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQ++P+SG VIV+TPQD+AL+D ++ + M++K+ +P++G++ENMS  + S 
Sbjct: 219 GTGDIQLTLAQRVPVSGAVIVTTPQDIALLDARKGLRMFEKVKVPVLGIVENMSIHICSQ 278

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G++  +FG GG    A +  +  L  +P D  +R  +D G P V  +     ++IY++I
Sbjct: 279 CGQEEPIFGEGGGERMAAQYSVALLGQLPLDKRIREDADSGHPSVATDPEGRIAQIYRDI 338

Query: 333 SDRI 336
           +  I
Sbjct: 339 ARHI 342


>gi|317048836|ref|YP_004116484.1| ParA/MinD-like ATPase [Pantoea sp. At-9b]
 gi|316950453|gb|ADU69928.1| ATPase-like, ParA/MinD [Pantoea sp. At-9b]
          Length = 370

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 119/342 (34%), Positives = 202/342 (59%), Gaps = 11/342 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  ++  L     P  ++N+  ++ L  + ++   ++L + +P   A   + L++  
Sbjct: 12  EALRAVVMGVLSGFEHPTLQHNLTTLKALRHVALLDGKLHLELVMPFAWASAFEELKAQT 71

Query: 63  QQIIQNIP-------TVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVN 115
              +  +         +++ + TL   KN P       VK  +AV+SGKGGVGKS+T VN
Sbjct: 72  SGELLRLTQSNAIDWRLRHDIATLKRVKNHP---GATGVKNIIAVSSGKGGVGKSSTAVN 128

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLV 174
           +A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P   +G+   S+  LV
Sbjct: 129 MALALAAEGARVGILDADIYGPSIPNMLGTENERPTSPDGTHMAPIMAHGLATNSIGYLV 188

Query: 175 DENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVS 234
            ++ AM+WRGPM   A+M +L+  +W  LD+L++DMPPGTGD  LT+AQ +P++G ++V+
Sbjct: 189 TDDNAMVWRGPMASKALMQLLNETLWPDLDYLVLDMPPGTGDIQLTLAQNVPVTGALVVT 248

Query: 235 TPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGI 294
           TPQD+ALID ++ I M++K+N+P++G++ENMS  + S+ G    +FG GGA+  A+    
Sbjct: 249 TPQDIALIDARKGIVMFEKVNVPVLGVVENMSIHICSECGHHEPIFGTGGAQKLAQDYNT 308

Query: 295 PFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             L  +P  +++R   D G P V+   +S  + +Y++++ R+
Sbjct: 309 RLLAQLPLHINLREDLDDGEPTVIRRPDSEFTALYRQLAGRV 350


>gi|213583695|ref|ZP_03365521.1| putative ATPase [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-0664]
          Length = 285

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 169/262 (64%), Gaps = 4/262 (1%)

Query: 76  VVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVY 135
           + TL   KN P       VK  +AV+SGKGGVGKS+T VN+A AL+ +G  V +LDAD+Y
Sbjct: 7   IATLKRVKNQPGING---VKNIIAVSSGKGGVGKSSTAVNLALALEAEGAKVGVLDADIY 63

Query: 136 GPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHM 194
           GPSIP +L    +   S D   + P  ++G+   S+  LV ++ AM+WRGPM   A+M M
Sbjct: 64  GPSIPTMLGAEDQRPTSPDGTHMAPIMSHGLATNSIGYLVTDDNAMVWRGPMASKALMQM 123

Query: 195 LHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKM 254
           L   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V+TPQD+ALID K+ I M++K+
Sbjct: 124 LQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVVTTPQDIALIDAKKGIVMFEKV 183

Query: 255 NIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGI 314
            +P++G++ENMS  + S+ G    +FG GGA+  AEK     L  +P  + +R   D G 
Sbjct: 184 EVPVLGIVENMSMHICSNCGHHEPIFGTGGAQKLAEKYHTQLLGQMPLHISLREDLDRGT 243

Query: 315 PIVVHNMNSATSEIYQEISDRI 336
           P VV    S  + IY+E++DR+
Sbjct: 244 PTVVSRPESEFTAIYRELADRV 265


>gi|254421114|ref|ZP_05034838.1| hypothetical protein BBAL3_3424 [Brevundimonas sp. BAL3]
 gi|196187291|gb|EDX82267.1| hypothetical protein BBAL3_3424 [Brevundimonas sp. BAL3]
          Length = 375

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 129/360 (35%), Positives = 194/360 (53%), Gaps = 40/360 (11%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           ++ ++ +L  +  P     +     +  + +  +    ++ V  ++      +R  A+  
Sbjct: 21  RSAVIAALDAVMDPVSGQGLFASGLVQGLVVAEDRAGFALEVDRSLVATYAPVRDAAEAA 80

Query: 66  IQNIPTVKNAVVTLTENKNP----PQQRNN---------------------LNVKKFVAV 100
           ++ +P +    V LT    P    P  R                        +V++ +AV
Sbjct: 81  LKVLPGMNRVSVILTAEAKPGLAKPAARTAGLSKAAVDQGRAKAPVPTDRPAHVRRVLAV 140

Query: 101 ASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPK 160
           ASGKGGVGKST  VN+A AL ++G +V ILDADVYGPS+P +L ISG+    D   + P 
Sbjct: 141 ASGKGGVGKSTVAVNLAVALASRGLSVGILDADVYGPSLPTMLGISGQPAYEDGAIV-PH 199

Query: 161 ENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQ----LDFLLIDMPPGTGD 216
             +G+K MS+  L   + AMIWRGPM   AI  ML    WG     LD L++D+PPGTGD
Sbjct: 200 VAHGMKAMSVGLLTKMDDAMIWRGPMASQAITQMLTQTRWGTAEAPLDVLVVDLPPGTGD 259

Query: 217 AHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKK 276
             LT+ QK PL G VIVSTPQ++AL D +RA +++Q++N+P +G+IENMS          
Sbjct: 260 VQLTLIQKTPLDGAVIVSTPQEVALADARRAHTLFQRVNVPTLGLIENMSGA-------- 311

Query: 277 YDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
             +FG GGA+ EAE++ IPFL  +P D  +R   D G+P V  + +   +  +  ++DRI
Sbjct: 312 --VFGQGGAKAEAERLAIPFLGDLPLDAALRAGGDAGVPTVAADPSGDIAARFAIVADRI 369


>gi|254281769|ref|ZP_04956737.1| ParA family protein [gamma proteobacterium NOR51-B]
 gi|219677972|gb|EED34321.1| ParA family protein [gamma proteobacterium NOR51-B]
          Length = 307

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 112/244 (45%), Positives = 161/244 (65%), Gaps = 2/244 (0%)

Query: 95  KKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKV--EIS 152
           K+ VAVASGKGGVGKST  VN+A AL  +G +V +LDAD+YGPS+  +L ++  V  +  
Sbjct: 40  KRIVAVASGKGGVGKSTVTVNLAVALAERGWSVGLLDADIYGPSMRTMLGVADSVTPDQR 99

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K+L P   +G++ MSM  L +E    +WRGPM   A+M ML   +WG LD LLIDMPP
Sbjct: 100 DGKYLLPITAHGVQAMSMGFLTNERTPSVWRGPMASGALMQMLEQTLWGDLDILLIDMPP 159

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT++QK  L+G VIV+TPQD+AL+D ++ I M+ K+++P++G+IENM+  + + 
Sbjct: 160 GTGDIQLTLSQKTALTGAVIVTTPQDIALLDARKGIEMFAKVDVPVLGIIENMAVHVCAA 219

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    LFG  G +  AE+ G+P L S+P  + +R  +D G P+     +S  +  + E 
Sbjct: 220 CGHSEHLFGEAGGQRLAEEYGVPVLASLPLSITMREYADGGKPLATSLPDSDEARRFFEA 279

Query: 333 SDRI 336
           SDR+
Sbjct: 280 SDRL 283


>gi|163802869|ref|ZP_02196758.1| methionyl-tRNA synthetase [Vibrio sp. AND4]
 gi|159173409|gb|EDP58232.1| methionyl-tRNA synthetase [Vibrio sp. AND4]
          Length = 358

