RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780831|ref|YP_003065244.1| hypothetical protein CLIBASIA_03620 [Candidatus Liberibacter asiaticus str. psy62] (341 letters) >gnl|CDD|38232 KOG3022, KOG3022, KOG3022, Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning]. Length = 300 Score = 261 bits (669), Expect = 2e-70 Identities = 111/260 (42%), Positives = 164/260 (63%), Gaps = 3/260 (1%) Query: 85 PPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK 144 P +Q N VK + V SGKGGVGKST VN+A AL ++GK V +LDAD+ GPSIP+++ Sbjct: 37 PAKQENLSGVKHIILVLSGKGGVGKSTVTVNLALALASEGKKVGLLDADLCGPSIPRMMG 96 Query: 145 ISGKVEISDKKFLKP-KENYGIKIMSMASLV-DENVAMIWRGPMVQSAIMHMLHNVVWGQ 202 + G+V P N +K+MSM L+ + ++IWRGP S I L +V WG+ Sbjct: 97 LEGEVVHQSDNGWIPVVVNKNLKLMSMGFLLKPRDDSVIWRGPKKNSMIKQFLKDVDWGE 156 Query: 203 LDFLLIDMPPGTGDAHLTIAQKIPLS-GVVIVSTPQDLALIDVKRAISMYQKMNIPIIGM 261 LD+L+ID PPGT D HL++ Q + S G VIV+TPQ++AL DV++ I +K IPI+G+ Sbjct: 157 LDYLVIDTPPGTSDEHLSLVQFLRESDGAVIVTTPQEVALQDVRKEIDFCRKAGIPILGV 216 Query: 262 IENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNM 321 +ENMS F+ G ++FG+GG AE++G+P L S+P D + SD G+P V Sbjct: 217 VENMSGFVCPKCGHSTNIFGSGGGERLAEELGLPLLGSLPLDPLIAESSDSGVPFVEEYP 276 Query: 322 NSATSEIYQEISDRIQQFFV 341 +S SE +++I++++ + Sbjct: 277 DSPASEAFEDIAEKLVEQLS 296 >gnl|CDD|73300 cd02037, MRP-like, MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily. Like the other members of the superfamily, MRP contains a ATP-binding domain at the N-termini. It is found in bacteria as a membrane-spanning protein and functions as a Na+/H+ antiporter.. Length = 169 Score = 238 bits (610), Expect = 1e-63 Identities = 99/207 (47%), Positives = 128/207 (61%), Gaps = 39/207 (18%) Query: 98 VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFL 157 +AV SGKGGVGKST VN+A AL G V +LDAD+YGPSIPK+ Sbjct: 2 IAVMSGKGGVGKSTVAVNLALALAKLGYKVGLLDADIYGPSIPKM--------------- 46 Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217 WRGPM AI L +V WG+LD+L+IDMPPGTGD Sbjct: 47 ------------------------WRGPMKMGAIKQFLTDVDWGELDYLVIDMPPGTGDE 82 Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277 HLT+AQ +P+ G VIV+TPQ++AL DV++AI M++K+NIPI+G++ENMSYF+ GKK Sbjct: 83 HLTLAQSLPIDGAVIVTTPQEVALDDVRKAIDMFKKVNIPILGVVENMSYFVCPHCGKKI 142 Query: 278 DLFGNGGARFEAEKIGIPFLESVPFDM 304 +FG GG AE++G+P L +P D Sbjct: 143 YIFGKGGGEKLAEELGVPLLGKIPLDP 169 >gnl|CDD|30835 COG0489, Mrp, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 265 Score = 194 bits (493), Expect = 3e-50 Identities = 103/274 (37%), Positives = 153/274 (55%), Gaps = 17/274 (6%) Query: 43 LSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNL--NVKKFVAV 100 + I + A + + + + + A L + + L VK +AV Sbjct: 3 VEIELALPFASSSEEIPELLAKALAALLPKSTASEALRALRTNLKFAKVLRKGVKNVIAV 62 Query: 101 ASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISD----KKF 156 SGKGGVGKST VN+A AL GK V +LDAD+ GPSIP++L + +++ + Sbjct: 63 TSGKGGVGKSTVAVNLAAALAQLGKRVLLLDADLRGPSIPRMLGLENLPGLTELLAGEAL 122 Query: 157 LKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGD 216 ++ GIK++S+ L V +I RG + A++ +L +V+WG+ D+++ID PPGTGD Sbjct: 123 EPVIQHDGIKVLSILPLGP--VPVIPRGLLGSKAMLQLLEDVLWGEYDYVIIDTPPGTGD 180 Query: 217 AHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKK 276 A T+ Q+IP GVVIV+TP AL DVK+AI M +K IP++G++ENMSYF+ G+ Sbjct: 181 ADATVLQRIPD-GVVIVTTPGKTALEDVKKAIDMLEKAGIPVLGVVENMSYFICPRCGE- 238 Query: 277 YDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLS 310 GG AE+ G P+L S+P D R S Sbjct: 239 ------GGGEKYAERYG-PYLGSIPLDPSAREAS 265 >gnl|CDD|73299 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell. The site is determined by the min operon products MinC, MinD and MinE. MinC is a nonspecific inhibitor of the septum protein FtsZ. MinE is the supressor of MinC. MinD plays a pivotal role, selecting the mid-cell over other sites through the activation and regulation of MinC and MinE. MinD is a membrane-associated ATPase, related to nitrogenase iron protein. More distantly related proteins include flagellar biosynthesis proteins and ParA chromosome partitioning proteins. MinD is a monomer.. Length = 179 Score = 90.6 bits (225), Expect = 6e-19 Identities = 59/234 (25%), Positives = 99/234 (42%), Gaps = 58/234 (24%) Query: 98 VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFL 157 + V SGKGGVGK+TT N+ AL G V ++DAD+ ++ +L + +V + Sbjct: 2 IVVTSGKGGVGKTTTTANLGTALAQLGYKVVLIDADLGLRNLDLILGLENRVVYT----- 56 Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTG-D 216 LH+V+ G D++LID P G Sbjct: 57 -------------------------------------LHDVLAG--DYILIDSPAGIERG 77 Query: 217 AHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKK 276 IA P ++V+TP+ +L D R + + + I ++G+I N + Sbjct: 78 FITAIA---PADEALLVTTPEISSLRDADRVKGLLEALGIKVVGVIVNRV---------R 125 Query: 277 YDLFGNGGARFEAEKI-GIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIY 329 D+ G + E+I G+P L +P D V ++ G P+V++ S ++ Y Sbjct: 126 PDMVEGGDMVEDIEEILGVPLLGVIPEDPAVIRATNRGEPVVLNKPKSPAAQAY 179 >gnl|CDD|30803 COG0455, COG0455, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 262 Score = 86.5 bits (214), Expect = 1e-17 Identities = 62/258 (24%), Positives = 116/258 (44%), Gaps = 29/258 (11%) Query: 96 KFVAVASGKGGVGKSTTVVNI-ACALKNKGKNVAILDADVYGPSIPKLLKI-SGKVEISD 153 K +AV SGKGGVGK+T N+ A GK V ++DAD+ ++ LL + S + D Sbjct: 3 KVIAVVSGKGGVGKTTITANLGAALAALGGKVVLLIDADLGLGNLSLLLGVESKPTTLHD 62 Query: 154 --KKFLKPKE------NYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDF 205 ++ G+ ++ S +++ + P ++ L D+ Sbjct: 63 VLAGEASIEDIIYETPQDGLYVLPGGSGLEDLAKL---DPEDLEDVIKELE----ELYDY 115 Query: 206 LLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIG--MIE 263 +LID G T++ + +VIV+TP+ ++ D + I + K+ + ++G ++ Sbjct: 116 ILIDTGAGLSRD--TLSFILSSDELVIVTTPEPTSITDAYKTIKILSKLGLDLLGRRVVL 173 Query: 264 NMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNS 323 N T + D+ A +P L+ +PFD +VR G PIV+++ NS Sbjct: 174 NR----VRSTKEGVDVA----ALLIQVVKQVPVLQVIPFDPEVRRALAEGKPIVLYSPNS 225 Query: 324 ATSEIYQEISDRIQQFFV 341 S+ +E++ ++ Sbjct: 226 KASQAIKELAAKLAGLPE 243 >gnl|CDD|145019 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain. This family consists