RPSBLAST alignment for GI: 254780831 and conserved domain: cd03110

>gnl|CDD|73339 cd03110, Fer4_NifH_child, This protein family's function is unkown. It contains nucleotide binding site. It uses NTP as energy source to transfer electron or ion.. Length = 179
 Score = 67.9 bits (166), Expect = 3e-12
 Identities = 57/206 (27%), Positives = 85/206 (41%), Gaps = 30/206 (14%)

Query: 98  VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFL 157
           +AV SGKGG GK+T    +A  LKN    V + D DV  P++   LK   ++E  +   +
Sbjct: 2   IAVISGKGGTGKTTVTAALAALLKN----VVLADCDVDAPNLHLFLK--PEIEEEEDFIV 55

Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217
             K     K +    L          G +V     H          + ++ID PPG G  
Sbjct: 56  GGK-----KAVIDPELCISCGLC---GKLVTEVRKHAKEIAKAEGAELIIIDGPPGIGCP 107

Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277
              IA        ++V+ P    L D++RA+ + +   IP +G++ N           KY
Sbjct: 108 --VIASLTGADAALLVTEPTPSGLHDLERAVELVRHFGIP-VGVVIN-----------KY 153

Query: 278 DLFGNGGARFE--AEKIGIPFLESVP 301
           DL        E   E+ GIP L  +P
Sbjct: 154 DLNDEIAEEIEDYCEEEGIPILGKIP 179