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 166/245 (67%), Gaps = 1/245 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL-KISGKVEI 151
            VK  +AV+S KGGVGKSTT VN+A A+   G  V +LDAD+YGPS+P +L + + K E+
Sbjct: 93  GVKNIIAVSSAKGGVGKSTTAVNLALAIAQSGAKVGLLDADIYGPSVPMMLGQENAKPEV 152

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            D K+++P   +GI   S+  LVD++ A IWRGPM   A+  +L    W +LD+L+IDMP
Sbjct: 153 RDAKWMEPILAHGIYTHSIGYLVDKSEAAIWRGPMASKALSQLLTETDWPELDYLVIDMP 212

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT++Q+IP++G V+V+TPQDLAL+D ++  +M+ K+N+P++G++ENMS+ + S
Sbjct: 213 PGTGDIQLTLSQQIPVTGTVLVTTPQDLALVDARKGAAMFHKVNVPVVGIVENMSFHICS 272

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
             G    +FG GGA   +++ G+  L  +P  + +R   D GIP V     S  ++ Y++
Sbjct: 273 HCGALEHIFGTGGAENMSQEFGLALLGQIPLHISMREDIDAGIPTVARRPKSEHADYYKQ 332

Query: 332 ISDRI 336
           ++DR+
Sbjct: 333 LADRV 337


>gi|261496290|ref|ZP_05992694.1| putative ATPase [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261308052|gb|EEY09351.1| putative ATPase [Mannheimia haemolytica serotype A2 str. OVINE]
          Length = 365

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 128/348 (36%), Positives = 207/348 (59%), Gaps = 16/348 (4%)

Query: 1   MNQILKNQIVDS---LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS 57
           MNQ+ + Q+V+    L+  S P  + +++ +    +  +  + + + IT+P       ++
Sbjct: 1   MNQVNEQQLVEIKAILQQFSHPTLQKDLIALNAFKKAELGGDILRIEITMPFAWNSGFET 60

Query: 58  LRSNAQQIIQNIPTVKNA-------VVTLTE-NKNPPQQRNNLNVKKFVAVASGKGGVGK 109
           L++  +  ++ +             + TL   NK+P        VK  +AV SGKGGVGK
Sbjct: 61  LKAETEAKLKQVTGASGVKWVLNYQIATLKRANKHPAVN----GVKNIIAVTSGKGGVGK 116

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIM 168
           STT VN+A AL+ +G  V ILDAD+YGPSIP +L    +   S D K + P   +G++  
Sbjct: 117 STTSVNLALALRAQGARVGILDADIYGPSIPHMLGAKDQRPTSPDNKHITPITAHGLQSN 176

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           S+  L++E+ A IWRGPM  SA+  +L+   W +LD+L+IDMPPGTGD  LT++Q+IP++
Sbjct: 177 SIGYLMEEDNATIWRGPMASSALSQLLNETWWNELDYLVIDMPPGTGDIQLTLSQQIPVT 236

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFE 288
           G V+V+TPQD+AL+D  + ISM++K+++P++G+IENMS  + S+ G    +FG GGA   
Sbjct: 237 GAVVVTTPQDIALLDAIKGISMFEKVSVPVLGVIENMSMHICSNCGHHEAIFGTGGAEKI 296

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           A+K G   L  +P  + +R   D G+P VV       S+ Y  +++++
Sbjct: 297 AQKYGTKVLAQLPLHIRLREDLDSGVPTVVAAPEHEISQAYLALAEKV 344


>gi|157144943|ref|YP_001452262.1| putative ATPase [Citrobacter koseri ATCC BAA-895]
 gi|157082148|gb|ABV11826.1| hypothetical protein CKO_00672 [Citrobacter koseri ATCC BAA-895]
          Length = 369

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 128/343 (37%), Positives = 201/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 11  ETLRAMVAGTLANFQHPTLKHNLTTLKALHHVAWLDDTLHVELVMPFVWHSAFEVLKEQC 70

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 71  SADLLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 126

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S D   + P  ++G+   S+  L
Sbjct: 127 NLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLATNSIGYL 186

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
           V ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP++G V+V
Sbjct: 187 VTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVTGAVVV 246

Query: 234 STPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293
           +TPQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AE+  
Sbjct: 247 TTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAQKLAEQYR 306

Query: 294 IPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
              L  +P  + +R   D G P V+   +S  + IY+E++ R+
Sbjct: 307 TQLLGQMPLHISLREDLDRGTPTVISRPDSEFTAIYRELAGRV 349


>gi|317968788|ref|ZP_07970178.1| ATPase [Synechococcus sp. CB0205]
          Length = 366

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 119/345 (34%), Positives = 208/345 (60%), Gaps = 24/345 (6%)

Query: 2   NQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSN 61
           +Q LK  +  +L+ L   G   +++++Q + E+ + +N V   + +P   + Q   + ++
Sbjct: 5   DQALKEALA-ALEPLKDAGTGRSLLDLQWIQEVRVQNNRVVFQLALPGYASSQRDRIAAD 63

Query: 62  AQQIIQNIPTVKNAVVTLTEN--KNP----------------PQQRNNLNVKKFVAVASG 103
           A+  +  +  + +  + LT+   + P                P+++    VK+ +AV+SG
Sbjct: 64  ARGALLQLGGIDDVQIELTQATPQAPSQGGAPIGAAGHGGGGPERQAIPGVKQVIAVSSG 123

Query: 104 KGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVE----ISDKKFLKP 159
           KGGVGKST  VN+ACAL  +G  V +LDAD+YGP+ P +L ++ +        + + L P
Sbjct: 124 KGGVGKSTVAVNLACALAQRGLKVGLLDADIYGPNAPTMLGVADQTPQVRGSGNDQVLTP 183

Query: 160 KENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHL 219
            E+ GI ++SM  L+D +  +IWRGPM+   I   L+ V WG+ D L++D+PPGTGDA L
Sbjct: 184 IESCGIAMVSMGLLIDAHQPVIWRGPMLNGIIRQFLYQVEWGERDVLVVDLPPGTGDAQL 243

Query: 220 TIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTG-KKYD 278
           ++AQ +P++GV+IV+TPQ ++L D +R ++M+Q++ +P++G++ENM+ F+  D   K+Y+
Sbjct: 244 SLAQAVPMAGVIIVTTPQMVSLQDARRGLAMFQQLGVPVLGVVENMTAFIPPDAPEKRYE 303

Query: 279 LFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS 323
           LFG+GG +  A++ G+P L  +P ++ V    D G P+ V    S
Sbjct: 304 LFGSGGGQCLADESGVPLLAQLPMELAVVQGGDGGRPVTVSAPES 348


>gi|261493080|ref|ZP_05989619.1| putative ATPase [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261311259|gb|EEY12423.1| putative ATPase [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 365

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 128/348 (36%), Positives = 207/348 (59%), Gaps = 16/348 (4%)

Query: 1   MNQILKNQIVDS---LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS 57
           MNQ+ + Q+V+    L+  S P  + +++ +    +  +  + + + IT+P       ++
Sbjct: 1   MNQLNEQQLVEIKAILQQFSHPTLQKDLIALNAFKKAELGGDILRIEITMPFAWNSGFET 60

Query: 58  LRSNAQQIIQNIPTVKNA-------VVTLTE-NKNPPQQRNNLNVKKFVAVASGKGGVGK 109
           L++  +  ++ +             + TL   NK+P        VK  +AV SGKGGVGK
Sbjct: 61  LKAETEAKLKQVTGASGVKWVLNYQIATLKRANKHPAVN----GVKNIIAVTSGKGGVGK 116

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIM 168
           STT VN+A AL+ +G  V ILDAD+YGPSIP +L    +   S D K + P   +G++  
Sbjct: 117 STTSVNLALALRAQGARVGILDADIYGPSIPHMLGAKDQRPTSPDNKHITPITAHGLQSN 176

