RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780832|ref|YP_003065245.1| putative potassium uptake transport system protein [Candidatus Liberibacter asiaticus str. psy62] (628 letters) >d2bw3a2 c.55.3.12 (A:163-609) Transposase Hermes, catalytic domain {House fly (Musca domestica) [TaxId: 7370]} Length = 447 Score = 28.1 bits (61), Expect = 2.1 Identities = 13/65 (20%), Positives = 24/65 (36%), Gaps = 6/65 (9%) Query: 368 ESLVAAYGISVSGTMVISTIM----FSVFVHVCWKWKISKVIIFLFPLLSIEMTFLGANL 423 +S V G S + + + V +H ++ +I+ L L T N+ Sbjct: 5 KSAVEKDGASATIDLWTDNYIKRNFLGVTLHYHENNELRDLILGLKSLDFERST--AENI 62 Query: 424 FKVLD 428 +K L Sbjct: 63 YKKLK 67 >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Score = 27.8 bits (60), Expect = 2.7 Identities = 8/42 (19%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Query: 243 LGHFGRKPIQY--AWMVIFPALAINYLGQGALVLSNPEAIKD 282 L + P+ AW P L + ++ +PE ++ Sbjct: 13 LKDLQQDPLAVLLAWGRAHPRLFLPLPRFPLALIFDPEGVEG 54 >d1x87a_ e.51.1.1 (A:) Urocanate hydratase HutU {Bacillus stearothermophilus [TaxId: 1422]} Length = 545 Score = 27.1 bits (60), Expect = 4.0 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 13/56 (23%) Query: 286 MMFGGWFLPFAVLTATCATVIASQAVITGTF----SLARQAIHLGFLPRMKIFFTS 337 +M+G +TA I SQ ++ GT+ +ARQ H G I T+ Sbjct: 116 IMYGQ-------MTAGSWIYIGSQGIVQGTYETFAEVARQ--HFGGTLAGTITLTA 162 >d1uwka_ e.51.1.1 (A:) Urocanate hydratase HutU {Pseudomonas putida [TaxId: 303]} Length = 554 Score = 26.7 bits (59), Expect = 6.4 Identities = 15/56 (26%), Positives = 22/56 (39%), Gaps = 13/56 (23%) Query: 286 MMFGGWFLPFAVLTATCATVIASQAVITGTF----SLARQAIHLGFLPRMKIFFTS 337 M+G +TA I SQ ++ GT+ RQ H G + K T+ Sbjct: 124 AMYGQ-------MTAGSWIYIGSQGIVQGTYETFVEAGRQ--HYGGSLKGKWVLTA 170 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.327 0.141 0.422 Gapped Lambda K H 0.267 0.0621 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 2,283,956 Number of extensions: 105239 Number of successful extensions: 331 Number of sequences better than 10.0: 1 Number of HSP's gapped: 330 Number of HSP's successfully gapped: 22 Length of query: 628 Length of database: 2,407,596 Length adjustment: 91 Effective length of query: 537 Effective length of database: 1,158,166 Effective search space: 621935142 Effective search space used: 621935142 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 56 (25.6 bits)