of various cobyrinic acid a,c-diamide synthases. These include CbiA and CbiP from S.typhimurium, and CobQ from R. capsulatus. These amidases catalyse amidations to various side chains of hydrogenobyrinic acid or cobyrinic acid a,c-diamide in the biosynthesis of cobalamin (vitamin B12) from uroporphyrinogen III. Vitamin B12 is an important cofactor and an essential nutrient for many plants and animals and is primarily produced by bacteria. The family also contains dethiobiotin synthetases as well as the plasmid partitioning proteins of the MinD/ParA family. Length = 212 Score = 76.3 bits (188), Expect = 1e-14 Identities = 39/180 (21%), Positives = 81/180 (45%), Gaps = 19/180 (10%) Query: 98 VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGP---SIPKLLKISGKV----E 150 +A+A KGGVGK+T N+A AL +G V ++D D S+ K + + E Sbjct: 1 IAIAGTKGGVGKTTLAANLARALAKRGYRVLLIDLDPQANLTSSLGKGPDLIDVLKEGLE 60 Query: 151 ISDKKFLKPKENYGIKIMSMASLVDENVAMI-----WRGPMVQSAIMHMLHNVVWGQLDF 205 I D + L+ + ++ + + +I + + ++ D+ Sbjct: 61 IVDAQPLQHIAAAIVPSRNL-----DPLLLIPSNLSLANFESELILEGGEEGLIKLAYDY 115 Query: 206 LLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENM 265 ++ID PG G LT + +V+ P+ +A++ +R + + +++ + I+G++ N Sbjct: 116 VIIDGAPGLG--ELTANALVAADILVVPIEPEGVAVLGAQRLLELVERLGLKILGVVLNK 173 >gnl|CDD|31343 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]. Length = 284 Score = 70.7 bits (173), Expect = 5e-13 Identities = 73/306 (23%), Positives = 111/306 (36%), Gaps = 88/306 (28%) Query: 98 VAVASGKGGVGKSTTVVNIACALKNKGK-----------NVAIL-------DADVYGPSI 139 VAVASGKGG GK+T N+A L +K K N+ +L + +V I Sbjct: 4 VAVASGKGGTGKTTVAANLAVLLGDKYKLVLADCDVEAPNLHLLLGVEVLEEEEVIRGEI 63 Query: 140 PKL---------------LKISGKVEISDKKFLKPKENYGIKIMSMA------------- 171 P++ + V K L P G S+ Sbjct: 64 PEIDPEKCIRCGKCAEVCRFGAIVVLPGGKPVLNPDLCEGCGACSIVCPEPAIEEEPVVI 123 Query: 172 -----SLVDENVAMIW---------RGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGD- 216 S D +I G +V + H D L+ID GTG Sbjct: 124 GKIYESKTDYGFPLISGRLNVGEEESGKLVTALKKHAKEL-----ADLLIIDSAAGTGCP 178 Query: 217 --AHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTG 274 A L A ++V+ P L D+KRA+ + + IP G++ N Sbjct: 179 VIASLKGADL-----AILVTEPTPFGLHDLKRALELVEHFGIPT-GIVIN---------- 222 Query: 275 KKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISD 334 +Y+L G+ E+ GIP L +P+D D+ G P V + A E E ++ Sbjct: 223 -RYNL-GDSEIEEYCEEEGIPILGEIPYDKDIPEAYVNGEPFVEPDSKEA--EAILEEAE 278 Query: 335 RIQQFF 340 ++++F Sbjct: 279 KLKEFI 284 >gnl|CDD|32719 COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning]. Length = 272 Score = 69.8 bits (171), Expect = 1e-12 Identities = 60/271 (22%), Positives = 112/271 (41%), Gaps = 56/271 (20%) Query: 96 KFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLK----------- 144 + + V SGKGGVGK+TT NI AL GK V ++D D+ ++ ++ Sbjct: 3 RIIVVTSGKGGVGKTTTTANIGTALAQLGKKVVLIDFDIGLRNLDLIMGLENRIVYDLVD 62 Query: 145 -ISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQL 203 I G+ ++ + +K K + ++ + D++ + + +++ + Sbjct: 63 VIEGEATLN-QALIKDKRLENLFLLPASQTRDKDA-------LTPEGVKKVVNELKAMDF 114 Query: 204 DFLLIDMPPG--TGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGM 261 D+++ID P G G + ++V+ P+ ++ D R IIG+ Sbjct: 115 DYIIIDSPAGIEQG-FKNAVY---FADEAIVVTNPEVSSVRDSDR-----------IIGL 159 Query: 262 IENMSYFLASDTGKKYDLFGNGGARFEAEKI---------------GIPFLESVPFDMDV 306 +E+ S K L N R+ E + IP + +P D DV Sbjct: 160 LESKSRRAEIGEEPKEHLLLN---RYRPEMVKRGEMLSVEDVLEILSIPLIGVIPEDQDV 216 Query: 307 RVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337 S+ G P V+ + NS + Y++I+ R+ Sbjct: 217 LRASNKGEP-VILDDNSDAGKAYRDIARRLL 246 >gnl|CDD|73339 cd03110, Fer4_NifH_child, This protein family's function is unkown. It contains nucleotide binding site. It uses NTP as energy source to transfer electron or ion.. Length = 179 Score = 67.9 bits (166), Expect = 3e-12 Identities = 57/206 (27%), Positives = 85/206 (41%), Gaps = 30/206 (14%) Query: 98 VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFL 157 +AV SGKGG GK+T +A LKN V + D DV P++ LK ++E + + Sbjct: 2 IAVISGKGGTGKTTVTAALAALLKN----VVLADCDVDAPNLHLFLK--PEIEEEEDFIV 55 Query: 158 KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDA 217 K K + L G +V H + ++ID PPG G Sbjct: 56 GGK-----KAVIDPELCISCGLC---GKLVTEVRKHAKEIAKAEGAELIIIDGPPGIGCP 107 Query: 218 HLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKY 277 IA ++V+ P L D++RA+ + + IP +G++ N KY Sbjct: 108 --VIASLTGADAALLVTEPTPSGLHDLERAVELVRHFGIP-VGVVIN-----------KY 153 Query: 278 DLFGNGGARFE--AEKIGIPFLESVP 301 DL E E+ GIP L +P Sbjct: 154 DLNDEIAEEIEDYCEEEGIPILGKIP 179 >gnl|CDD|164554 CHL00175, minD, septum-site determining protein; Validated. Length = 281 Score = 64.8 bits (158), Expect = 3e-11 Identities = 55/249 (22%), Positives = 112/249 (44%), Gaps = 28/249 (11%) Query: 81 ENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIP 140 E + + + + + + SGKGGVGK+TT N+ ++ G VA++DAD+ ++ Sbjct: 1 EQITTEDKEKSATMSRIIVITSGKGGVGKTTTTANLGMSIARLGYRVALIDADIGLRNLD 60 Query: 141 KLLKISGKVEIS-----------DKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQS 189 LL + +V + D+ ++ K + +++++ R + + Sbjct: 61 LLLGLENRVLYTAMDVLEGECRLDQALIRDKRWKNLSLLAISKNRQ-------RYNVTRK 113 Query: 190 AIMHMLHNVVWGQLDFLLIDMPPGTGDA-HLTIAQKIPLSGVVIVSTPQDLALIDVKRAI 248 + ++ ++ D++LID P G IA P ++V+TP+ A+ D R Sbjct: 114 NMNMLVDSLKNRGYDYILIDCPAGIDVGFINAIA---PAQEAIVVTTPEITAIRDADRVA 170 Query: 249 SMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRV 308 + + I + ++ N + D + D+ R E +GIP L ++P D +V + Sbjct: 171 GLLEANGIYNVKLLVNR---VRPDMIQANDMM---SVRDVQEMLGIPLLGAIPEDENVII 224 Query: 309 LSDLGIPIV 317 ++ G P+V Sbjct: 225 STNRGEPLV 233 >gnl|CDD|31385 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 259 Score = 62.5 bits (151), Expect = 1e-10 Identities = 55/259 (21%), Positives = 97/259 (37%), Gaps = 21/259 (8%) Query: 96 KFVAVASGKGGVGKSTTVVNIACAL-KNKGKNVAILDADVYG---------PSIPKLLKI 145 K +AVA+ KGGVGK+TT VN+A AL K GK V ++D D G P + L Sbjct: 3 KIIAVANQKGGVGKTTTAVNLAAALAKRGGKKVLLIDLDPQGSLTSWLGLRPDLEGDLYN 62 Query: 146 SGKVEISDKKFLKPK-ENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLD 204 L G+ ++ + E + + + +L + V D Sbjct: 63 LLSGLKERPDILDYTVVIEGLDLIPSNIDLAEGAEIELNAVAKELLLKRLL-DPVKDDYD 121 Query: 205 FLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI---DVKRAISMYQKMNIPIIGM 261 +++ID PP G LT+ V+I P+ L L + + K+ + + Sbjct: 122 YIIIDTPPSLGV--LTLNALAAADHVLIPVQPEFLDLEGLEQLLNTLEDLLKLRRNKLIV 179 Query: 262 IENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNM 321 + + S T ++ + V + R + G P+ ++ Sbjct: 180 VGILITRFDSRTKLADEVLQELKQLLGDPVLKTKIPRRVAY----REAAAEGKPLYEYDP 235 Query: 322 NSATSEIYQEISDRIQQFF 340 S +E Y E++ + + Sbjct: 236 KSKAAEEYYELAKELLEEL 254 >gnl|CDD|73301 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily. It shares the common function as an ATPase, with the ATP-binding domain at the N-terminus. In Pseudomonas aeruginosa, FleN gene is involved in regulating the number of flagella and chemotactic motility by influencing FleQ activity.. Length = 139 Score = 58.6 bits (142), Expect = 2e-09 Identities = 21/38 (55%), Positives = 26/38 (68%) Query: 97 FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV 134 +AV SGKGGVGK+ N+A AL GK V +LDAD+ Sbjct: 1 IIAVTSGKGGVGKTNISANLALALAKLGKRVLLLDADL 38 Score = 30.5 bits (69), Expect = 0.78 Identities = 19/100 (19%), Positives = 42/100 (42%), Gaps = 6/100 (6%) Query: 203 LDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAIS-MYQKMNIPIIGM 261 D+++ID G D L V++V+TP+ ++ D I + +++ + + Sbjct: 45 YDYIIIDTGAGISDNVLDFFLAAD--EVIVVTTPEPTSITDAYALIKKLAKQLRVLNFRV 102 Query: 262 IENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVP 301 + N + + K + N RF + + +L +P Sbjct: 103 VVNRAES-PKEGKKVFKRLSNVSNRFLG--LSLDYLGFIP 139 >gnl|CDD|73298 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell. This ATP-driven oxyanion pump catalyzes the extrusion of arsenite, antimonite and arsenate. Maintenance of a low intracellular concentration of oxyanion produces resistance to the toxic agents. The pump is composed of two subunits, the catalytic ArsA subunit and the membrane subunit ArsB, which are encoded by arsA and arsB genes respectively. Arsenic efflux in bacteria is catalyzed by either ArsB alone or by ArsAB complex. The ATP-coupled pump, however, is more efficient. ArsA is composed of two homologous halves, A1 and A2, connected by a short linker sequence.. Length = 217 Score = 58.4 bits (141), Expect = 3e-09 Identities = 40/187 (21%), Positives = 72/187 (38%), Gaps = 15/187 (8%) Query: 102 SGKGGVGKSTTVVNIACALKNKGKNVAILDAD----VYGPSIPKL--LKISGKVEISDKK 155 +GKGGVGK+T A L +GK V ++ D + +P L I EI+ Sbjct: 5 TGKGGVGKTTIAAATAVRLAEEGKKVLLVSTDPAHNLSDKGLPNLSDAFIVEDPEIAPNL 64 Query: 156 FL---KPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPP 212 + L+ E +A G ++++ + G D ++ D P Sbjct: 65 YREEVDATRRVERAWGGEGGLMLE-LAAALPGIEELASLLAVFREFSEGLYDVIVFDTAP 123 Query: 213 GTGDAHLTIAQKI----PLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYF 268 TG + +++ + +V+ P+ L L + +RAI+ IP+ ++ N Sbjct: 124 -TGHTLRLLVRELLTDPERTSFRLVTLPEKLPLYETERAITELALYGIPVDAVVVNRVLP 182 Query: 269 LASDTGK 275 D Sbjct: 183 AEVDDDP 189 >gnl|CDD|73302 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in R. etli Sym plasmid. This operon is involved in the plasmid replication and partition.. Length = 104 Score = 51.4 bits (123), Expect = 4e-07 Identities = 21/36 (58%), Positives = 28/36 (77%) Query: 98 VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDAD 133 +AVA+ KGGVGK+TT VN+A AL +GK V ++D D Sbjct: 2 IAVANQKGGVGKTTTAVNLAAALARRGKRVLLIDLD 37 >gnl|CDD|48363 cd02033, BchX, Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring. This family contains the X subunit of this three-subunit enzyme. Sequence and structure similarity between bchX, protochlorophyllide reductase L subunit (bchL and chlL) and nitrogenase Fe protein (nifH gene) suggest their functional similarity. Members of the BchX family serve as the unique electron donors to their respective catalytic subunits (bchN-bchB, bchY-bchZ and nitrogenase component 1). Mechanistically, they hydrolyze ATP and transfer electrons through a Fe4-S4 cluster.. Length = 329 Score = 48.1 bits (114), Expect = 4e-06 Identities = 69/254 (27%), Positives = 110/254 (43%), Gaps = 51/254 (20%) Query: 78 TLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGP 137 TL PP ++ + +A+ GKGG+GKS T+ N++ + +GK V ++ D Sbjct: 19 TLEIPTAPPTKKTQI-----IAI-YGKGGIGKSFTLANLSYMMAQQGKRVLLIGCDPKSD 72 Query: 138 SIPKLLKISGK-----VEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMV----- 187 + L GK +E S KK L +E ++I + D AM GP V Sbjct: 73 TTSLLF--GGKACPTIIETSAKKKLAGEE---VQIGDVCFKRDGVFAMELGGPEVGRGCG 127 Query: 188 QSAIMHMLHNVV------WGQLDFLLIDMPPGT--GDAHLTIAQKIPLSGVVIVSTPQDL 239 I+H + W D++L+D G L IA+ ++ VIV DL Sbjct: 128 GRGIIHGFELLEKLGFHDWD-FDYVLLDFLGDVVCGGFGLPIARD--MAQKVIVVGSNDL 184 Query: 240 ALI----DVKRAISMYQKM--NIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIG 293 + +V A+ ++K+ N+ + GM+ N K D G G A+ A G Sbjct: 185 QSLYVANNVCNAVEYFRKLGGNVGVAGMVIN-----------KDD--GTGEAQAFAAHAG 231 Query: 294 IPFLESVPFDMDVR 307 IP L ++P D ++R Sbjct: 232 IPILAAIPADEELR 245 >gnl|CDD|73290 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.. Length = 99 Score = 46.6 bits (110), Expect = 1e-05 Identities = 19/37 (51%), Positives = 25/37 (67%) Query: 98 VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV 134 V V +GKGGVGK+T N+A AL +GK V ++D V Sbjct: 1 VIVVTGKGGVGKTTLAANLAAALAKRGKRVLLIDDYV 37 Score = 35.1 bits (80), Expect = 0.032 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Query: 204 DFLLIDMPPGTGDAH-LTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIG 260 D++LID PPG G L + + V+IV+TP+ LA++ +R + ++ I + Sbjct: 35 DYVLIDTPPGLGLLVLLCLLALLAADLVIIVTTPEALAVLGARRLTEVVLELAIEGLR 92 >gnl|CDD|33438 COG3640, CooC, CO dehydrogenase maturation factor [Cell division and chromosome partitioning]. Length = 255 Score = 46.4 bits (110), Expect = 1e-05 Identities = 55/269 (20%), Positives = 113/269 (42%), Gaps = 52/269 (19%) Query: 102 SGKGGVGKST-TVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVE-ISDKK-FLK 158 +GKGGVGK+T + + L G NV ++DAD ++P+ L + ++ + K+ LK Sbjct: 6 TGKGGVGKTTIAALLLKRLLSKGGYNVLVVDADP-DSNLPEALGVEEPMKYLGGKRELLK 64 Query: 159 