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           S+  L++E+ A IWRGPM  SA+  +L+   W +LD+L+IDMPPGTGD  LT++Q+IP++
Sbjct: 177 SIGYLMEEDNATIWRGPMASSALSQLLNETWWNELDYLVIDMPPGTGDIQLTLSQQIPVT 236

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFE 288
           G V+V+TPQD+AL+D  + ISM++K+++P++G+IENMS  + S+ G    +FG GGA   
Sbjct: 237 GAVVVTTPQDIALLDAIKGISMFEKVSVPVLGVIENMSMHICSNCGHHEAIFGTGGAEKI 296

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           A+K G   L  +P  + +R   D G+P VV       S+ Y  +++++
Sbjct: 297 AQKYGTKVLAQLPLHIRLREDLDSGVPTVVAAPEHEISQAYLALAEKV 344


>gi|213961974|ref|ZP_03390239.1| ATP-binding protein, Mrp/Nbp35 family [Capnocytophaga sputigena
           Capno]
 gi|213955327|gb|EEB66644.1| ATP-binding protein, Mrp/Nbp35 family [Capnocytophaga sputigena
           Capno]
          Length = 373

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 125/342 (36%), Positives = 194/342 (56%), Gaps = 39/342 (11%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVP--------------- 48
           I K  ++++L+ ++ PGE  N+V+   +  I +  + V + + +                
Sbjct: 3   IQKKDVLEALRKITAPGEGKNMVDSGAVQNIVVFGDEVVVDVVINNPSLQAKKRTEVEIM 62

Query: 49  ---HTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKG 105
              H   H+   +  N + I   +P +K   +   +N               +AVASGKG
Sbjct: 63  KAIHGEVHEKAKVVVNVKVIAPEVPEIKGKPIPGIQN--------------VIAVASGKG 108

Query: 106 GVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISG----KVEISDKKFLKPKE 161
           GVGKST   N+A AL   G  V +LDADVYGPSIP +  ++G     V I+ K F++P E
Sbjct: 109 GVGKSTVTANLAAALAKMGFKVGVLDADVYGPSIPIMFDVAGNRPQSVAINGKSFIQPIE 168

Query: 162 NYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTI 221
           NYG+KI+S+    + N A+IWRGPM   A+  ++    WG+LDFLLID+PPGTGD HL+I
Sbjct: 169 NYGVKILSIGFFTNANQAVIWRGPMASKALNQLIFESYWGELDFLLIDLPPGTGDIHLSI 228

Query: 222 AQKIPLSGVVIVSTPQDLALIDVKRAISMYQK--MNIPIIGMIENMSYFLASD-TGKKYD 278
            Q +P++G V+VSTPQ +AL D +R ++M+++  +N+P++G++ENM+YF   +    KY 
Sbjct: 229 MQALPITGAVVVSTPQKIALADARRGVAMFEQENINVPVLGIVENMAYFTPEELPNNKYY 288

Query: 279 LFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHN 320
           +FG  GA+  A  + +PFL  +P    +R   D G P V+ +
Sbjct: 289 IFGKEGAKNLAADLNVPFLGEIPLVQGIREAGDEGRPTVLQD 330


>gi|193212090|ref|YP_001998043.1| hypothetical protein Cpar_0421 [Chlorobaculum parvum NCIB 8327]
 gi|193085567|gb|ACF10843.1| protein of unknown function DUF59 [Chlorobaculum parvum NCIB 8327]
          Length = 379

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 116/254 (45%), Positives = 171/254 (67%), Gaps = 3/254 (1%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI 145
           PQ+ +  NVK  +AVASGKGGVGKST  VN+A +L   G  V ++DAD+YGPSIP L  +
Sbjct: 116 PQKIDLPNVKNIIAVASGKGGVGKSTVSVNLAVSLAASGAKVGLIDADLYGPSIPTLFGL 175

Query: 146 SG-KVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLD 204
              K E+ + K + P E +G+K+MS+  LVD   A+IWRGPM  SAI  ++ +V W +LD
Sbjct: 176 QNVKPEVKNNKIM-PIEKFGVKLMSIGFLVDPETALIWRGPMASSAIRQLISDVDWQELD 234

Query: 205 FLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIEN 264
           +L+ D+PPGTGD  LT+ Q +PLSG V+V+TPQD+AL DV +A++M++K+++ I+G++EN
Sbjct: 235 YLIFDLPPGTGDIQLTLVQALPLSGAVVVTTPQDVALADVAKAVTMFRKVDVSILGVVEN 294

Query: 265 MSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSA 324
           MS++   D  K Y +FG GG    A+   +PFL S+P    VR   D+G P ++ N ++ 
Sbjct: 295 MSWYELPDGSKDY-IFGKGGGEKFAKINALPFLGSIPISSKVREGGDIGTPSIIANPDAP 353

Query: 325 TSEIYQEISDRIQQ 338
           TS    +++  I +
Sbjct: 354 TSVAASKVAGEIAR 367


>gi|163858412|ref|YP_001632710.1| putative iron sulfur binding protein [Bordetella petrii DSM 12804]
 gi|163262140|emb|CAP44442.1| putative iron sulfur binding protein [Bordetella petrii]
          Length = 363

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 164/244 (67%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
            V+  +AVASGKGGVGKSTT VN+A AL   G +V ILDAD+YGPS+P +L ISG+    
Sbjct: 95  TVRNIIAVASGKGGVGKSTTAVNLALALAADGAHVGILDADIYGPSVPTMLGISGRPASH 154

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K ++P + +G++  S+  L+D +   IWRGPMV  A   ML    W  LD+L+IDMPP
Sbjct: 155 DNKTMEPLQGHGLQANSIGFLIDADAPAIWRGPMVTQAFEQMLRQTNWRDLDYLVIDMPP 214

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQK+P+ G VIV+TPQDLAL D ++ + M+QK+++PI+G++ENM+  + S 
Sbjct: 215 GTGDLALTLAQKVPVVGAVIVTTPQDLALQDARKGLRMFQKVDVPILGIVENMAVHICSQ 274

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G    +FG GG +  A +   P+L S+P  +D+R  +D G P VV + +   +  Y++I
Sbjct: 275 CGHAEHIFGEGGGQRMAAQYQAPWLGSLPLALDIREQADAGRPSVVADPDGEAARRYRDI 334

Query: 333 SDRI 336
           + ++
Sbjct: 335 ARKL 338


>gi|254190800|ref|ZP_04897307.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei Pasteur 52237]
 gi|157938475|gb|EDO94145.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei Pasteur 52237]
          Length = 418

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 115/241 (47%), Positives = 165/241 (68%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NVK  VAVASGKGGVGKSTT VN+A AL  +G +V +LDAD+YGPS+P +L I  + E  
Sbjct: 152 NVKNIVAVASGKGGVGKSTTAVNLALALAAEGASVGMLDADIYGPSLPTMLGIHERPESP 211

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K + P   +G++  S+  LV E+  M+WRGPM  SA+  +L    W  LD+L++DMPP
Sbjct: 212 DNKSMNPLVGHGLQANSIGFLVGEDNPMVWRGPMATSALEQLLRQTNWRDLDYLIVDMPP 271

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQ++P++G VIV+TPQD+AL+D K+ + M++K+NIPI+G++ENMS  + S+
Sbjct: 272 GTGDIQLTLAQRVPVTGAVIVTTPQDIALLDAKKGLKMFEKVNIPILGIVENMSIHVCSN 331

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG GGA   A + G+  L S+P D+ +R  +D G P V  + +   +E Y  I
Sbjct: 332 CGHEEHVFGAGGAERMAREYGVAVLGSLPLDIRIREQADSGAPTVAADPHGKLAERYCAI 391

Query: 333 S 333
           +
Sbjct: 392 A 392


>gi|224372398|ref|YP_002606770.1| ATP/GTP-binding protein [Nautilia profundicola AmH]
 gi|223590021|gb|ACM93757.1| ATP/GTP-binding protein [Nautilia profundicola AmH]
          Length = 371

