RPSBLAST alignment for GI: 254780831 and conserved domain: cd03115

>gnl|CDD|48379 cd03115, SRP, The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.. Length = 173
 Score = 39.3 bits (92), Expect = 0.001
 Identities = 21/52 (40%), Positives = 31/52 (59%)

Query: 97  FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGK 148
            V +  G  GVGK+TT   +A  LK KGK V ++ AD Y P+  + L++ G+
Sbjct: 1   TVILLVGLQGVGKTTTAAKLALYLKKKGKKVLLVAADTYRPAAIEQLRVLGE 52