P--------------KENYGI-KIMSMASLVDENVAMIWRG-----------PMVQSAIM 192 KEN + + + + ++ ++ G PM + + Sbjct: 65 KRTGAEPGGPPGEMFKENPLVSDLPDEYLVENGDIDLLVMGKIEEGGEGCACPM-NALLR 123 Query: 193 HMLHNVVWGQLDFLLIDMPPGTGDAHLT--IAQKIPLSGVVIVSTPQDLALIDVKRAISM 250 +L +++ + + +++D G H + + L V++V P +L +R + Sbjct: 124 RLLRHLILNRYEVVIVDTEAGI--EHFGRGTIEGVDL--VIVVVDPSYKSLRTAERIKEL 179 Query: 251 YQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLS 310 +++ I I ++ N K D R AE++G+ L +P+D +V Sbjct: 180 AEELGIKRIFVVLN-----------KVDE-EEELLRELAEELGLEVLGVIPYDPEVVEAD 227 Query: 311 DLGIPIVVHNMNSATSEIYQEISDRIQQF 339 G P+ N + +EI++R+ + Sbjct: 228 LKGEPL---NEEPEVLKEIEEIAERLIKL 253 >gnl|CDD|48369 cd02040, NifH, NifH gene encodes component II (iron protein) of nitrogenase. Nitrogenase is responsible for the biological nitrogen fixation, i.e. reduction of molecular nitrogen to ammonia. NifH consists of two oxygen-sensitive metallosulfur proteins: the mollybdenum-iron (alternatively, vanadium-iron or iron-iron) protein (commonly referred to as component 1), and the iron protein (commonly referred to as component 2). The iron protein is a homodimer, with an Fe4S4 cluster bound between the subunits and two ATP-binding domains. It supplies energy by ATP hydrolysis, and transfers electrons from reduced ferredoxin or flavodoxin to component 1 for the reduction of molecular nitrogen to ammonia.. Length = 270 Score = 44.0 bits (104), Expect = 5e-05 Identities = 63/261 (24%), Positives = 113/261 (43%), Gaps = 50/261 (19%) Query: 103 GKGGVGKSTTVVNIACALKNKGKNVAILDAD------------VYGPSIPKLLKISGKVE 150 GKGG+GKSTT N++ AL GK V I+ D P++ L+ G+VE Sbjct: 8 GKGGIGKSTTTQNLSAALAEMGKKVMIVGCDPKADSTRLLLGGKAIPTVLDTLREKGEVE 67 Query: 151 ISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLID- 209 + + + GIK + + + V RG + ++ L LDF++ D Sbjct: 68 LELEDVIFEGFG-GIKCVE-SGGPEPGVGCAGRGVITAINLLEEL-GAYEDDLDFVIYDV 124 Query: 210 ----------MPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALI---DVKRAISMYQKM-N 255 MP G AQ+I IV++ + +AL ++ + I Y K Sbjct: 125 LGDVVCGGFAMPIREG-----KAQEI-----YIVTSGEMMALYAANNICKGILKYAKSGG 174 Query: 256 IPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIP 315 + + G+I N + +T ++ +L F A+++G + VP D V+ G Sbjct: 175 VRLGGLICN-----SRNTDREDELI----DAF-AKRLGTQMIHFVPRDNVVQRAELRGKT 224 Query: 316 IVVHNMNSATSEIYQEISDRI 336 ++ ++ S ++ Y+E++ +I Sbjct: 225 VIEYDPESKQADEYRELARKI 245 >gnl|CDD|73214 cd00550, ArsA_ATPase, Oxyanion-translocating ATPase (ArsA). This ATPase is involved in transport of arsenite, antimonite or other oxyanions across biological membranes in all three kingdoms of life. ArsA contains a highly conserved AAA motif present in the AAA+ ATPase superfamily associated with a variety of cellular activities. To form a functional ATP-driven pump, ArsA interacts with the permease ArsB, which is a channel-forming integral membrane protein. One of the most interesting features of ArsA is the allosteric activation by its transport substrates. A divalent cation, typically Mg2+, is required for its enzymatic activity.. Length = 254 Score = 42.6 bits (100), Expect = 2e-04 Identities = 37/194 (19%), Positives = 69/194 (35%), Gaps = 33/194 (17%) Query: 102 SGKGGVGKSTTVVNIACALKNKGKNVAILD-------ADVYGPSIPKL-LKISGK----- 148 GKGGVGK+T A L +GK V ++ +D + K + G Sbjct: 6 GGKGGVGKTTISAATAVRLAEQGKKVLLVSTDPAHSLSDSFNQEFGKGPTPVKGVENLSA 65 Query: 149 VEISDKKFLKPKENYG-----IKIMSMASLVDENVAMIWRGPMVQ--SAIMHMLHNVVWG 201 +EI ++ L +E I+ + ++ + P ++ +A + Sbjct: 66 MEIDPQEAL--EEYRQEVLEPIEANLLLEMLKGILEEELESPGIEEIAAFDEFSRYIDEA 123 Query: 202 QLDFLLIDMPP-----------GTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISM 250 + D ++ D P I + +V P+ ++L + +RAI Sbjct: 124 EYDVVVFDTAPTGHTLRLLSLPTVLSWAREILSDPERTSFRLVCIPEKMSLYETERAIQE 183 Query: 251 YQKMNIPIIGMIEN 264 K I + +I N Sbjct: 184 LAKYGIDVDAVIVN 197 >gnl|CDD|73297 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH). CODH from Rhodospirillum rubrum catalyzes the reversible oxidation of CO to CO2. CODH contains a nickel-iron-sulfur cluster (C-center) and an iron-sulfur cluster (B-center). CO oxidation occurs at the C-center. Three accessory proteins encoded by cooCTJ genes are involved in nickel incorporation into a nickel site. CooC functions as a nickel insertase that mobilizes nickel to apoCODH using energy released from ATP hydrolysis. CooC is a homodimer and has NTPase activities. Mutation at the P-loop abolishs its function.. Length = 116 Score = 41.7 bits (98), Expect = 3e-04 Identities = 17/32 (53%), Positives = 21/32 (65%) Query: 102 SGKGGVGKSTTVVNIACALKNKGKNVAILDAD 133 +GKGGVGK+T +A L KGK V +DAD Sbjct: 5 TGKGGVGKTTIAALLARYLAEKGKPVLAIDAD 36 >gnl|CDD|48371 cd02117, NifH_like, This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase. Members of this family use energey from ATP hydrolysis and transfer electrons through a Fe4-S4 cluster to other subunit for reduction of substrate.. Length = 212 Score = 41.7 bits (98), Expect = 3e-04 Identities = 16/31 (51%), Positives = 20/31 (64%) Query: 103 GKGGVGKSTTVVNIACALKNKGKNVAILDAD 133 GKGG+GKSTT N++ AL GK V + D Sbjct: 7 GKGGIGKSTTSQNLSAALAEMGKKVLQVGCD 37 >gnl|CDD|31539 COG1348, NifH, Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism]. Length = 278 Score = 41.4 bits (97), Expect = 3e-04 Identities = 18/31 (58%), Positives = 21/31 (67%) Query: 103 GKGGVGKSTTVVNIACALKNKGKNVAILDAD 133 GKGG+GKSTT N+A AL GK V I+ D Sbjct: 8 GKGGIGKSTTSQNLAAALAELGKKVLIVGCD 38 Score = 33.3 bits (76), Expect = 0.10 Identities = 13/49 (26%), Positives = 26/49 (53%) Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQ 337 AE++G + VP D V+ G ++ + +S +E Y+E++ +I Sbjct: 199 AERLGTQLIHFVPRDNIVQKAELNGKTVIEYAPDSNQAEEYRELAKKIL 247 >gnl|CDD|143913 pfam00142, Fer4_NifH, 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family. Length = 269 Score = 40.4 bits (95), Expect = 7e-04 Identities = 17/31 (54%), Positives = 20/31 (64%) Query: 103 GKGGVGKSTTVVNIACALKNKGKNVAILDAD 133 GKGG+GKSTT N + AL GK V I+ D Sbjct: 7 GKGGIGKSTTSQNTSAALAEMGKKVLIVGCD 37 Score = 26.9 bits (60), Expect = 7.6 Identities = 10/48 (20%), Positives = 22/48 (45%) Query: 289 AEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRI 336 AE +G + VP D V+ ++ + ++ Y+E++ +I Sbjct: 197 AEALGTQMIHFVPRDNIVQKAELNKQTVIEYAPTCNQAKEYRELARKI 244 >gnl|CDD|48379 cd03115, SRP, The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.. Length = 173 Score = 39.3 bits (92), Expect = 0.001 Identities = 21/52 (40%), Positives = 31/52 (59%) Query: 97 FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGK 148 V + G GVGK+TT +A LK KGK V ++ AD Y P+ + L++ G+ Sbjct: 1 TVILLVGLQGVGKTTTAAKLALYLKKKGKKVLLVAADTYRPAAIEQLRVLGE 52 >gnl|CDD|177011 CHL00072, chlL, photochlorophyllide reductase subunit L. Length = 290 Score = 39.3 bits (92), Expect = 0.001 Identities = 16/25 (64%), Positives = 19/25 (76%) Query: 103 GKGGVGKSTTVVNIACALKNKGKNV 127 GKGG+GKSTT NI+ AL +GK V Sbjct: 7 GKGGIGKSTTSCNISIALARRGKKV 31 >gnl|CDD|48362 cd02032, Bchl_like, This family of proteins contains bchL and chlL. Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls. Three genes, bchL, bchN and bchB, are involved in light-independent protochlorophyllide reduction in bacteriochlorophyll biosynthesis. In cyanobacteria, algae, and gymnosperms, three similar genes, chlL, chlN and chlB are involved in protochlorophyllide reduction during chlorophylls biosynthesis. BchL/chlL, bchN/chlN and bchB/chlB exhibit significant sequence similarity to the nifH, nifD and nifK subunits of nitrogenase, respectively. Nitrogenase catalyzes the reductive formation of ammonia from dinitrogen.. Length = 267 Score = 39.1 bits (91), Expect = 0.002 Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 103 GKGGVGKSTTVVNIACALKNKGKNV 127 GKGG+GKSTT N++ AL +GK V Sbjct: 7 GKGGIGKSTTSSNLSVALAKRGKKV 31 >gnl|CDD|73340 cd03111, CpaE_like, This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster. The function of these proteins are unkown. The Caulobacter pilus assembly contains 7 genes: pilA, cpaA, cpaB, cpaC, cpaD, cpaE and cpaF. These genes are clustered together on chromosome.. Length = 106 Score = 38.7 bits (90), Expect = 0.002 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 98 VAVASGKGGVGKSTTVVNIACAL-KNKGKNVAILDAD 133 +A KGGVG +T N+A AL K G+ V ++D D Sbjct: 2 IAFIGAKGGVGATTLAANLAVALAKEAGRRVLLVDLD 38 >gnl|CDD|30352 COG0003, ArsA, Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 322 Score = 37.6 bits (87), Expect = 0.005 Identities = 29/138 (21%), Positives = 49/138 (35%), Gaps = 28/138 (20%) Query: 102 SGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKE 161 +GKGGVGK+T A L GK V ++ D P+ L + +E+ Sbjct: 8 TGKGGVGKTTIAAATAVKLAESGKKVLLVSTD---PA-HSLGDVFD-LELGHDPRKVGPN 62 Query: 162 NYGIKIMSMASL------VDENVAMIWRGPMVQSAIMHMLHN----------------VV 199 +++ +L V + +A + R + L V Sbjct: 63 LDALELDPEKALEEYWDEVKDYLARLLRTRGLGGIYADELATLPGIDEALALLKILEYYV 122 Query: 200 WGQLDFLLIDMPPGTGDA 217 G+ D +++D P TG Sbjct: 123 SGEYDVIVVDTAP-TGHT 139 >gnl|CDD|48378 cd03114, ArgK-like, The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.. Length = 148 Score = 37.1 bits (86), Expect = 0.007 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 8/72 (11%) Query: 102 SGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDK-KFLKPK 160 +G G GKST + + AL+ +GK VA+L D PS P SG + D+ + + Sbjct: 5 TGVPGAGKSTLIDALITALRARGKRVAVLAID---PSSPF----SGGAILGDRIRMERHA 57 Query: 161 ENYGIKIMSMAS 172 + G+ I S+A+ Sbjct: 58 SDPGVFIRSLAT 69 >gnl|CDD|30887 COG0541, Ffh, Signal recognition particle GTPase [Intracellular trafficking and secretion]. Length = 451 Score = 34.7 bits (80), Expect = 0.041 Identities = 18/43 (41%), Positives = 25/43 (58%) Query: 106 GVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGK 148 G GK+TT +A LK KGK V ++ AD Y P+ + LK + Sbjct: 110 GSGKTTTAGKLAKYLKKKGKKVLLVAADTYRPAAIEQLKQLAE 152 >gnl|CDD|35999 KOG0780, KOG0780, KOG0780, Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport]. Length = 483 Score = 33.7 bits (77), Expect = 0.068 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 4/87 (4%) Query: 61 NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACAL 120 N ++IIQ V + +V L + Q K V + G G GK+TT +A Sbjct: 70 NKRRIIQKA--VFDELVKLLDPGKSALQPKKG--KPSVIMFVGLQGSGKTTTCTKLAYYY 125 Query: 121 KNKGKNVAILDADVYGPSIPKLLKISG 147 K KG VA++ AD + LK + Sbjct: 126 KKKGYKVALVCADTFRAGAFDQLKQNA 152 >gnl|CDD|31889 COG1703, ArgK, Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]. Length = 323 Score = 33.4 bits (76), Expect = 0.088 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 8/72 (11%) Query: 102 SGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDK-KFLKPK 160 +G G GKST + + L+ +G VA+L D PS P +G + D+ + + Sbjct: 57 TGVPGAGKSTLIEALGRELRERGHRVAVLAVD---PSSPF----TGGSILGDRIRMQRLA 109 Query: 161 ENYGIKIMSMAS 172 + G+ I S S Sbjct: 110 VDPGVFIRSSPS 121 >gnl|CDD|144151 pfam00448, SRP54, SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins. Length = 196 Score = 33.3 bits (77), Expect = 0.091 Identities = 13/30 (43%), Positives = 20/30 (66%) Query: 106 GVGKSTTVVNIACALKNKGKNVAILDADVY 135 G GK+TT+ +A LK +GK V ++ AD + Sbjct: 11 GSGKTTTIAKLAAYLKKQGKKVLLVAADTF 40 >gnl|CDD|30898 COG0552, FtsY, Signal recognition particle GTPase [Intracellular trafficking and secretion]. Length = 340 Score = 32.9 bits (75), Expect = 0.11 Identities = 36/138 (26%), Positives = 62/138 (44%), Gaps = 12/138 (8%) Query: 6 KNQIVDSLKVLSIPGEKNNIVE--MQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ 63 K +K L + K + E ++ L E+ I + + + I +L+ R + Sbjct: 45 KKNFGKGIKGLFLKKIKEKLDEDLLEELEELLIEAD---VGVETAEEIIEELRK-REGKK 100 Query: 64 QIIQNIPTVKNAVV-TLTENKNPPQQRNNLNV-----KKFVAVASGKGGVGKSTTVVNIA 117 + I++ TVK A+ L E P + + K FV + G GVGK+TT+ +A Sbjct: 101 KKIKDEETVKEALREALIEILRPVDKVDLPLEIPKEKKPFVILFVGVNGVGKTTTIAKLA 160 Query: 118 CALKNKGKNVAILDADVY 135 LK +GK+V + D + Sbjct: 161 KYLKQQGKSVLLAAGDTF 178 >gnl|CDD|31609 COG1419, FlhF, Flagellar GTP-binding protein [Cell motility and secretion]. Length = 407 Score = 32.6 bits (74), Expect = 0.14 Identities = 36/178 (20%), Positives = 64/178 (35%), Gaps = 13/178 (7%) Query: 89 RNNLNVKKFVAVASGKGGVGKSTTVVNIAC--ALKNKGKNVAILDADVYGPSIPKLLKIS 146 N + +K V G GVGK+TT+ +A + K K VAI+ D Y + LK Sbjct: 196 ENLIVEQKRVIALVGPTGVGKTTTLAKLAARYVMLKKKKKVAIITTDTYRIGAVEQLKTY 