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 136/347 (39%), Positives = 210/347 (60%), Gaps = 19/347 (5%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSIT--VPHTIAHQLQSLRSNA 62
           +K++I + L+ +  PG K ++V+   + +I +  +     IT  +P T     Q L  + 
Sbjct: 1   MKDKIKELLQNVIYPGFKKSVVDFGFVKDIEVSEDGKQAIITYQIPSTDDEVAQKLNDS- 59

Query: 63  QQIIQNIPTVK----NAVVTLTENKNPPQQRNN-----LNVKKFVAVASGKGGVGKSTTV 113
                 I T+K     A V +   K P +  +       NVK FV V+SGKGGVGKSTT 
Sbjct: 60  -----TIDTLKAEGIEASVNIIRPKKPRETSSRGVNKMPNVKSFVMVSSGKGGVGKSTTS 114

Query: 114 VNIACALKNKGKNVAILDADVYGPSIPKLLKISG-KVEISDKKFLKPKENYGIKIMSMAS 172
           VN+A AL  +GK V ILD D+YGP+I ++L +   K E+   K +KP ENYG+K +SMA+
Sbjct: 115 VNLALALAKQGKKVGILDGDIYGPNISRMLGMQDRKPEVVGNK-VKPFENYGVKFISMAN 173

Query: 173 LVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVI 232
           L+ E  A++WRG M+  A+   + +V WG+LD L+IDMPPGTGDA +T+AQ++P++  V 
Sbjct: 174 LLPEGKALMWRGAMLVKALQQFMEDVDWGELDILVIDMPPGTGDAQMTMAQQVPVTAGVA 233

Query: 233 VSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKI 292
           V+TPQ +A+ D KR++ M+++++IPI G+IENMS F+  + G+KYD+FG+G A   A   
Sbjct: 234 VTTPQTVAVDDAKRSMDMFKQLHIPIAGVIENMSGFICPNCGEKYDIFGSGAAEKLANDY 293

Query: 293 GIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQF 339
               L  +P +  +R   D G PIVV    S +++ + + +  + +F
Sbjct: 294 DTKILAKIPIEPAIREGGDKGEPIVVSRPESESAKEFSKAAKELIEF 340


>gi|238761090|ref|ZP_04622067.1| hypothetical protein ykris0001_34350 [Yersinia kristensenii ATCC
           33638]
 gi|238761343|ref|ZP_04622319.1| hypothetical protein ykris0001_20760 [Yersinia kristensenii ATCC
           33638]
 gi|238700317|gb|EEP93058.1| hypothetical protein ykris0001_20760 [Yersinia kristensenii ATCC
           33638]
 gi|238700570|gb|EEP93310.1| hypothetical protein ykris0001_34350 [Yersinia kristensenii ATCC
           33638]
          Length = 370

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 123/338 (36%), Positives = 200/338 (59%), Gaps = 5/338 (1%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           +L+ QI   +     P  + ++ E++ +    ++ N +++ + +P        +L+ +  
Sbjct: 13  LLQLQISKVIATFKHPTLQKSLTELRAIHHCALLDNVLHIELVMPFAWQFGFDALKESVS 72

Query: 64  QIIQNIPTVKNAVVTLTENKNPPQQRNNL----NVKKFVAVASGKGGVGKSTTVVNIACA 119
             +  +   K     L+ N    ++ N+      V+  VAV+SGKGGVGKS+T VN+A A
Sbjct: 73  GELLAVTGAKAIDWKLSHNITTLKRANDQPGVKGVRNIVAVSSGKGGVGKSSTAVNLALA 132

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENV 178
           L  +G  V ILDAD+YGPSIP +L  + +   S D K + P   +GI   S+  LV +  
Sbjct: 133 LAEEGAKVGILDADIYGPSIPNMLGTTQQRPTSPDGKHMAPIMAHGIATNSIGYLVTDEN 192

Query: 179 AMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQD 238
           AM+WRGPM   A+M ML + +W  LD+L+IDMPPGTGD  LT++Q IP++G ++V+TPQD
Sbjct: 193 AMVWRGPMASKALMQMLQDTLWPDLDYLVIDMPPGTGDIQLTLSQNIPVTGALVVTTPQD 252

Query: 239 LALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLE 298
           +ALID  + I M++K+++P++G+IENMS  + S+ G    +FG GGA   A+K     L 
Sbjct: 253 IALIDAMKGIVMFEKVHVPVLGIIENMSMHICSNCGHLEPIFGTGGAEKLAQKYHCKLLG 312

Query: 299 SVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            +P  + +R   D G P VV + +S  ++IY++++  +
Sbjct: 313 QIPLHISLREDLDRGEPTVVSHPDSEFADIYRQLASNV 350


>gi|254258941|ref|ZP_04949995.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 1710a]
 gi|254217630|gb|EET07014.1| CobQ/CobB/MinD/ParA nucleotide binding protein [Burkholderia
           pseudomallei 1710a]
          Length = 396

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 115/241 (47%), Positives = 165/241 (68%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS 152
           NVK  VAVASGKGGVGKSTT VN+A AL  +G +V +LDAD+YGPS+P +L I  + E  
Sbjct: 130 NVKNIVAVASGKGGVGKSTTAVNLALALAAEGASVGMLDADIYGPSLPTMLGIHERPESP 189

Query: 153 DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212
           D K + P   +G++  S+  LV E+  M+WRGPM  SA+  +L    W  LD+L++DMPP
Sbjct: 190 DNKSMNPLVGHGLQANSIGFLVGEDNPMVWRGPMATSALEQLLRQTNWRDLDYLIVDMPP 249

Query: 213 GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASD 272
           GTGD  LT+AQ++P++G VIV+TPQD+AL+D K+ + M++K+NIPI+G++ENMS  + S+
Sbjct: 250 GTGDIQLTLAQRVPVTGAVIVTTPQDIALLDAKKGLKMFEKVNIPILGIVENMSIHVCSN 309

Query: 273 TGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEI 332
            G +  +FG GGA   A + G+  L S+P D+ +R  +D G P V  + +   +E Y  I
Sbjct: 310 CGHEEHVFGAGGAERMAREYGVAVLGSLPLDIRIREQADSGAPTVAADPHGKLAERYCAI 369

Query: 333 S 333
           +
Sbjct: 370 A 370


>gi|315126747|ref|YP_004068750.1| MinD/MRP family ATPase [Pseudoalteromonas sp. SM9913]
 gi|315015261|gb|ADT68599.1| MinD/MRP family ATPase [Pseudoalteromonas sp. SM9913]
          Length = 358

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 117/254 (46%), Positives = 170/254 (66%), Gaps = 2/254 (0%)

Query: 77  VTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYG 136
           V +T N +  +      +K  V VASGKGGVGKSTT VN+A +LKN+G  V ILDAD+YG
Sbjct: 79  VNVTANVHLKEAAKFKAIKHIVLVASGKGGVGKSTTAVNLAGSLKNEGAKVGILDADIYG 138

Query: 137 PSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHML 195
           PSIP LL + G   ++ D K L+P +  GIK  S+  LV  + A +WRGPM   A+  +L
Sbjct: 139 PSIPMLLGLVGSEPVTKDNKQLQPFDANGIKAQSIGFLVPSDDATVWRGPMASGALSQLL 198

Query: 196 HNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMN 255
           +   WG+LD+L++DMPPGTGD  LT++QK+P SG VIV+TPQDLAL D ++ I+M+ K+N
Sbjct: 199 NETDWGELDYLIVDMPPGTGDIQLTMSQKVPASGTVIVTTPQDLALADAQKGIAMFNKVN 258

Query: 256 IPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIP 315
           +P++G+IENMS+++    G+   +FG  GA+  A K G+P L  +P  +D+R  S+ G  
Sbjct: 259 VPVLGLIENMSHYICGHCGEANHVFGKDGAQKLALKHGVPVLSHIPLAIDIRESSEQG-K 317

Query: 316 IVVHNMNSATSEIY 329
           ++  + ++  S+ Y
Sbjct: 318 LIADDTDAVISKTY 331


>gi|325954759|ref|YP_004238419.1| ATPase-like, ParA/MinD [Weeksella virosa DSM 16922]
 gi|323437377|gb|ADX67841.1| ATPase-like, ParA/MinD [Weeksella virosa DSM 16922]
          Length = 367

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 134/347 (38%), Positives = 201/347 (57%), Gaps = 21/347 (6%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQI 65
           ++QI + L+ L I   +N +   Q + E  I      L I  P    H+ + L    +  
Sbjct: 5   RDQINEVLESLGI---RNWMRNAQVMGEKII------LDIASPTPTMHERKRLEVAIRNA 55

Query: 66  I-QNIPTVK---NAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALK 121
             +++P  +   N  V + E  N  +      VK  +AVASGKGGVGKST   N+A +L 
Sbjct: 56  FREHLPEAELQLNITVEVEEKPNEIKGNPLPGVKNIIAVASGKGGVGKSTMASNLAISLA 115

Query: 122 NKGKNVAILDADVYGPSIPKLLKISG----KVEISDKKFLKPKENYGIKIMSMASLVDEN 177
             G  V +LDAD+YGPS+P +  +       VE++ K  +KP ENYG+K++S+    D +
Sbjct: 116 KMGFKVGLLDADIYGPSMPIMFDVEDAKPFSVEVNGKTKIKPVENYGVKLLSIGFFADTD 175

Query: 178 VAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQ 237
            A++WRGPM   A+  ML +  WG+LDFLLID+PPGTGD HL+I Q+IPL+G V+VSTPQ
Sbjct: 176 QAIVWRGPMAAKALNQMLRDAHWGELDFLLIDLPPGTGDIHLSIVQQIPLTGAVVVSTPQ 235

Query: 238 DLALIDVKRAISMY--QKMNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAEKIGI 294
            +AL D ++ + M+  + +N+P++G++ENM+YF   +    KY +FG  GA+  AE +G+
Sbjct: 236 PIALADARKGVGMFAMEAINVPVLGIVENMAYFTPEELPNNKYYIFGQNGAKNLAEDLGV 295

Query: 295 PFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV 341
           PFL  VP    +R  +D+G P  +   N+  + IY  I+    Q  V
Sbjct: 296 PFLGEVPIIQSIREAADVGRPASLQE-NTIAANIYANIARNTVQSLV 341


>gi|91762862|ref|ZP_01264827.1| probable ATPase [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718664|gb|EAS85314.1| probable ATPase [Candidatus Pelagibacter ubique HTCC1002]
          Length = 291

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 127/286 (44%), Positives = 174/286 (60%), Gaps = 11/286 (3%)

Query: 60  SNAQQIIQNIPTVKNAVVTLTE----NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVN 115
           SN + +    P + +A+    E     KNP      L  K  +AV+S KGGVGKST   N
Sbjct: 13  SNDKNMTDKKPELSDAMKKKLEPRKFTKNP-----ILGTKFTIAVSSAKGGVGKSTFATN 67

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVD 175
           +A ALK  G  V +LDAD+YGPSIPK+  I+ K + SD + L P   Y I+ MS+  L D
Sbjct: 68  LALALKQIGCKVGLLDADIYGPSIPKMFDINEKPK-SDGQTLTPITKYDIQCMSIGFLAD 126

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
           +   MIWRGPMV SAI      V W  LDF+++DMPPGTGD  LT +Q+I + G +IVST
Sbjct: 127 QQTPMIWRGPMVTSAIKTFTQKVGWKDLDFIIVDMPPGTGDTQLTFSQEIKMDGAIIVST 186

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQ++AL+DVKR I M+ K+ + I+G+++NMSYF   D GKKY +FG GG +  AE+    
Sbjct: 187 PQEVALLDVKRGIKMFDKLGVKILGLVDNMSYFTGDD-GKKYKIFGEGGVKRTAEEFEKE 245

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV 341
           FL  +P + +V    D G PIV  N     S+IY + + +I+  ++
Sbjct: 246 FLGEIPINPEVGKCGDEGKPIVEANPEHEISKIYLDFARKIKSTYL 291


>gi|78189609|ref|YP_379947.1| ATP-binding Mrp/Nbp35 family protein [Chlorobium chlorochromatii
           CaD3]
 gi|78171808|gb|ABB28904.1| ATP-binding protein, Mrp/Nbp35 family [Chlorobium chlorochromatii
           CaD3]
          Length = 305

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 170/245 (69%), Gaps = 3/245 (1%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK-ISGKVEI 151
           ++K  +A+ASGKGGVGKST  VN+A +L   G  V ++DAD+YGPSIP +   ++ K E+
Sbjct: 47  HIKHKIAIASGKGGVGKSTFAVNLAVSLAQSGAKVGLIDADLYGPSIPTMFGLVNEKPEV 106

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
            ++K L+P E YG+K+MS+  L+D    +IWRGPM  SAI   + +V W +LD+LL D+P
Sbjct: 107 FEQK-LQPLEKYGVKLMSVGFLIDSETPVIWRGPMASSAIKQFITDVAWPELDYLLFDLP 165

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  +T+AQ +P++G VIV+TPQD+A+ DV +A+SM++K+N+P++G+ ENMSY+   
Sbjct: 166 PGTGDIQITLAQTLPMTGAVIVTTPQDVAISDVAKAVSMFRKVNVPLLGLAENMSYYQLP 225

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
           D  K +     GG +F A+  G+PFL  +P +  VR   D G+P V+ +  SAT++ + +
Sbjct: 226 DGTKDFIFGTKGGEKF-AKIQGVPFLGELPIERAVREGGDSGVPCVIEHPESATAKAFAQ 284

Query: 332 ISDRI 336
           I+  +
Sbjct: 285 IAREV 289


>gi|71082718|ref|YP_265437.1| ATPase [Candidatus Pelagibacter ubique HTCC1062]
 gi|71061831|gb|AAZ20834.1| probable ATPase [Candidatus Pelagibacter ubique HTCC1062]
          Length = 291

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 127/286 (44%), Positives = 174/286 (60%), Gaps = 11/286 (3%)

Query: 60  SNAQQIIQNIPTVKNAVVTLTE----NKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVN 115
           SN + +    P + +A+    E     KNP      L  K  +AV+S KGGVGKST   N
Sbjct: 13  SNDKNMTDKKPELSDAMKKKLEPRKFTKNP-----ILGTKFTIAVSSAKGGVGKSTFATN 67

Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVD 175
           +A ALK  G  V +LDAD+YGPSIPK+  I+ K + SD + L P   Y I+ MS+  L D
Sbjct: 68  LALALKQIGCKVGLLDADIYGPSIPKMFDINEKPK-SDGQTLTPITKYDIQCMSIGFLAD 126

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
           +   MIWRGPMV SAI      V W  LDF+++DMPPGTGD  LT +Q+I + G +IVST
Sbjct: 127 QQTPMIWRGPMVTSAIKTFTQKVGWKDLDFIIVDMPPGTGDTQLTFSQEIKMDGAIIVST 186

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQ++AL+DVKR I M+ K+ + I+G+++NMSYF   D GKKY +FG GG +  AE+    
Sbjct: 187 PQEVALLDVKRGIKMFDKLGVKILGLVDNMSYFTGDD-GKKYKIFGEGGVKRTAEEFEKE 245

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV 341
           FL  +P + +V    D G PIV  N     S+IY + + +I+  ++
Sbjct: 246 FLGEIPINPEVGKCGDEGKPIVEANPEHEISKIYLDFARKIKSTYL 291


>gi|119383333|ref|YP_914389.1| putative Mrp (multidrug resistance-associated proteins) family
           protein [Paracoccus denitrificans PD1222]
 gi|119373100|gb|ABL68693.1| putative Mrp (multidrug resistance-associated proteins) family
           protein [Paracoccus denitrificans PD1222]
          Length = 367

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 130/362 (35%), Positives = 208/362 (57%), Gaps = 32/362 (8%)

Query: 4   ILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63
           I + ++++ L  +++PG   N+V    +  + +    V   I      A  L  + + AQ
Sbjct: 3   ISRERVLEELARIAVPG-GGNLVSADLVRALSVESGVVRFVIEAADAAARSLGPVEAEAQ 61