255 Query: 147 GKVEISDKKFLKPKENYGIKIMSMAS----LVDENVAMIWRGPMVQSAIMHMLHNVVWGQ 202 + + + + I ++ LVD + + L +V Sbjct: 256 ADIMGVPLEVVYSPKELAEAIEALRDCDVILVD-TAGRSQYDKE-KIEELKELIDVSHSI 313 Query: 203 LDFLLIDMPPGTGDAHLTIAQ--KIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPI 258 +L++ D I Q P+ G++ T D + S+ + +P+ Sbjct: 314 EVYLVLSATTKYEDLKEIIKQFSLFPIDGLIF--TKLDETTS-LGNLFSLMYETRLPV 368 >gnl|CDD|146080 pfam03266, DUF265, Protein of unknown function, DUF265. Length = 168 Score = 31.8 bits (73), Expect = 0.31 Identities = 11/27 (40%), Positives = 16/27 (59%) Query: 102 SGKGGVGKSTTVVNIACALKNKGKNVA 128 +G GVGK+T V + LK++G V Sbjct: 5 TGPPGVGKTTLVKKVIELLKSEGVKVG 31 >gnl|CDD|111283 pfam02374, ArsA_ATPase, Anion-transporting ATPase. This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell. Length = 304 Score = 31.6 bits (72), Expect = 0.34 Identities = 14/32 (43%), Positives = 18/32 (56%) Query: 102 SGKGGVGKSTTVVNIACALKNKGKNVAILDAD 133 GKGGVGK+T A L +GK V ++ D Sbjct: 7 GGKGGVGKTTVSCATAVRLSEQGKKVLLVSTD 38 >gnl|CDD|31532 COG1341, COG1341, Predicted GTPase or GTP-binding protein [General function prediction only]. Length = 398 Score = 31.5 bits (71), Expect = 0.35 Identities = 17/42 (40%), Positives = 22/42 (52%) Query: 98 VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSI 139 V + G GKST +A L +G+ VAI+DADV I Sbjct: 75 VVMVVGPVDSGKSTLTTYLANKLLARGRKVAIIDADVGQSEI 116 >gnl|CDD|30875 COG0529, CysC, Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]. Length = 197 Score = 31.4 bits (71), Expect = 0.37 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Query: 85 PPQQRNNLNVKK-FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV 134 Q+R L +K V +G G GKST + L KG +V +LD D Sbjct: 11 TKQEREALKGQKGAVIWFTGLSGSGKSTIANALEEKLFAKGYHVYLLDGDN 61 >gnl|CDD|112137 pfam03308, ArgK, ArgK protein. The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems. Length = 267 Score = 30.4 bits (69), Expect = 0.77 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Query: 102 SGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIP 140 +G G GKST + + L+ +G VA+L D PS P Sbjct: 35 TGVPGAGKSTLIEALGMELRRRGHRVAVLAVD---PSSP 70 >gnl|CDD|34570 COG4963, CpaE, Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion]. Length = 366 Score = 29.9 bits (67), Expect = 0.92 Identities = 50/236 (21%), Positives = 93/236 (39%), Gaps = 38/236 (16%) Query: 98 VAVASGKGGVGKSTTVVNIACALKNK-GKNVAILDADVYGPSIPKLLKISGKVEISDKKF 156 +A KGGVG ST N+A L G V ++D D+ G + L I++ Sbjct: 107 LAFLGAKGGVGTSTLAHNLAKGLAILSGAAVLLVDLDLQGGTAALYLDQDPAFGIAEAVK 166 Query: 157 ------------LKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLD 204 L + G+K+++ + + +N + A+ +L +++ G D Sbjct: 167 QPERLDQVLLDSLLTRLASGLKLLAAPTELAKN------YDLKTGAVERLL-DLLRGSFD 219 Query: 205 FLLIDMPPGTGDAHLTIAQKIPLSG---VVIVSTPQDLALIDVKRAISMYQKMNIPIIGM 261 F+++D+P D + LSG +VIV+ P +L + K + +++ Sbjct: 220 FVVVDLPNIWTDWTRQV-----LSGSDEIVIVAEPSLASLRNAKELLDELKRLRPNDPKP 274 Query: 262 IENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMD-VRVLSDLGIPI 316 I ++ + DL E +GI L +PFD ++ G + Sbjct: 275 ILVLNRVGVPKRPEPSDL---------EEILGIESLLVLPFDPALFGDAANNGRML 321 >gnl|CDD|133262 cd01853, Toc34_like, Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts). This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90. The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex. The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle. Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein. Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic. Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon. Length = 249 Score = 29.6 bits (67), Expect = 1.3 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 8/48 (16%) Query: 103 GKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVE 150 GK GVGKS+T+ +I G+ A A + ++ ++SG V+ Sbjct: 38 GKTGVGKSSTINSIF------GERKAATSA--FQSETLRVREVSGTVD 77 >gnl|CDD|38036 KOG2825, KOG2825, KOG2825, Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism]. Length = 323 Score = 29.2 bits (65), Expect = 1.5 Identities = 13/31 (41%), Positives = 19/31 (61%) Query: 103 GKGGVGKSTTVVNIACALKNKGKNVAILDAD 133 GKGGVGK+T ++A L ++V I+ D Sbjct: 26 GKGGVGKTTCSCSLAVQLAKVRESVLIISTD 56 >gnl|CDD|33697 COG3910, COG3910, Predicted ATPase [General function prediction only]. Length = 233 Score = 29.1 bits (65), Expect = 1.9 Identities = 29/135 (21%), Positives = 51/135 (37%), Gaps = 21/135 (15%) Query: 89 RNNLNVKKFVAVASGKGGVGKSTTVVNIACALK----NKGKNVAILDADVYGPSIPKLLK 144 L + + +G+ G GKST + IA + GKN + D ++ K Sbjct: 30 EERLEFRAPITFITGENGSGKSTLLEAIAAGMGFNAAGGGKNFK-GELDASHSALVDYAK 88 Query: 145 ISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQS--------AIMHMLH 196 + + + FL+ + Y + AS +DE A +S + + + H Sbjct: 89 LHKRKKPPIGFFLRAESFYNV-----ASYLDE--ADGEANYGGRSLHHMSHGESFLAIFH 141 Query: 197 NVVWGQLDFLLIDMP 211 N GQ ++D P Sbjct: 142 NRFNGQ-GIYILDEP 155 >gnl|CDD|29986 cd01120, RecA-like_NTPases, RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.. Length = 165 Score = 28.9 bits (64), Expect = 2.0 Identities = 12/52 (23%), Positives = 20/52 (38%) Query: 103 GKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDK 154 G G GK+T + +A + KG V +D + + + L D Sbjct: 6 GPTGSGKTTLALQLALNIATKGGKVVYVDIEEEIEELTERLIGESLKGALDN 57 >gnl|CDD|33398 COG3598, RepA, RecA-family ATPase [DNA replication, recombination, and repair]. Length = 402 Score = 28.8 bits (64), Expect = 2.2 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 14/102 (13%) Query: 51 IAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENK--NPPQQRNNLNVKKFVAVASGKGGVG 108 A Q S +S I Q+ V+ + L+E N PQ + K +V++ G GVG Sbjct: 42 QAAQPHSRKSALVTITQSFIQVQAEAMRLSEWDRSNSPQLIDEFFRKGYVSILYGDSGVG 101 Query: 109 KSTTVVNIACAL-----------KNKGKNVAILDADVYGPSI 139 K+T ++ + AL K GK V + ++Y I Sbjct: 102 KTTLLLYLCIALAAGKNLFGNKVKEPGK-VLYVSLELYREDI 142 >gnl|CDD|48377 cd03113, CTGs, CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain. The enzymes hydrolyze the amide bond of glutamine to ammonia and glutamate at the glutaminase domains and transfer nascent ammonia to the acceptor substrate at the synthetase domain to form an aminated product. Glutaminase