Query: 64  ------------QIIQNIPTV--------------KNAVVTLTENKNPPQQRNNL---NV 94
                       QI+   PTV              + A  +L   ++P  Q        V
Sbjct: 62  RALSALPGVEKVQIVTTAPTVPRGAAPQVTARSGGEGAPPSLKIGRHPTPQAGPAPVSGV 121

Query: 95  KKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDK 154
            + +A+ SGKGGVGKST   N+A AL  KG+ V +LDAD+YGPS P++L ++G+   SD 
Sbjct: 122 ARILAIGSGKGGVGKSTLTSNLAVALARKGRRVGLLDADIYGPSQPRMLGLTGQRPTSDG 181

Query: 155 KFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGT 214
           + ++P   +G+ +MS+  ++ E  A++WRGPM+  A+  ML+ V WG+LD LL+D+PPGT
Sbjct: 182 QMIEPLHAHGVTVMSLGLMMKEGEAVVWRGPMLMGALQQMLNQVKWGELDVLLVDLPPGT 241

Query: 215 GDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTG 274
           GD  L++ QK  +SG +IVSTPQD+ALID +RAI M+ K+  P++G++ENMS ++  + G
Sbjct: 242 GDVQLSLCQKAQVSGAIIVSTPQDVALIDARRAIDMFDKLKTPVLGLVENMSTYICPNCG 301

Query: 275 KKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISD 334
            +  LFG+GG   EA  +G+PFL  +P ++D+R+  D G PI   +   A S  +  +++
Sbjct: 302 HEAHLFGHGGVAAEAAALGLPFLGEIPLNLDLRLSGDAGTPIAAGDGPVAQS--FARLAE 359

Query: 335 RI 336
           R+
Sbjct: 360 RL 361


>gi|257388627|ref|YP_003178400.1| hypothetical protein Hmuk_2587 [Halomicrobium mukohataei DSM 12286]
 gi|257170934|gb|ACV48693.1| protein of unknown function DUF59 [Halomicrobium mukohataei DSM
           12286]
          Length = 351

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 119/330 (36%), Positives = 196/330 (59%), Gaps = 8/330 (2%)

Query: 9   IVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68
           + + L+ +  P  +++IV +  ++EI I   ++ + + +    +    ++ ++ ++ + +
Sbjct: 6   VRERLREVRDPDLRDDIVSLGLVNEIEIDDASIAVDLALGAPYSPNETAIAADVREALDD 65

Query: 69  IPTVKNAVVTLTENKNPPQQRNNL---NVKKFVAVASGKGGVGKSTTVVNIACALKNKGK 125
                +  + LT N +            VK  +AVASGKGGVGKST  VN+A  L   G 
Sbjct: 66  ----DDREIELTANVDRGMDAEGTVLPGVKNVIAVASGKGGVGKSTLAVNLAVGLSELGA 121

Query: 126 NVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGP 185
            V + DADVYGP++P+++      + ++   + P E YGIK+MSM  LV E+  +IWRGP
Sbjct: 122 QVGLFDADVYGPNVPRMVAADEHPQATEDDQIIPPEKYGIKLMSMDFLVGEDDPVIWRGP 181

Query: 186 MVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVK 245
           MV S +  +  +VVWG LD+++ID+PPGTGD  LT+ Q IP++G  IV+TPQ +AL D +
Sbjct: 182 MVDSVLTQLWEDVVWGSLDYMVIDLPPGTGDTQLTMLQNIPVTGATIVTTPQTVALDDAR 241

Query: 246 RAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMD 305
           + + M+ +   P++G++ENMS F   D G ++D+F +GG R  +E+  +PFL  +P D  
Sbjct: 242 KGLEMFGRHETPVLGLVENMSTFTCPDCGGEHDIFDSGGGREFSEETDLPFLGEIPLDPA 301

Query: 306 VRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
           VR   D G P+V+ + +S T E ++E   R
Sbjct: 302 VREGGDDGEPMVL-DEDSETGEAFREFVHR 330


>gi|168229504|ref|ZP_02654562.1| mrp protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|194470059|ref|ZP_03076043.1| mrp protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194456423|gb|EDX45262.1| mrp protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|205335925|gb|EDZ22689.1| mrp protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
          Length = 369

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 198/341 (58%), Gaps = 13/341 (3%)

Query: 5   LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQ 64
           L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+     
Sbjct: 13  LRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWNSAFEVLKEQCSA 72

Query: 65  IIQNIPTVKNA-------VVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVVNI 116
            +  I   K         + TL   KN P     +N VK  +AV+SGKGGVGKS+T VN+
Sbjct: 73  DLLRITGAKAIDWKLSYNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAVNL 128

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASLVD 175
           A AL  +G  V +LDAD+YGPSIP +L    +   S D   + P  ++G+   S+  LV 
Sbjct: 129 ALALAAEGAKVGVLDADIYGPSIPTMLGAEDQRPTSPDGTHMAPIMSHGLATNSIGYLVT 188

Query: 176 ENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVST 235
           ++ AM+WRGPM   A+M ML   +W  LD+L++DMPPGTGD  LT+AQ IP+ G V+V+T
Sbjct: 189 DDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPVIGAVVVTT 248

Query: 236 PQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIP 295
           PQD+ALID K+ I M++K+ +P++G++ENMS  + S+ G    +FG GGA+  AEK    
Sbjct: 249 PQDIALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAQKLAEKYHTQ 308

Query: 296 FLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
            L  +P  + +R   D G P VV    S  + IY+E++DR+
Sbjct: 309 LLGQMPLHISLREDLDRGTPTVVSRPESEFTAIYRELADRV 349


>gi|66803064|ref|XP_635375.1| Mrp/NBP35 family protein [Dictyostelium discoideum AX4]
 gi|74851525|sp|Q54F15|NUBPL_DICDI RecName: Full=Iron-sulfur protein NUBPL; AltName:
           Full=Nucleotide-binding protein-like; Flags: Precursor
 gi|60463698|gb|EAL61880.1| Mrp/NBP35 family protein [Dictyostelium discoideum AX4]
          Length = 323

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 120/245 (48%), Positives = 165/245 (67%), Gaps = 2/245 (0%)

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKL--LKISGKVEI 151
           +K  +AV+S KGGVGKST  VNIA  L +   +V +LD DV+GPSIP +  LK   K   
Sbjct: 56  IKNIIAVSSAKGGVGKSTCAVNIALGLSSHNLSVGLLDVDVFGPSIPLMMDLKNHEKPFT 115

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           ++   + P +NYGIK MSM  LV+E+  +IWRGPMV SA+  +L    WG LD L+ D+P
Sbjct: 116 NELNQMIPLQNYGIKCMSMGFLVNEDDPIIWRGPMVGSALEKLLRQTDWGHLDVLVCDLP 175

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGDA LT+ Q++PL+G VIVSTPQD+AL DV R ++M++K+ +PI+G++ENMSYF   
Sbjct: 176 PGTGDAILTMCQRVPLTGAVIVSTPQDVALADVVRGVNMFKKVEVPILGLVENMSYFNCP 235

Query: 272 DTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQE 331
              +   +FGN GA+  A+K+GI FL  VP  + +R  SD G PI V   +S  ++ Y++
Sbjct: 236 HCNESTHIFGNEGAKNTAKKMGINFLGDVPIHLQIRETSDSGKPITVTQPDSPQAKNYKD 295

Query: 332 ISDRI 336
           IS  I
Sbjct: 296 ISKEI 300


>gi|87300940|ref|ZP_01083782.1| MRP protein-like [Synechococcus sp. WH 5701]
 gi|87284811|gb|EAQ76763.1| MRP protein-like [Synechococcus sp. WH 5701]
          Length = 368

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 110/258 (42%), Positives = 170/258 (65%), Gaps = 5/258 (1%)

Query: 84  NPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL 143
           N P+++    V + +AV+SGKGGVGKST  VN+ACAL   G  V +LDAD+YGP+ P +L
Sbjct: 103 NLPERQGIPGVGRIIAVSSGKGGVGKSTVAVNLACALAQSGLRVGLLDADIYGPNAPTML 162