domains have evolved from the same ancestor, whereas the synthetase domains are evolutionarily unrelated and have different functions. This protein family is classified based on the N-terminal synthetase domain.. Length = 255 Score = 28.6 bits (64), Expect = 2.3 Identities = 12/41 (29%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Query: 96 KFVAVASG-KGGVGKSTTVVNIACALKNKGKNVAILDADVY 135 K++ V G +GK T ++ LK +G V D Y Sbjct: 1 KYIFVTGGVVSSLGKGITAASLGRLLKARGLKVTAQKLDPY 41 >gnl|CDD|73210 cd00477, FTHFS, Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate. FTHFS is a highly expressed key enzyme in both the Wood-Ljungdahl pathway of autotrophic CO2 fixation (acetogenesis) and the glycine synthase/reductase pathways of purinolysis. The key physiological role of this enzyme in acetogens is to catalyze the formylation of tetrahydrofolate, an initial step in the reduction of carbon dioxide and other one-carbon precursors to acetate. In purinolytic organisms, the enzymatic reaction is reversed, liberating formate from 10-formyltetrahydrofolate with concurrent production of ATP.. Length = 524 Score = 28.5 bits (64), Expect = 2.8 Identities = 10/24 (41%), Positives = 13/24 (54%) Query: 106 GVGKSTTVVNIACALKNKGKNVAI 129 G GK+TT + +A AL GK Sbjct: 52 GEGKTTTTIGLAQALNAHGKKAIA 75 >gnl|CDD|31331 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]. Length = 226 Score = 28.6 bits (64), Expect = 2.9 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Query: 91 NLNVKK--FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI 145 NL ++ FVA+ G G GKST + + K V I D+ S +L K+ Sbjct: 25 NLEIEAGEFVAI-VGPSGSGKSTLLNLLGGLDKPTSGEVLINGKDLTKLSEKELAKL 80 >gnl|CDD|110446 pfam01443, Viral_helicase1, Viral (Superfamily 1) RNA helicase. Helicase activity for this family has been demonstrated and NTPase activity. This helicase has multiple roles at different stages of viral RNA replication, as dissected by mutational analysis. Length = 226 Score = 28.5 bits (64), Expect = 3.1 Identities = 17/77 (22%), Positives = 27/77 (35%), Gaps = 11/77 (14%) Query: 100 VASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKP 159 V G G GKST + + + A L P L ++ + + FL Sbjct: 2 VVHGVPGCGKSTLIRKLLRTDLTVIRPTAEL----RTEGKPDLPNLNVR---TVDTFLMA 54 Query: 160 KENYGIKIMSMASLVDE 176 KI+ ++DE Sbjct: 55 LLKPTGKIL----ILDE 67 >gnl|CDD|146036 pfam03205, MobB, Molybdopterin guanine dinucleotide synthesis protein B. This protein contains a P-loop. Length = 122 Score = 28.5 bits (64), Expect = 3.1 Identities = 11/38 (28%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Query: 103 GKGGVGKSTTVVNIACALKNKGKNVA-ILDADVYGPSI 139 G GK+T + + LK +G VA + D I Sbjct: 7 GPKDSGKTTLIRKLLNYLKRRGYRVAVVKHLDHGQGEI 44 >gnl|CDD|31805 COG1618, COG1618, Predicted nucleotide kinase [Nucleotide transport and metabolism]. Length = 179 Score = 28.3 bits (63), Expect = 3.1 Identities = 13/27 (48%), Positives = 18/27 (66%) Query: 102 SGKGGVGKSTTVVNIACALKNKGKNVA 128 +G+ GVGK+T V+ IA L+ KG V Sbjct: 11 TGRPGVGKTTLVLKIAEKLREKGYKVG 37 >gnl|CDD|30850 COG0504, PyrG, CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]. Length = 533 Score = 28.2 bits (63), Expect = 3.2 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Query: 95 KKFVAVASG-KGGVGKSTTVVNIACALKNKGKNVAILDADVY 135 K++ V G +GK T ++ LK +G V I D Y Sbjct: 1 TKYIFVTGGVVSSLGKGITAASLGRLLKARGLKVTIQKLDPY 42 >gnl|CDD|29070 cd00155, RasGEF, Guanine nucleotide exchange factor for Ras-like small GTPases. Small GTP-binding proteins of the Ras superfamily function as molecular switches in fundamental events such as signal transduction, cytoskeleton dynamics and intracellular trafficking. Guanine-nucleotide-exchange factors (GEFs) positively regulate these GTP-binding proteins in response to a variety of signals. GEFs catalyze the dissociation of GDP from the inactive GTP-binding proteins. GTP can then bind and induce structural changes that allow interaction with effectors.. Length = 237 Score = 28.3 bits (63), Expect = 3.3 Identities = 22/106 (20%), Positives = 38/106 (35%), Gaps = 15/106 (14%) Query: 53 HQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTT 112 + L N ++ I+ + N V + P++R L + KF+ VA Sbjct: 38 DKNIHLSPNLERFIERFNNLSNWVASEILLCTNPKKRARL-LSKFIQVA----------- 85 Query: 113 VVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLK 158 L N +AI+ A + I +L K + KK + Sbjct: 86 --KHCRELNNFNSLMAIVSA-LSSSPISRLKKTWEVLSSKLKKLFE 128 >gnl|CDD|32626 COG2759, MIS1, Formyltetrahydrofolate synthetase [Nucleotide transport and metabolism]. Length = 554 Score = 28.3 bits (63), Expect = 3.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Query: 106 GVGKSTTVVNIACALKNKGKNVAI 129 G GK+TT + + AL GK I Sbjct: 66 GEGKTTTTIGLVDALNKLGKKAII 89 >gnl|CDD|35854 KOG0635, KOG0635, KOG0635, Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism]. Length = 207 Score = 28.0 bits (62), Expect = 3.7 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 8/46 (17%) Query: 92 LNVKKFVAVASGKGGVGKSTTVVNIACALK----NKGKNVAILDAD 133 L K V +G G GKST +ACAL +GK ILD D Sbjct: 27 LKQKGCVIWITGLSGSGKST----LACALSQALLQRGKLTYILDGD 68 >gnl|CDD|30200 cd02027, APSK, Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.. Length = 149 Score = 28.1 bits (63), Expect = 3.8 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 8/36 (22%) Query: 102 SGKGGVGKSTTVVNIACA----LKNKGKNVAILDAD 133 +G G GKST IA A L +G+ V +LD D Sbjct: 5 TGLSGSGKST----IARALEEKLFQRGRPVYVLDGD 36 >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.. Length = 151 Score = 27.9 bits (62), Expect = 3.8 Identities = 12/53 (22%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Query: 106 GVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLK 158 G GK+T IA L G L+A + + L ++ + L Sbjct: 29 GTGKTTLARAIANELFRPGAPFLYLNA----SDLLEGLVVAELFGHFLVRLLF 77 >gnl|CDD|38034 KOG2823, KOG2823, KOG2823, Cellular protein (glioma tumor suppressor candidate region gene 2) [General function prediction only]. Length = 438 Score = 28.1 bits (62), Expect = 3.9 Identities = 22/108 (20%), Positives = 38/108 (35%), Gaps = 6/108 (5%) Query: 59 RSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118 R T + V K+ + L + K A G+ + + Sbjct: 77 RKKVLDKKPKKITSNISKVQSPSTKSGHPNKIKLELSKKTAKI------GRKQAGLALPK 130 Query: 119 ALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIK 166 AL K ++ D++G K+ K+ V D+ FLK + G+K Sbjct: 131 ALVAKPGPQDTVERDLWGLDSTKIPKLDLDVWEQDEFFLKQVKKKGVK 178 >gnl|CDD|38952 KOG3748, KOG3748, KOG3748, Uncharacterized conserved protein [Function unknown]. Length = 477 Score = 28.2 bits (62), Expect = 3.9 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 4/99 (4%) Query: 80 TENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSI 139 T++ P +++ + AV G + +TVV G+ A+L + + P+ Sbjct: 242 TDSNEPIATPPTFSLQDWQAVEFSSSG-SQLSTVVRSEKGPAFLGEPTALLLSKIPPPNF 300 Query: 140 PKLLKISGKVEISDKKFLKP---KENYGIKIMSMASLVD 175 P KISGKV KK ++ EN G+ I M + D Sbjct: 301 PSEQKISGKVHFLPKKGMENVDLDENSGVSIYLMDKVQD 339 >gnl|CDD|37014 KOG1803, KOG1803, KOG1803, DNA helicase [Replication, recombination and repair]. Length = 649 Score = 28.0 bits (62), Expect = 4.2 Identities = 38/223 (17%), Positives = 69/223 (30%), Gaps = 32/223 (14%) Query: 88 QRNNLNVKKFVAVASGKGGVGKSTTVVNIA--CALKNKGKNVAILDADVYGPSIPKLLKI 145 N+ V + + K + A + S +LLK+ Sbjct: 71 PSNSFGPGDVVWLRTDKLNNKSKPCTEGVVYRVAEDSIDVAFEEEVDKPLTLSSLRLLKL 130 Query: 146 SGKVEI----SDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQS------------ 189 KV L N G + +L + + ++ Sbjct: 131 ENKVTYRRMKDTMICLSKFSNPGPSSDVVETLFGDRKPIPSPNIEIKKITFFNKNLNSSQ 190 Query: 190 --AIMHMLHNVVWGQLDFLLIDMPPGTGDAH---LTIAQKIPLSGVVIVSTPQDLALIDV 244 A+ ++N D L+I PPGTG I+Q + V+V P ++A+ ++ Sbjct: 191 KAAVSFAINNK-----DLLIIHGPPGTGKTRTLVEIISQLVKQKKRVLVCAPSNVAVDNI 245 Query: 245 KRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARF 287 ++ K+N+ +G + L S DL N Sbjct: 246 VERLTH-LKLNLVRVGHPARL---LESVADHSLDLLSNTKDNS 284 >gnl|CDD|32636 COG2805, PilT, Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 353 Score = 27.9 bits (62), Expect = 4.2 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 4/72 (5%) Query: 59 RSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIAC 118 R +++ IP+ + TL E PP R + + + +G G GKSTT+ + Sbjct: 91 RGGYALVLRLIPSK---IPTLEELGLPPIVRELAESPRGLILVTGPTGSGKSTTLAAMID 147 Query: 119 ALKNKGKNVAIL 130 + NK K IL Sbjct: 148 YI-NKHKAKHIL 158 >gnl|CDD|31982 COG1797, CobB, Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism]. Length = 451 Score = 27.9 bits (62), Expect = 4.5 Identities = 10/31 (32%), Positives = 16/31 (51%) Query: 98 VAVASGKGGVGKSTTVVNIACALKNKGKNVA 128 V +A G GK+T + + AL+ +G V Sbjct: 3 VVIAGTSSGSGKTTVTLGLMRALRRRGLKVQ 33 >gnl|CDD|29987 cd01121, Sms, Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.. Length = 372 Score = 27.5 bits (61), Expect = 5.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Query: 94 VKKFVAVASGKGGVGKSTTVVNIACALKNKGKNV 127 V V + G G+GKST ++ +A L +G V Sbjct: 80 VPGSVILIGGDPGIGKSTLLLQVAARLAKRGGKV 113 >gnl|CDD|72996 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domain 2 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.. Length = 246 Score = 27.6 bits (61), Expect = 5.2 Identities = 32/145 (22%), Positives = 54/145 (37%), Gaps = 24/145 (16%) Query: 98 VAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADV-YGPSIPKLLKISGKVEISDKKF 156 V G G+GK+T + +A LK ++ I V Y P I E + + Sbjct: 27 VIGILGPNGIGKTTFIKMLAGVLKPDEGDIEIELDTVSYKPQ-----YIKADYEGTVRDL 81 Query: 157 LKPK----------ENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFL 206 L + K + + ++D V + G + + AI L D Sbjct: 82 LSSITKDFYTHPYFKTEIAKPLQIEQILDREVPELSGGELQRVAIAACLSK----DADIY 137 Query: 207 LIDMPPGTGDAHLTIAQKIPLSGVV 231 L+D P A+L + Q++ S V+ Sbjct: 138 LLDEP----SAYLDVEQRLMASKVI 158 >gnl|CDD|31265 COG1066, Sms, Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]. Length = 456 Score = 27.5 bits (61), Expect = 5.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Query: 94 VKKFVAVASGKGGVGKSTTVVNIACALKNKGK 125 V V + G G+GKST ++ +A L +GK Sbjct: 91 VPGSVILIGGDPGIGKSTLLLQVAARLAKRGK 122 >gnl|CDD|107288 cd06293, PBP1_LacI_like_11, Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor. Length = 269 Score = 27.4 bits (61), Expect = 6.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Query: 119 ALKNKGKNVAILDADVYGPSIPKL 142 L N N+ ++D DV G +PK+ Sbjct: 73 KLINSYGNIVLVDEDVPGAKVPKV 96 >gnl|CDD|110578 pfam01583, APS_kinase, Adenylylsulphate kinase. Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulfate. This domain contains an ATP binding P-loop motif. Length = 157 Score = 27.3 bits (61), Expect = 6.9 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 8/37 (21%) Query: 102 SGKGGVGKSTTVVNIACALKNK----GKNVAILDADV 134 +G G GKST IA AL+ K G +V +LD D Sbjct: 8 TGLSGSGKST----IANALERKLFAQGISVYVLDGDN 40 >gnl|CDD|145169 pfam01861, DUF43, Protein of unknown function DUF43. This family includes archaebacterial proteins of unknown function. All the members are 350-400 amino acids long. Length = 243 Score = 27.0 bits (60), Expect = 8.5 Identities = 12/53 (22%), Positives = 22/53 (41%), Gaps = 14/53 (26%) Query: 116 IACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIM 168 +A AL K +A++D D +L+K ++ K +E I+ Sbjct: 59 LAAALTGLPKRIAVVDID------ERLIKF-------IERVAK-EEGLKIEAF 97 >gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 211 Score = 26.6 bits (59), Expect = 9.9 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Query: 91 NLNVKK--FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGK 148 +L +KK FV + G G GKST + + L V + D+ S+ +L + G Sbjct: 21 SLTIKKGEFVLIV-GPNGSGKSTLLRLLNGLLGPTSGEVLVDGKDLTKLSLKELRRKVGL 79 Query: 149 V 149 V Sbjct: 80 V 80 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.135 0.381 Gapped Lambda K H 0.267 0.0703 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,980,318 Number of extensions: 211406 Number of successful extensions: 781 Number of sequences better than 10.0: 1 Number of HSP's gapped: 756 Number of HSP's successfully gapped: 100 Length of query: 341 Length of database: 6,263,737 Length adjustment: 94 Effective length of query: 247 Effective length of database: 4,232,491 Effective search space: 1045425277 Effective search space used: 1045425277 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 58 (26.2 bits)