Query: 144 KISGKV-EI---SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVV 199
            ++ +  E+    +++ L P E  GI ++SM  L+ EN  ++WRGPM+   I   L+   
Sbjct: 163 GVADRTPEVRGSGNEQVLVPIETCGIGMVSMGLLIQENQPVVWRGPMLNGIIRQFLYQAD 222

Query: 200 WGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPII 259
           WG+ D L++D+PPGTGDA LT+AQ +P++GVVIV+TPQ ++L D +R ++M+ +M +P++
Sbjct: 223 WGERDVLVVDLPPGTGDAQLTLAQAVPMAGVVIVTTPQRVSLQDARRGLAMFLQMGVPVL 282

Query: 260 GMIENMSYFLASDTGK-KYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVV 318
           G++ENMS F+  D  +  Y +FG+GG    A + G+P L  +P +M V    D G P+V+
Sbjct: 283 GVVENMSTFIPPDRPEASYAIFGSGGGATLAAEAGVPLLAELPLEMAVVDGGDQGCPVVI 342

Query: 319 HNMNSATSEIYQEISDRI 336
               SAT+  +Q ++ RI
Sbjct: 343 ARPESATARAFQTLAQRI 360


>gi|254360501|ref|ZP_04976650.1| possible ATPase [Mannheimia haemolytica PHL213]
 gi|153091041|gb|EDN73046.1| possible ATPase [Mannheimia haemolytica PHL213]
          Length = 365

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 128/348 (36%), Positives = 208/348 (59%), Gaps = 16/348 (4%)

Query: 1   MNQILKNQIVDS---LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQS 57
           MNQ+ + Q+V+    L+  S P  + +++ +    +  +  + + + IT+P       ++
Sbjct: 1   MNQLNEQQLVEIKAILQQFSHPTLQKDLIALNAFKKAELGGDILRIEITMPFAWNSGFET 60

Query: 58  LRSNAQQIIQNIP-------TVKNAVVTLTE-NKNPPQQRNNLNVKKFVAVASGKGGVGK 109
           L++  +  ++ +         +   + TL   NK+P        VK  +AV SGKGGVGK
Sbjct: 61  LKAETEAKLKQVTGSSGVKWVLNYQIATLKRANKHPAVN----GVKNIIAVTSGKGGVGK 116

Query: 110 STTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIM 168
           STT VN+A AL+ +G  V ILDAD+YGPSIP +L    +   S D K + P   +G++  
Sbjct: 117 STTSVNLALALRAQGTRVGILDADIYGPSIPHMLGAKDQRPTSPDNKHITPITAHGLQSN 176

Query: 169 SMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLS 228
           S+  L++E+ A IWRGPM  SA+  +L+   W +LD+L+IDMPPGTGD  LT++Q+IP++
Sbjct: 177 SIGYLMEEDNATIWRGPMASSALSQLLNETWWNELDYLVIDMPPGTGDIQLTLSQQIPVT 236

Query: 229 GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFE 288
           G V+V+TPQD+AL+D  + ISM++K+++P++G+IENMS  + S+ G    +FG GGA   
Sbjct: 237 GAVVVTTPQDIALLDAIKGISMFEKVSVPVLGVIENMSMHICSNCGHHEAIFGTGGAEKI 296

Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           A+K G   L  +P  + +R   D G+P VV       S+ Y  +++++
Sbjct: 297 AQKYGTKVLAQLPLHIRLREDLDSGVPTVVAAPEHEISQAYLALAEKV 344


>gi|76802054|ref|YP_327062.1| ATP-binding protein Mrp 1 [Natronomonas pharaonis DSM 2160]
 gi|76557919|emb|CAI49503.1| ATP-binding protein Mrp 1 [Natronomonas pharaonis DSM 2160]
          Length = 348

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 117/336 (34%), Positives = 203/336 (60%), Gaps = 14/336 (4%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVY--LSITVPH--TIAHQLQSLRSN 61
           +  ++D L  +  P   ++IV +  ++++ I   T++  L++  P+  T      ++R  
Sbjct: 3   EETVLDRLAAVEDPDLGDDIVSLGLVNDVNIDAETIHVDLALGAPYSPTETELAGTVRDA 62

Query: 62  AQQIIQNIPTVKNAVVTLTENKN--PPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACA 119
             ++ + I    +    L+ ++   P       +V+  +AVASGKGGVGKST  VN+A  
Sbjct: 63  LSELDREIDLTASVDTGLSADEQILP-------DVENIIAVASGKGGVGKSTVAVNLAAG 115

Query: 120 LKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVA 179
           L   G  V + DADVYGP++P++++   + + ++++ + P E YG+K+MSM  LV E+  
Sbjct: 116 LSQLGARVGLFDADVYGPNVPRMVEADDQPKATEQETIIPPEKYGMKLMSMDFLVGEDDP 175

Query: 180 MIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDL 239
           +IWRGPMV   +  +  +V WG LD++++D+PPGTGD  LT+ Q +P+SG VIV+TPQ +
Sbjct: 176 VIWRGPMVHKVLTQLWEDVEWGALDYMVVDLPPGTGDTQLTLLQSVPVSGAVIVTTPQKV 235

Query: 240 ALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLES 299
           AL D ++ + M+ + + P++G++ENMS F+  D G ++D+FG+GG    A+ + +PFL  
Sbjct: 236 ALDDAEKGLQMFGEHDTPVLGIVENMSGFVCPDCGSEHDIFGSGGGESFADDVEMPFLGR 295

Query: 300 VPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDR 335
           +P D  VR   D G P+V+ + +  T E  +  ++R
Sbjct: 296 IPLDPAVREGGDAGRPVVL-DEDDETGEALRSFTER 330


>gi|88799944|ref|ZP_01115516.1| ATP-binding protein, Mrp/Nbp35 family [Reinekea sp. MED297]
 gi|88777375|gb|EAR08578.1| ATP-binding protein, Mrp/Nbp35 family [Reinekea sp. MED297]
          Length = 265

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 166/246 (67%), Gaps = 2/246 (0%)

Query: 93  NVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLL--KISGKVE 150
           NVKK +AVASGKGGVGKSTT VN+A ALK  G NV +LDAD+YGPS+  +L  K   K E
Sbjct: 3   NVKKIIAVASGKGGVGKSTTAVNLALALKRLGHNVGLLDADIYGPSVGLMLGVKEGTKPE 62

Query: 151 ISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDM 210
           + D     P   +G++ MSMA LV +   M+WRGPM   A+  +L   +W +LD+L++DM
Sbjct: 63  VKDGNSFVPILAHGLQTMSMAYLVTDKTPMVWRGPMASGALQQILTQTLWDKLDYLVVDM 122

Query: 211 PPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLA 270
           PPGTGD  LT+AQK  + G VIV+TPQDLAL+D K+ I M+QK+N+P++G++ENM+  + 
Sbjct: 123 PPGTGDIQLTLAQKANIDGAVIVTTPQDLALLDAKKGIEMFQKVNVPVLGVVENMAVHVC 182

Query: 271 SDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQ 330
           S+ G +  +FG  G +  AE+  +  L S+P DM +R  +D G P +V +  ++ +  Y+
Sbjct: 183 SNCGHEEHIFGEKGGQRLAEQYHVDILASLPLDMAIREGTDGGQPTMVGDAQNSLTASYE 242

Query: 331 EISDRI 336
            +++ +
Sbjct: 243 ALANGV 248


>gi|26987834|ref|NP_743259.1| ATP-binding Mrp/Nbp35 family protein [Pseudomonas putida KT2440]
 gi|24982534|gb|AAN66723.1|AE016300_8 ATP-binding protein, Mrp/Nbp35 family [Pseudomonas putida KT2440]
          Length = 364

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 180/280 (64%), Gaps = 6/280 (2%)

Query: 63  QQIIQNIPTVKNAVVTL----TENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118
           Q  I ++  V  A V++      +K   Q  +  NVK  +AVASGKGGVGKSTT  N+A 
Sbjct: 63  QAAIGSLEGVTGAQVSIDCVVAAHKAQAQVPSMANVKNIIAVASGKGGVGKSTTAANLAL 122

Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKIS--GKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           AL  +G  V ILDAD+YGPS   +  I+   + +I ++K+  P + +G+++MSMA L D+
Sbjct: 123 ALAREGARVGILDADIYGPSQGVMFGIAEGTRPQIREQKWFVPIKAHGVEVMSMAFLTDD 182

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           N  M+WRGPMV  A++ ++    W  LD+L+IDMPPGTGD  LT+AQK+P+ G VIV+TP
Sbjct: 183 NTPMVWRGPMVSGALLQLVTQTAWDDLDYLVIDMPPGTGDIQLTLAQKVPVVGSVIVTTP 242

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QDLAL+D K+ + M++K+NIP++G++ENM+  + S+ G    LFG GG    A + G+  
Sbjct: 243 QDLALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLASQYGVDL 302

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336
           L S+P  M +R  +D G P  +    S  + +YQE++ ++
Sbjct: 303 LASLPLSMLIREQADSGKPTAIAEPESQIAMVYQELARQV 342


>gi|295132383|ref|YP_003583059.1| Mrp/Nbp35 family ATP-binding protein [Zunongwangia profunda SM-A87]
 gi|294980398|gb|ADF50863.1| Mrp/Nbp35 family ATP-binding protein [Zunongwangia profunda SM-A87]
          Length = 380

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 125/348 (35%), Positives = 204/348 (58%), Gaps = 16/348 (4%)

Query: 6   KNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAH-----QLQSLRS 60
           + +I+ +L+ +S+ GE  N+VE   L  +    + V + + +     H     ++  +++
Sbjct: 5   RKEIIRALESISVAGEGKNMVEGGALQNVMTFGDEVIVDLVLSSPALHIKKRAEVDVMKA 64

Query: 61  NAQQIIQNIPTVKNAVVTL--TENKNPPQQRNNL-NVKKFVAVASGKGGVGKSTTVVNIA 117
             +++ +      N  V    TE K P  +   +  +K  +AVASGKGGVGKST   N+A
Sbjct: 65  IHEKVYEKAKIKVNIKVEAPATEKKAPEIKGKPIPGIKNIIAVASGKGGVGKSTVTANLA 124

Query: 118 CALKNKGKNVAILDADVYGPSIPKLLKISGK----VEISDKKFLKPKENYGIKIMSMASL 173
             L   G  V +LDAD+YGPS+P +  ++ +    V +  K  +KP ENYG+KI+S+   
Sbjct: 125 VTLSKMGFKVGVLDADIYGPSVPIMFDVAAERPLSVNVDGKSKMKPVENYGVKILSIGFF 184

Query: 174 VDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIV 233
              N A+IWRGPM   A+  M+ +  WG LDFLL+D+PPGTGD HL+I Q +P++G V+V
Sbjct: 185 TKPNQAVIWRGPMAAKALNQMIFDAAWGALDFLLVDLPPGTGDIHLSIMQSLPITGAVVV 244

Query: 234 STPQDLALIDVKRAISMYQK--MNIPIIGMIENMSYFLASD-TGKKYDLFGNGGARFEAE 290
           STPQ++AL D K+ ++M+Q+  +N+P++G++ENM+YF   +    KY +FG  GA+  +E
Sbjct: 245 STPQNVALADAKKGVAMFQQESINVPVLGIVENMAYFTPQELPNNKYYIFGEQGAKNLSE 304

Query: 291 KIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQ 338
            + +PFL  +P    +R   D+G P  +    +   E ++EI+  + Q
Sbjct: 305 DLQVPFLGEIPLVQSLRESGDIGRPAALQE-ETPLEESFKEITRNMVQ 351


>gi|38257754|sp|Q9CWD8|NUBPL_MOUSE RecName: Full=Iron-sulfur protein NUBPL; AltName:
           Full=Nucleotide-binding protein-like; Flags: Precursor
 gi|12846542|dbj|BAB27209.1| unnamed protein product [Mus musculus]
          Length = 319

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 167/253 (66%), Gaps = 2/253 (0%)

Query: 86  PQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACAL--KNKGKNVAILDADVYGPSIPKLL 143
           P+Q+    V++ + VASGKGGVGKSTT VN+A AL   +  K V +LD DVYGPSIPK++
Sbjct: 58  PKQKPIEGVREVIVVASGKGGVGKSTTAVNLALALAANDSSKAVGLLDVDVYGPSIPKMM 117

Query: 144 KISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQL 203
            + G  E+S    ++P  NYGI  MSM  LV+E   ++WRG MV SAI  +L  V WGQL
Sbjct: 118 NLRGNPELSPNNLMRPLLNYGIACMSMGFLVEETAPLVWRGLMVMSAIEKLLRQVDWGQL 177

Query: 204 DFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIE 263
           D+L++DMPPGTGD  L+++Q IP+SG VIVSTPQD+AL+D  +   M++K+N+P++G+++
Sbjct: 178 DYLVVDMPPGTGDVQLSVSQNIPISGAVIVSTPQDIALMDAHKGAEMFRKVNVPVLGLVQ 237

Query: 264 NMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS 323
           NMS F       K  +FG  GAR  A+ + +  L  VP  + +R  SD+G P+V+    S
Sbjct: 238 NMSVFQCPKCKHKTHIFGADGARKLAQTLDLDVLGDVPLHLSIREASDMGQPVVLSQPGS 297

Query: 324 ATSEIYQEISDRI 336
             ++ Y  I+  +
Sbjct: 298 DEAKAYLHIASEV 310


>gi|88706622|ref|ZP_01104325.1| nucleotide-binding protein [Congregibacter litoralis KT71]
 gi|88699118|gb|EAQ96234.1| nucleotide-binding protein [Congregibacter litoralis KT71]
          Length = 269

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 156/239 (65%), Gaps = 4/239 (1%)

Query: 94  VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKIS--GKVEI 151
            K  +AVASGKGGVGKSTT VN+A AL   G  V +LDAD+YGPS+  +L ++   + E 
Sbjct: 4   AKHIIAVASGKGGVGKSTTAVNLALALSATGARVGLLDADIYGPSVALMLGVAEGTRPES 63

Query: 152 SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMP 211
           SD K + P E +G+  MSMA L  +   M+WRGPM   A++ ML    WG LD+L+IDMP
Sbjct: 64  SDGKTMSPVEAHGLASMSMAYLASDRTPMVWRGPMAGGALIQMLEQTRWGDLDYLIIDMP 123

Query: 212 PGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLAS 271
           PGTGD  LT++QK  +SG VIV+TPQD+AL+D ++ I M++K+++P++G+IENM     S
Sbjct: 124 PGTGDIQLTLSQKATVSGAVIVTTPQDIALLDARKGIEMFRKVSVPVLGIIENMGLHTCS 183

Query: 272 DTGKKYDLFG-NGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329
             G    +FG +GG R  AE  G+  L S+P +  +R  +D G PIV+    SA  + Y
Sbjct: 184 QCGHTESVFGLDGGQRIAAE-YGVALLASLPLERTIREYTDAGTPIVIREPESAAGQAY 241


>gi|81244885|gb|ABB65593.1| putative ATPase [Shigella boydii Sb227]
          Length = 379

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 128/343 (37%), Positives = 199/343 (58%), Gaps = 13/343 (3%)

Query: 3   QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNA 62
           + L+  +  +L     P  K+N+  ++ L  +  + +T+++ + +P       + L+   
Sbjct: 21  EALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWHSAFEELKEQC 80

Query: 63  QQIIQNIPTVK-------NAVVTLTENKNPPQQRNNLN-VKKFVAVASGKGGVGKSTTVV 114
              +  I   K       + + TL   KN P     +N VK  +AV+SGKGGVGKS+T V
Sbjct: 81  SAELLRITGAKAIDWKLSHNIATLKRVKNQP----GINGVKNIIAVSSGKGGVGKSSTAV 136

Query: 115 NIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEIS-DKKFLKPKENYGIKIMSMASL 173
           N+A AL  +G  V ILDAD+YGPSIP +L    +   S